File size: 19,493 Bytes
e740833 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 |
import re
import torch
from PIL import Image
from lavis.models import load_model_and_preprocess
from lavis.processors import load_processor
from lavis.common.registry import registry
from torch.nn import functional as F
from lavis.models.base_model import all_gather_with_grad, concat_all_gather
import numpy as np
import pandas as pd
import time
from fuzzywuzzy import process
from multiprocessing import Pool, Queue, Process
import difflib
import Levenshtein
import os
# import obonet
def fuzzy_match(texts):
text_dict = {}
for context in texts:
if context not in choices:
# txt_dict[txt] = process.extractOne(txt, choices)[0]
text_dict[context] = difflib.get_close_matches(context, choices, n=1, cutoff=0.)[0]
return text_dict
def txt_map(x, txt_dict):
if type(x) == str:
x = eval(x)
x_ = []
for i in x:
if i in txt_dict:
x_.append(txt_dict[i])
else:
x_.append(i)
return x_
def levenshtein_sim(text, label):
all_s = []
for x in label:
s = 0
for y in text:
temp = Levenshtein.ratio(x, y)
if temp > s:
s = temp
all_s.append(s)
all_s = [round(i, 3) for i in all_s]
return all_s
def func(text, label):
all_s = []
for x in label:
s = 0
for y in text:
temp = Levenshtein.ratio(x, y)
if temp > s:
s = temp
all_s.append(s)
all_s = [round(i, 3) for i in all_s]
return all_s
def stage2_output(df_test):
config = {'arch': 'blip2_protein_opt', 'load_finetuned': False,
'pretrained': '/cluster/home/wenkai/LAVIS/lavis/output/BLIP2/Pretrain_stage2/20230924220/checkpoint_5.pth',
'finetuned': '', 'num_query_token': 32, 'opt_model': 'facebook/opt-2.7b', 'prompt': '',
'model_type': 'pretrain_protein_opt2.7b', 'load_pretrained': True, 'freeze_vit': True,
'max_protein_len': 600,
'max_txt_len': 25}
model_cls = registry.get_model_class(config['arch'])
model = model_cls.from_config(config)
model.to(device)
model.eval()
images = df_test['protein'].tolist()
n = len(images)
bsz = 12
iter = n // bsz + 1
for i in range(iter):
image = images[i*bsz: min(n, (i+1)*bsz)]
image = [('protein{}'.format(i), x) for i, x in enumerate(image)]
with model.maybe_autocast():
_, _, batch_tokens = model.visual_encoder(image)
image_embeds = model.ln_vision(batch_tokens.to(device), repr_layers=[model.vis_layers], return_contacts=True)["representations"][model.vis_layers].contiguous()
image_atts = torch.ones(image_embeds.size()[:-1], dtype=torch.long).to(device)
query_tokens = model.query_tokens.expand(image_embeds.shape[0], -1, -1)
query_output = model.Qformer.bert(
query_embeds=query_tokens,
encoder_hidden_states=image_embeds,
encoder_attention_mask=image_atts,
return_dict=True,
)
inputs_opt = model.opt_proj(query_output.last_hidden_state)
atts_opt = torch.ones(inputs_opt.size()[:-1], dtype=torch.long).to(device)
model.opt_tokenizer.padding_side = "right"
text = ['' for i in range(len(image))]
opt_tokens = model.opt_tokenizer(
text,
return_tensors="pt",
padding="longest",
truncation=True,
max_length=model.max_txt_len,
).to(device)
inputs_embeds = model.opt_model.model.decoder.embed_tokens(opt_tokens.input_ids)
inputs_embeds = torch.cat([inputs_opt, inputs_embeds], dim=1)
attention_mask = torch.cat([atts_opt, opt_tokens.attention_mask], dim=1)
num_txt = 10
return_num_txt = 5
with model.maybe_autocast():
outputs = model.opt_model.generate(inputs_embeds=inputs_embeds, attention_mask=attention_mask, min_length=3,
max_length=30,
repetition_penalty=5., num_beams=num_txt, eos_token_id=50118,
length_penalty=1., num_return_sequences=return_num_txt, temperature=1.)
