File size: 6,768 Bytes
9789c9a b58af2f 9789c9a 13022ca 9789c9a 13022ca 9789c9a 13022ca 9789c9a 13022ca 9789c9a 605ea26 eba2fc8 13022ca cb69e76 9789c9a eba2fc8 13022ca eba2fc8 13022ca cb69e76 13022ca cb69e76 13022ca 77440de |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 |
---
task_categories:
- question-answering
- tabular-classification
- text-generation
language:
- en
tags:
- biology
- proteins
- amino-acids
size_categories:
- 100K<1M
---
# Protein Data Stability - Single Mutation
This repository contains data on the change in protein stability with a single mutation.
## Attribution of Data Sources
- **Primary Source**: Tsuboyama, K., Dauparas, J., Chen, J. et al. Mega-scale experimental analysis of protein folding stability in biology and design. Nature 620, 434–444 (2023). [Link to the paper](https://www.nature.com/articles/s41586-023-06328-6)
- **Dataset Link**: [Zenodo Record](https://zenodo.org/record/7992926)
As to where the dataset comes from in this broader work, the relevant dataset (#3) is shown in `dataset_table.jpeg` of this repository's files.
## Sample Protein Stability Data [subset of 4 columns]
| Base Protein Sequence | Mutation | ΔΔG_ML | Classification |
|-------------------------------------------------------------|----------|--------------------|-----------------|
| FDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRL | R63W | -0.2010871345320799 | neutral |
| FDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRL | R63Y | 0.0194756159891467 | neutral |
| FDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRL | R63F | 0.7231614929744659 | stabilising |
| FDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRL | R63P | -0.3668887752897785 | neutral |
| FDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRL | R63C | -0.5317304030261774 | destabilising |
## Dataset Structure
This dataset focuses on the differential deltaG of *unfolding* (mutation minus base) of various protein mutations and is derived from stability measurements (free energy of unfolding) measured by two proteases, trypsin and chymotrypsin.
### Columns (Trypsin):
- **name**: The name of the protein variant.
- **dna_seq**: The DNA sequence encoding the protein variant.
- **log10_K50_t**: The log10 of the K50 value measured with trypsin (a measure of stability).
- **log10_K50_t_95CI_high**: The upper bound of the 95% confidence interval for log10_K50_t.
- **log10_K50_t_95CI_low**: The lower bound of the 95% confidence interval for log10_K50_t.
- **log10_K50_t_95CI**: The width of the 95% confidence interval for log10_K50_t.
- **fitting_error_t**: A measure of error between the model and data for trypsin.
- **log10_K50unfolded_t**: The predicted log10 K50 value for the unfolded state with trypsin.
- **deltaG_t**: The ΔG stability calculated from the trypsin data.
- **deltaG_t_95CI_high**: The upper bound of the ΔG confidence interval from trypsin.
- **deltaG_t_95CI_low**: The lower bound of the ΔG confidence interval from trypsin.
- **deltaG_t_95CI**: The width of the ΔG confidence interval from trypsin.
### Columns (Chymotrypsin):
- **log10_K50_c**: Analogous to `log10_K50_t`, but for chymotrypsin.
- **log10_K50_c_95CI_high**: Upper bound of the 95% CI for `log10_K50_c`.
- **log10_K50_c_95CI_low**: Lower bound of the 95% CI for `log10_K50_c`.
- **log10_K50_c_95CI**: Width of the 95% CI for `log10_K50_c`.
- **fitting_error_c**: A measure of error between the model and data for chymotrypsin.
- **log10_K50unfolded_c**: Predicted log10 K50 value for the unfolded state with chymotrypsin.
- **deltaG_c**: ΔG stability calculated from the chymotrypsin data.
- **deltaG_c_95CI_high**: Upper bound of the ΔG CI from chymotrypsin.
- **deltaG_c_95CI_low**: Lower bound of the ΔG CI from chymotrypsin.
- **deltaG_c_95CI**: Width of the ΔG CI from chymotrypsin.
### Combined Data:
- **deltaG**: The combined ΔG estimate from both trypsin and chymotrypsin.
- **deltaG_95CI_high**: Upper bound of the combined ΔG confidence interval.
- **deltaG_95CI_low**: Lower bound of the combined ΔG confidence interval.
- **deltaG_95CI**: Width of the combined ΔG confidence interval.
### Protein Sequencing Data:
- **aa_seq_full**: The full amino acid sequence.
- **aa_seq**: A (sometimes shortened) amino acid sequence representing the protein.
- **mut_type**: The type of mutation introduced to the protein.
- **WT_name**: Name of the wild type variant.
- **WT_cluster**: Cluster classification for the wild type variant.
- **mutation**: Represented as a combination of amino acid and its position (e.g., F10N indicates changing the 10th amino acid (F) in a sequence for N).
- **base_aa_seq**: The base sequence of the protein before the mutation.
### Derived Data:
- **log10_K50_trypsin_ML**: Log10 value of K50 derived from a machine learning model using trypsin data.
- **log10_K50_chymotrypsin_ML**: Log10 value of K50 derived from a machine learning model using chymotrypsin data.
- **dG_ML**: ΔG derived from a machine learning model that makes use of stability measurements from both proteases.
- **ddG_ML**: Differential ΔG (mutation minus base) derived from a machine learning model.
### Classification:
- **Stabilizing_mut**: Indicates whether the mutation is stabilizing or not.
- **pair_name**: Name representation combining the wild type and mutation.
- **classification**: Classification based on `ddG_ML`:
- Rows below -0.5 standard deviations are classified as 'destabilising'.
- Rows above +0.5 standard deviations are classified as 'stabilising'.
- Rows between -0.5 and 0.5 standard deviations are classified as 'neutral'.
This dataset offers a comprehensive view of protein mutations, their effects, and how they relate to the stability measurements made with trypsin and chymotrypsin.
### Understanding ΔG (delta G)
ΔG is the Gibbs free energy change of a process, dictating whether a process is thermodynamically favorable:
- **Negative ΔG**: Indicates the process is energetically favorable. For protein unfolding, it implies the protein is more stable in its unfolded form.
- **Positive ΔG**: Indicates the process is not energetically favorable. In protein unfolding, it means the protein requires energy to maintain its unfolded state, i.e. it is stable in folded form.
The **delta delta G** (ΔΔG) represents the deltaG of the mutation compared to the base protein:
- **Positive ΔΔG**: Suggests the mutation enhances protein stability.
- **Negative ΔΔG**: Suggests the mutation decreases protein stability.
### Data Cleanup and Validation:
1. Filtering: The dataset has been curated to only include examples of single mutations.
2. Sequence mutations were extracted from the row names. Base mutations are labelled as 'base'.
3. Consistency Check: Only rows with a consistent 'mutation', aligned with both the base and mutated sequences from the raw data, have been retained. |