YAML Metadata Warning: empty or missing yaml metadata in repo card (https://huggingface.co/docs/hub/model-cards#model-card-metadata)

NeuroPred-PLM: an interpretable and robust model for prediction of neuropeptides by protein language model

PyPI - Version PyPI - Python Version GitHub - LICENSE PyPI - Downloads

Requirements

To install requirements:

# latest version
pip install git+https://github.com/ISYSLAB-HUST/NeuroPred-PLM.git
# stable version
pip install NeuroPredPLM

Usage

import torch
from NeuroPredPLM.predict import predict
data = [
    ("peptide_1", "IGLRLPNMLKF"),
    ("peptide_2", "QAAQFKVWSASELVD"),
    ("peptide_3","LRSPKMMHKSGCFGRRLDRIGSLSGLGCNVLRKY")
]

device = "cuda" if torch.cuda.is_available() else "cpu" 
neuropeptide_pred = predict(data,device)
# {peptide_id:[Type:int(1->neuropeptide,0->non-neuropeptide), attention score:nd.array]}

License

Released under the MIT license.

Contact

If you have any questions, comments, or would like to report a bug, please file a Github issue or contact me at wanglei94@hust.edu.cn.

Downloads last month

-

Downloads are not tracked for this model. How to track
Inference Providers NEW
This model is not currently available via any of the supported Inference Providers.
The model cannot be deployed to the HF Inference API: The model has no library tag.