output_text = model.opt_tokenizer.batch_decode(outputs, skip_special_tokens=True)
output_text = [text.strip() for text in output_text]
output_text_ = []
for i in range(len(image)):
output_text_.append(';'.join(output_text[i * return_num_txt:(i + 1) * return_num_txt]))
with open('/cluster/home/wenkai/LAVIS/output/output{}.txt'.format(fix), 'a+') as f:
for i in range(len(image)):
f.write(image[i][1] + "|" + output_text_[i] + '\n')
cat = 'mf'
fix = '_mf'
if cat == 'bp':
fix = '_bp'
if cat == 'cc':
fix = '_cc'
# model_pth = {'mf': 'uniprot_swissprot_mf_stage1_epo19.pth', 'bp': 'checkpoint17_GO_swissprot_reviewed_bp_stage1.pth', 'cc': ''}
# graph = obonet.read_obo("http://purl.obolibrary.org/obo/go.obo")
# setup device to use
device = torch.device("cuda") if torch.cuda.is_available() else "cpu"
# device = 'cpu'
### Levenshtein similarity
test = pd.read_csv('/cluster/home/wenkai/LAVIS/data/sim_split/test{}.csv'.format(fix), sep='|')[:10000]
test['function'] = test['function'].apply(lambda x: x.lower())
if os.path.exists('/cluster/home/wenkai/LAVIS/output/output{}.txt'.format(fix)):
os.remove('/cluster/home/wenkai/LAVIS/output/output{}.txt'.format(fix))
print("stage 2 predict starting")
stage2_output(test)
print("stage 2 predict completed")
df_pred = pd.read_csv('/cluster/home/wenkai/LAVIS/output/output{}.txt'.format(fix), sep='|', header=None, on_bad_lines='warn')
df_pred.columns = ['protein', 'function']
df_pred = df_pred.drop_duplicates()
df_pred['function'] = df_pred['function'].apply(lambda x: str(x).split(';'))
df_pred['function'] = df_pred['function'].apply(lambda x: [i.strip() for i in list(set(x))])
test.columns
test_g = test.groupby(['protein']).agg({'function': lambda x: list(x)}).reset_index()
test_g.columns = ['protein', 'label']
data = pd.merge(df_pred, test_g, on='protein', how='left')
data = data[data['label'].notnull()]
sim = []
for text, label in zip(data['function'].tolist(), data['label'].tolist()):
sim.append(func(text, label))
data['sim'] = sim
data['avg_score'] = data['sim'].apply(lambda x: round(np.mean(x), 3))
print("average similarity score: {}".format(round(data['avg_score'].mean(), 3)))
# data.to_csv('/home/nilin/LAVIS/predict_{}.csv'.format(cat), index=False, sep='|')
test = pd.read_csv('/cluster/home/wenkai/LAVIS/data/sim_split/test{}.csv'.format(fix), sep='|', usecols=['function', 'GO_label'])
test['function'] = test['function'].apply(lambda x: x.lower())
test = test.drop_duplicates()
test_dict = dict(zip(test['function'], test['GO_label']))
val = pd.read_csv('/cluster/home/wenkai/LAVIS/data/sim_split/val{}.csv'.format(fix), sep='|', usecols=['function', 'GO_label'])
val['function'] = val['function'].apply(lambda x: x.lower())
val = val.drop_duplicates()
val_dict = dict(zip(val['function'], val['GO_label']))
train = pd.read_csv('/cluster/home/wenkai/LAVIS/data/sim_split/train{}.csv'.format(fix), sep='|', usecols=['function', 'GO_label'])
train['function'] = train['function'].apply(lambda x: x.lower())
train = train.drop_duplicates()
train_dict = dict(zip(train['function'], train['GO_label']))
# go_des = pd.read_csv('/home/nilin/LAVIS/data/go_descriptions_new.txt', sep='|', header=None)
# # go_des = pd.read_csv('/home/nilin/LAVIS/data/go_descriptions.txt', sep='|', header=None)
# go_des.columns = ['GO', 'function']
# go_des = go_des[go_des['function'].notnull()]
# go_des['function'] = go_des['function'].apply(lambda x: x.lower())
# GO_dict = dict(zip(go_des['function'], go_des['GO']))
GO_dict = {}
GO_dict.update(train_dict)
GO_dict.update(val_dict)
GO_dict.update(test_dict)
choices = list(GO_dict.keys())
# data = pd.read_csv('/home/nilin/LAVIS/predict_{}.csv'.format(cat), sep='|')
data = data.sort_values(by='protein')
data = data.drop_duplicates('protein')
# data = data.sample(1000)
### 预测的文本如果不在GO标签词中,则算作最相似的GO标签
t0 = time.time()
txt_dict = {}
all_txt = []
for txt in data['function']:
if type(txt) == str:
all_txt.extend(eval(txt))
else:
all_txt.extend(txt)
all_txt = list(set(all_txt))
n = len(all_txt)
thread = 20
size = int(n/thread)
inds = list(range(0, n, size))
inds.append(n)
all_txt_sep = [all_txt[i: min(i+size, n)] for i in inds[:-1]]
with Pool(processes=thread) as pool:
result = pool.map(fuzzy_match, all_txt_sep)
pool.close()
pool.join()
for d in result:
txt_dict.update(d)
# for txt in all_txt[:10]:
# fuzzy_match(txt)
data['function'] = data['function'].apply(lambda x: txt_map(x, txt_dict))
data['function'] = data['function'].apply(lambda x: list(set(x)))
print("fuzzy matching time: {}".format(time.time() - t0))
