File size: 4,095 Bytes
9789c9a b58af2f 9789c9a 13022ca 9789c9a 13022ca 9789c9a 77440de 13022ca 9789c9a 13022ca 9789c9a 605ea26 13022ca cb69e76 9789c9a cb69e76 13022ca cb69e76 605ea26 13022ca cb69e76 13022ca cb69e76 13022ca 77440de |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 |
---
task_categories:
- question-answering
- tabular-classification
- text-generation
language:
- en
tags:
- biology
- proteins
- amino-acids
size_categories:
- 100K<1M
extra_gated_prompt: "Access to this dataset requires a purchase [here](https://buy.stripe.com/6oEbJu5tPci79IQcMX)"
extra_gated_fields:
Name: text
Affiliation: text
Email: text
I have purchased a license: checkbox
---
# Protein Data Stability - Single Mutation
This repository contains data on the change in protein stability with a single mutation.
There are two datasets:
- [Sample dataset, ~100 datapoints](https://huggingface.co/datasets/Trelis/protein_stability_single_mutation_SAMPLE).
- [Gated dataset, ~250k datapoints](https://huggingface.co/datasets/Trelis/protein_stability_single_mutation).
## Attribution of Data Sources
- **Primary Source**: Tsuboyama, K., Dauparas, J., Chen, J. et al. Mega-scale experimental analysis of protein folding stability in biology and design. Nature 620, 434–444 (2023). [Link to the paper](https://www.nature.com/articles/s41586-023-06328-6)
- **Dataset Link**: [Zenodo Record](https://zenodo.org/record/7992926)
As to where the dataset comes from in this broader work, the relevant dataset (#3) is shown in `dataset_table.jpeg` of this repository's files.
## Sample Protein Stability Data
| Base Protein Sequence | Mutation | ΔΔG_ML | Classification |
|-------------------------------------------------------------|----------|--------------------|-----------------|
| FDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRL | R63W | -0.2010871345320799 | neutral |
| FDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRL | R63Y | 0.0194756159891467 | neutral |
| FDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRL | R63F | 0.7231614929744659 | stabilising |
| FDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRL | R63P | -0.3668887752897785 | neutral |
| FDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRL | R63C | -0.5317304030261774 | destabilising |
## Dataset Structure
The dataset focuses on the differential deltaG of *unfolding* (mutation minus base) of various protein mutations.
- **Base Protein Sequence** (`aa_seq`): A (sometimes shortened) amino acid sequence.
- **Mutation**: Represented as a combination of amino acid and its position (e.g., F10N indicates changing the 10th amino acid (F) in a sequence for N).
- **delta deltaG** (`ddG_ML`): Derived from a model that makes use of stability measurements (free energy of unfolding) measured by two proteases, trypsin and chymotrypsin.
- **Classification**: Classification is done purely on the basis of ddG.
-- Rows below -0.5 standard deviations are classified as 'destabilising'
-- Rows above +0.5 standard deviations are classified as 'stabilising'
-- Rows between -0.5 and 0.5 standard deviations are classified as 'neutral'
### Understanding ΔG (delta G)
ΔG is the Gibbs free energy change of a process, dictating whether a process is thermodynamically favorable:
- **Negative ΔG**: Indicates the process is energetically favorable. For protein unfolding, it implies the protein is more stable in its unfolded form.
- **Positive ΔG**: Indicates the process is not energetically favorable. In protein unfolding, it means the protein requires energy to maintain its unfolded state, i.e. it is stable in folded form.
The **delta delta G** (ΔΔG) represents the deltaG of the mutation compared to the base protein:
- **Positive ΔΔG**: Suggests the mutation enhances protein stability.
- **Negative ΔΔG**: Suggests the mutation decreases protein stability.
### Data Cleanup and Validation:
1. Filtering: The dataset has been curated to only include examples of single mutations.
2. Sequence mutations were extracted from the row names. Base mutations are labelled as 'base'.
3. Consistency Check: Only rows with a consistent 'mutation', aligned with both the base and mutated sequences from the raw data, have been retained. |