File size: 13,461 Bytes
2fdc721 689b0f7 4688169 594ef1a 689b0f7 4688169 689b0f7 594ef1a 689b0f7 594ef1a 689b0f7 594ef1a 689b0f7 594ef1a b146506 689b0f7 726c8aa b01c7d0 6c50e03 bed1eb8 6c50e03 b9c732b f77192c 9ec50fb 3ca38f4 b9c732b 6c50e03 33f5122 6c50e03 33f5122 6c50e03 33f5122 6c50e03 33f5122 6c50e03 33f5122 6c50e03 33f5122 6c50e03 33f5122 b8f41d8 6c50e03 33f5122 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 |
---
extra_gated_heading: Acknowledge license to accept the repository
extra_gated_prompt: >
The Beijing Academy of Artificial Intelligence (hereinafter referred to as
"we" or "BAAI") provides you with an open-source dataset (hereinafter referred
to as "dataset") through the OPI HuggingFace repository
(https://huggingface.co/datasets/BAAI/OPI). You can download the dataset you
need and use it for purposes such as learning and research while abiding by
the usage rules of each original dataset.
Before you acquire the open-source dataset (including but not limited to
accessing, downloading, copying, distributing, using, or any other handling of
the dataset), you should read and understand this "OPI Open-Source Dataset
Usage Notice and Disclaimer" (hereinafter referred to as "this statement").
Once you acquire the open-source dataset, regardless of your method of
acquisition, your actions will be regarded as acknowledgment of the full
content of this statement.
1. Ownership and Operation Rights
You should fully understand that the ownership and operation rights of the OPI
HuggingFace repository (including the current and all previous versions)
belong to BAAI. BAAI has the final interpretation and decision rights over
this platform/tool and the open-source dataset plan.
You acknowledge and understand that due to updates and improvements in
relevant laws and regulations and the need to fulfill our legal compliance
obligations, we reserve the right to update, maintain, or even suspend or
permanently terminate the services of this platform/tool from time to time. We
will notify you of possible situations mentioned above reasonably such as
through an announcement or email within a reasonable time. You should make
corresponding adjustments and arrangements in a timely manner. However, we do
not bear any responsibility for any losses caused to you by any of the
aforementioned situations.
2. Claim of Rights to Open-Source Datasets
For the purpose of facilitating your dataset acquisition and use for learning,
and research, we have performed necessary steps such as format integration,
data cleaning, labeling, categorizing, annotating, and other related
processing on the third-party original datasets to form the open-source
datasets for this platform/tool's users.
You understand and acknowledge that we do not claim the proprietary rights of
intellectual property to the open-source datasets. Therefore, we have no
obligation to actively recognize and protect the potential intellectual
property of the open-source datasets. However, this does not mean that we
renounce the personal rights to claim credit, publication, modification, and
protection of the integrity of the work (if any) of the open-source datasets.
The potential intellectual property and corresponding legal rights of the
original datasets belong to the original rights holders.
In addition, providing you with open-source datasets that have been reasonably
arranged, processed, and handled does not mean that we acknowledge the
authenticity, accuracy, or indisputability of the intellectual property and
information content of the original datasets. You should filter and carefully
discern the open-source datasets you choose to use. You understand and agree
that BAAI does not undertake any obligation or warranty responsibility for any
defects or flaws in the original datasets you choose to use.
3. Usage Restrictions for Open-Source Datasets
Your use of the dataset must not infringe on our or any third party's legal
rights and interests (including but not limited to copyrights, patent rights,
trademark rights, and other intellectual property and other rights).
After obtaining the open-source dataset, you should ensure that your use of
the open-source dataset does not exceed the usage rules explicitly stipulated
by the rights holders of the original dataset in the form of a public notice
or agreement, including the range, purpose, and lawful purposes of the use of
the original data. We kindly remind you here that if your use of the
open-source dataset exceeds the predetermined range and purpose of the
original dataset, you may face the risk of infringing on the legal rights and
interests of the rights holders of the original dataset, such as intellectual
property, and may bear corresponding legal responsibilities.
4. Personal Information Protection
Due to technical limitations and the public welfare nature of the open-source
datasets, we cannot guarantee that the open-source datasets do not contain any
personal information, and we do not bear any legal responsibility for any
personal information that may be involved in the open-source datasets.
If the open-source dataset involves personal information, we do not bear any
legal responsibility for any personal information processing activities you
may involve when using the open-source dataset. We kindly remind you here that
you should handle personal information in accordance with the provisions of
the "Personal Information Protection Law" and other relevant laws and
regulations.
To protect the legal rights and interests of the information subject and to
fulfill possible applicable laws and administrative regulations, if you find
content that involves or may involve personal information during the use of
the open-source dataset, you should immediately stop using the part of the
dataset that involves personal information and contact us as indicated in "6.
Complaints and Notices."
5. Information Content Management
We do not bear any legal responsibility for any illegal and bad information
that may be involved in the open-source dataset.
If you find that the open-source dataset involves or may involve any illegal
and bad information during your use, you should immediately stop using the
part of the dataset that involves illegal and bad information and contact us
in a timely manner as indicated in "6. Complaints and Notices."
6. Complaints and Notices
If you believe that the open-source dataset has infringed on your legal rights
and interests, you can contact us at 010-50955974, and we will handle your
claims and complaints in accordance with the law in a timely manner.
To handle your claims and complaints, we may need you to provide contact
information, infringement proof materials, and identity proof materials.
Please note that if you maliciously complain or make false statements, you
will bear all legal responsibilities caused thereby (including but not limited
to reasonable compensation costs).
7. Disclaimer
You understand and agree that due to the nature of the open-source dataset,
the dataset may contain data from different sources and contributors, and the
authenticity, accuracy, and objectivity of the data may vary, and we cannot
make any promises about the availability and reliability of any dataset.