### Find the generated GO text that not included in the ground truth. Then generate pairs between them.
# pair_a, pair_b = [], []
# for preds, labels in zip(data['function'], data['label']):
# if type(preds) == str:
# preds = eval(preds)
# if type(labels) == str:
# labels = eval(labels)
# l = len(labels)
# for pred in preds:
# if pred not in labels:
# pair_a.extend([pred]*l)
# pair_b.extend(labels[:])
# pair_a = [re.sub('_', ':', GO_dict[i]) for i in pair_a]
# pair_b = [re.sub('_', ':', GO_dict[i]) for i in pair_b]
# with open('/home/nilin/LAVIS/examples/GO_pair{}.txt'.format(fix), 'w+') as f:
# for i, j in zip(pair_a, pair_b):
# f.write(i+' '+j+'\n')
# load model
model_config = {'arch': 'blip2_protein', 'load_finetuned': False,
'pretrained': '/cluster/home/wenkai/LAVIS/lavis/output/BLIP2/Pretrain_stage1/20230922185/checkpoint_15.pth',
'finetuned': '', 'num_query_token': 32, 'prompt': '',
'model_type': 'pretrain', 'load_pretrained': True, 'freeze_vit': False,
'max_protein_len': 512, 'max_txt_len': 25}
model_cls = registry.get_model_class(model_config['arch'])
model = model_cls.from_config(model_config)
model = model.to(device)
model.eval()
# evaluate
t0 = time.time()
proteins = list(data['protein'])
txts = list(data['function'])
scores = []
for seq, txt in zip(proteins, txts):
image = [('protein1', seq)]
_, _, batch_tokens = model.visual_encoder(image)
image_embeds = model.ln_vision(batch_tokens.to(device), repr_layers=[30], return_contacts=True)["representations"][
30].contiguous()
image_atts = torch.ones(image_embeds.size()[:-1], dtype=torch.long).to(device)
query_tokens = model.query_tokens.expand(image_embeds.shape[0], -1, -1)
query_output = model.Qformer.bert(
query_embeds=query_tokens,
encoder_hidden_states=image_embeds,
encoder_attention_mask=image_atts,
use_cache=True,
return_dict=True,
)
image_feats = F.normalize(model.vision_proj(query_output.last_hidden_state), dim=-1)
image_feats_all = concat_all_gather(image_feats)
if type(txt) == str:
txt = eval(txt)
length = len(txt)
with torch.no_grad():
text_tokens = model.tokenizer(
txt,
padding="max_length",
truncation=True,
max_length=model.max_txt_len,
return_tensors="pt",
).to(device)
text_output = model.Qformer.bert(
text_tokens.input_ids,
attention_mask=text_tokens.attention_mask,
return_dict=True,
)
text_feat = F.normalize(
model.text_proj(text_output.last_hidden_state[:, 0, :]), dim=-1
)
text_feat_all = concat_all_gather(text_feat)
sim_q2t = torch.matmul(image_feats.unsqueeze(1), text_feat_all.unsqueeze(-1)).squeeze()
sim_i2t, _ = sim_q2t.max(-1)
# print('sim_i2t: {}'.format(sim_i2t))
if length > 1:
scores.append(list(sim_i2t.detach().cpu().numpy()))
else:
scores.append([sim_i2t.item()])
print("model evaluate time: {}".format(time.time() - t0))
data['score'] = scores
# precision and recall top-k
topk = 2
threshould = 0.1
labels = []
pred_labels = []
for l in data['label']:
if type(l) == str:
l = eval(l)
labels.extend(l)
labels = list(set(labels))
total = len(labels)
for topk in range(1,7):
for threshould in range(1, 25, 1):
threshould /= 100
filter_txts = []
recalls = []
precisions = []
f1 = []
tp_dict, fp_dict, fn_dict = dict(zip(labels, [0]*len(labels))), dict(zip(labels, [0]*len(labels))), dict(zip(labels, [0]*len(labels)))
for txts, scores, label in zip(data['function'], data['score'], data['label']):
if type(label) == str:
label = eval(label)
txts_ = np.array(txts)
scores = np.array(scores)
txts = txts_[scores > threshould]
if len(txts) < 1:
txts = txts_[np.argmax(scores)]
scores = scores[scores > threshould]
l = len(scores)
ll = len(label)
if l <= topk:
filter_txts.append(list(txts))
else:
ind = np.argpartition(scores, -topk)[-topk:]
txts = txts[ind]
filter_txts.append(list(txts))
l = topk
for t in label:
if t in txts:
tp_dict[t] += 1
else:
fn_dict[t] += 1
for p in txts:
if p not in label:
if p in fp_dict:
fp_dict[p] += 1
else:
fp_dict[p] = 1
pred_labels.extend(txts)
p_total = len(set(pred_labels))
re, pr = 0., 0.
