Edit model card

ESM-2 Sequence Classifier

This is a small sequence classifier trained on synthetic data generated by GPT-4 which classifies protein sequences into three categories enzymes (class 0), receptor_proteins (class 1), and structural_proteins (class 2). This is trained using facebook/esm2_t6_8M_UR50D, one of the ESM-2 models.

This model is not well tested, and is for experimental and eductaional purposes. Use with caution.

Using the Model

To use the model, try running:

# Load the trained model and tokenizer
model = EsmForSequenceClassification.from_pretrained("AmelieSchreiber/esm2_t6_8M_UR50D_sequence_classifier_v1")
tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t6_8M_UR50D")

# Suppose these are your new sequences that you want to classify
# Additional Family 0: Enzymes
new_sequences_0 = [
    "ACGYLKTPKLADPPVLRGDSSVTKAICKPDPVLEK",
    "GVALDECKALDYLPGKPLPMDGKVCQCGSKTPLRP",
    "VLPGYTCGELDCKPGKPLPKCGADKTQVATPFLRG",
    "TCGALVQYPSCADPPVLRGSDSSVKACKKLDPQDK",
    "GALCEECKLCPGADYKPMDGDRLPAAATSKTRPVG",
    "PAVDCKKALVYLPKPLPMDGKVCRGSKTPKTRPYG",
    "VLGYTCGALDCKPGKPLPKCGADKTQVATPFLRGA",
    "CGALVQYPSCADPPVLRGSDSSVKACKKLDPQDKT",
    "ALCEECKLCPGADYKPMDGDRLPAAATSKTRPVGK",
    "AVDCKKALVYLPKPLPMDGKVCRGSKTPKTRPYGR",
]

# Additional Family 1: Receptor Proteins
new_sequences_1 = [
    "VGQRFYGGRQKNRHCELSPLPSACRGSVQGALYTD",
    "KDQVLTVPTYACRCCPKMDSKGRVPSTLRVKSARS",
    "PLAGVACGRGLDYRCPRKMVPGDLQVTPATQRPYG",
    "CGVRLGYPGCADVPLRGRSSFAPRACMKKDPRVTR",
    "RKGVAYLYECRKLRCRADYKPRGMDGRRLPKASTT",
    "RPTGAVNCKQAKVYRGLPLPMMGKVPRVCRSRRPY",
    "RLDGGYTCGQALDCKPGRKPPKMGCADLKSTVATP",
    "LGTCRKLVRYPQCADPPVMGRSSFRPKACCRQDPV",
    "RVGYAMCSPKLCSCRADYKPPMGDGDRLPKAATSK",
    "QPKAVNCRKAMVYRPKPLPMDKGVPVCRSKRPRPY",
]

# Additional Family 2: Structural Proteins
new_sequences_2 = [
    "VGKGFRYGSSQKRYLHCQKSALPPSCRRGKGQGSAT",
    "KDPTVMTVGTYSCQCPKQDSRGSVQPTSRVKTSRSK",
    "PLVGKACGRSSDYKCPGQMVSGGSKQTPASQRPSYD",
    "CGKKLVGYPSSKADVPLQGRSSFSPKACKKDPQMTS",
    "RKGVASLYCSSKLSCKAQYSKGMSDGRSPKASSTTS",
    "RPKSAASCEQAKSYRSLSLPSMKGKVPSKCSRSKRP",
    "RSDVSYTSCSQSKDCKPSKPPKMSGSKDSSTVATPS",
    "LSTCSKKVAYPSSKADPPSSGRSSFSMKACKKQDPPV",
    "RVGSASSEPKSSCSVQSYSKPSMSGDSSPKASSTSK",
    "QPSASNCEKMSSYRPSLPSMSKGVPSSRSKSSPPYQ",
]

# Tokenize the sequences and convert to tensors
# Merge all sequences
new_sequences = new_sequences_0 + new_sequences_1 + new_sequences_2
inputs = tokenizer(new_sequences, return_tensors="pt", padding=True, truncation=True)

# Use the model to get the logits
with torch.no_grad():
    logits = model(**inputs).logits

# Get the predicted class for each sequence
predicted_class_ids = torch.argmax(logits, dim=-1)

# Print the predicted class for each sequence
for sequence, predicted_class in zip(new_sequences, predicted_class_ids):
    print(f"Sequence: {sequence}, Predicted class: {predicted_class.item()}")
Downloads last month
84
Safetensors
Model size
7.84M params
Tensor type
F32
·
This model does not have enough activity to be deployed to Inference API (serverless) yet. Increase its social visibility and check back later, or deploy to Inference Endpoints (dedicated) instead.