In any case, we do not bear any legal responsibility for any risks such as
personal information infringement, illegal and bad information dissemination,
and intellectual property infringement that may exist in the open-source
dataset.
In any case, we do not bear any legal responsibility for any loss (including
but not limited to direct loss, indirect loss, and loss of potential benefits)
you suffer or is related to the open-source dataset.
8. Others
The open-source dataset is in a constant state of development and change. We
may update, adjust the range of the open-source dataset we provide, or
suspend, pause, or terminate the open-source dataset service due to business
development, third-party cooperation, changes in laws and regulations, and
other reasons.
extra_gated_fields:
Name: text
Affiliation: text
Country: text
I agree to accept the license: checkbox
extra_gated_button_content: Acknowledge license
license: cc-by-nc-4.0
language:
- en
tags:
- biology
- protein
- instruction dataset
- instruction tuning
pretty_name: Open Protein Instructions(OPI)
size_categories:
- 1M<n<10M
task_categories:
- text-generation
---

# Dataset Card for Open Protein Instructions (OPI)
## Dataset Update
The previous version of OPI dataset is based on the **release 2022_01** of UniProtKB/Swiss-Prot protein knowledgebase. At current, OPI is updated to contain the latest **release 2023_05**, which can be accessed via the dataset file [OPI_updated_160k.json](./OPI_DATA/OPI_updated_160k.json).
Reference:
- https://ftp.uniprot.org/pub/databases/uniprot/previous_releases/release-2022_01/knowledgebase/UniProtKB_SwissProt-relstat.html
- https://ftp.uniprot.org/pub/databases/uniprot/previous_releases/release-2023_05/knowledgebase/UniProtKB_SwissProt-relstat.html
## Dataset Description
- **Homepage:**
- **Repository:**
- **Paper:**
- **Leaderboard:**
- **Point of Contact:**
### Dataset Summary
Open Protein Instructions(OPI) is the initial part of Open Biology Instructions(OBI) project, together with the subsequent Open Molecule Instructions(OMI), Open DNA Instructions(ODI), Open RNA Instructions(ORI) and Open Single-cell Instructions (OSCI). OBI is a project which aims to fully leverage the potential ability of Large Language Models(LLMs), especially the scientific LLMs like Galactica, to facilitate research in AI for Life Science community. While OBI is still in an early stage, we hope to provide a starting point for the community to bridge LLMs and biological domain knowledge.
## Dataset Structure
### Data Instances
```
instruction:
What is the EC classification of the input protein sequence based on its biological function?
input:
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARS
LVTGREGYVPSNFVARVESLEMERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSL
QALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQSLRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLV
RLYAVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIERMNSIHRDLRAANILVSEALCCKIADFGLARIIDSEYTAQEGAK
FPIKWTAPEAIHFGVFTIKADVWSFGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEERPTFEFLQSVLEDFYT
ATERQYELQP
output:
2.7.10.2
```
### Data Splits
The OPI dataset folder structure is as follows:
```
./OPI_DATA/
βββ AP
β βββ Function
β β βββ test
β β β βββ CASPSimilarSeq_function_test.jsonl
β β β βββ IDFilterSeq_function_test.jsonl
β β β βββ UniProtSeq_function_test.jsonl
β β βββ train
β β βββ function_description_train.json
β β βββ function_description_train_0.01.json
β βββ GO
β β βββ test
β β β βββ CASPSimilarSeq_go_test.jsonl
β β β βββ IDFilterSeq_go_test.jsonl
β β β βββ UniProtSeq_go_test.jsonl
β β βββ train
β β βββ go_terms_train.json
β β βββ go_terms_train_0.01.json
β βββ Keywords
β βββ test
β β βββ CASPSimilarSeq_keywords_test.jsonl
β β βββ IDFilterSeq_keywords_test.jsonl
β β βββ UniProtSeq_keywords_test.jsonl
β βββ train
β βββ keywords_train.json
β βββ keywords_train_0.01.json
βββ KM
β βββ gSymbol2Cancer
β β βββ test
β β β βββ gene_symbol_to_cancer_test.jsonl
β β βββ train
β β βββ gene_symbol_to_cancer_train.json
β βββ gName2Cancer
β β βββ test
β β β βββ gene_name_to_cancer_test.jsonl
β β βββ train
β β βββ gene_name_to_cancer_train.json
β βββ gSymbol2Tissue
β βββ test
β β βββ gene_symbol_to_tissue_test.jsonl
β βββ train
β βββ gene_symbol_to_tissue_train.json
βββ SU
βββ EC_number
β βββ test
β β βββ CLEAN_EC_number_new_test.jsonl
β β βββ CLEAN_EC_number_price_test.jsonl
β βββ train
β βββ CLEAN_EC_number_train.json
βββ Fold_type-Remote
β βββ test
β β βββ Remote_test.jsonl
β βββ train
β βββ Remote_train.json
βββ Subcellular_location
βββ test
β βββ location_test.jsonl
βββ train
βββ location_train.json
```
## Dataset Creation
The OPI dataset is curated on our own by extracting key information from [Swiss-Prot](https://www.uniprot.org/uniprotkb?facets=reviewed%3Atrue&query=%2A) database. The detailed construction pipeline is depicted in the supplementary material of our manuscript which has been submitted to NeurIPS 2023 Datasets and Benchmarks. The following figure shows the general construction process.

## License
The dataset is licensed under a Creative Commons Attribution Non Commercial 4.0 License. The use of this dataset should also abide by the original [License & Disclaimer](https://www.uniprot.org/help/license) and [Privacy Notice](https://www.uniprot.org/help/privacy) of UniProt. |