for x in labels:
re += tp_dict[x] / (1.0 * (tp_dict[x] + fn_dict[x] + 1e-8))
pr += tp_dict[x] / (1.0 * (tp_dict[x] + fp_dict[x]+1e-8))
r = re / total
p = pr / total
f1 = 2 * p * r / (p + r)
print("Topk: {}, threshould: {}, macro_recall: {}, macro_precision: {}, micro_f1: {}".format(topk, threshould, r, p, f1))
# num_r = 0
# num_p = 0
# for x in label:
# if x in txts:
# num_r += 1
# for x in txts:
# if x in label:
# num_p += 1
# recall = num_r/ll
# precision = num_p/(l+0.0001)
# recalls.append(recall)
# precisions.append(precision)
# f1.append((2*recall*precision)/(recall+precision+0.0001))
#
# data['predict'] = filter_txts
# data['precision'] = precisions
# data['recall'] = recalls
# data['f1'] = f1
# print("Topk: {}, threshould: {}, macro_recall: {}, macro_precision: {}, micro_f1: {}".format(topk, threshould, round(data['recall'].mean(), 4), round(data['precision'].mean(), 4), round(data['f1'].mean(), 4)))
# sim = []
# for text, label in zip(data['predict'].tolist(), data['label'].tolist()):
# sim.append(levenshtein_sim(text, label))
#
# data['sim_filter'] = sim
# data['avg_score'] = data['sim_filter'].apply(lambda x: round(np.mean(x), 3))
# data['function'] = data['function'].apply(lambda x: eval(re.sub(';', ',', str(x))))
# data['label'] = data['label'].apply(lambda x: eval(re.sub(';', ',', str(x))))
# data['sim'] = data['sim'].apply(lambda x: eval(re.sub(';', ',', str(x))))
#
# data['function'] = data['function'].apply(lambda x: re.sub(',', ';', str(x)))
# data['label'] = data['label'].apply(lambda x: re.sub(',', ';', str(x)))
# data['sim'] = data['sim'].apply(lambda x: re.sub(',', ';', str(x)))
# data['predict'] = data['predict'].apply(lambda x: re.sub(',', ';', str(x)))
# data['sim_filter'] = data['sim_filter'].apply(lambda x: re.sub(',', ';', str(x)))
data.to_csv('/cluster/home/wenkai/LAVIS/output/predict_sim{}.csv'.format(fix), sep='|', index=False)
# data = pd.read_csv('/cluster/home/wenkai/LAVIS/output/predict_sim{}.csv'.format(fix), sep='|')
#
# # example
# image = ['MIELKHVTFGYNKKQMVLQDINITIPDGENVGILGESGCGKSTLASLVLGLFKPVKGEIYLSDNAVLTIFQHPLTSFNPDWTIETSLKEALYYYRGLTDNTAQDQLLLQHLSTFELNAQLLTKLPSEVSGGQLQRFNVMRSLLAQPRVLICDEITSNLDVIAEQNVINILKAQTITNLNHFIVISHDLSVLQRLVNRIIVLKDGMIVDDFAIEELFNVDRHPYTKELVQTFSY']
# image = [('protein{}'.format(i), x) for i, x in enumerate(image)]
#
# _, _, batch_tokens = model.visual_encoder(image)
# image_embeds = model.ln_vision(batch_tokens.to(device), repr_layers=[30], return_contacts=True)["representations"][30].contiguous()
#
# image_atts = torch.ones(image_embeds.size()[:-1], dtype=torch.long).to(device)
#
# query_tokens = model.query_tokens.expand(image_embeds.shape[0], -1, -1)
#
# query_output = model.Qformer.bert(
# query_embeds=query_tokens,
# encoder_hidden_states=image_embeds,
# encoder_attention_mask=image_atts,
# use_cache=True,
# return_dict=True,
# )
#
# image_feats = F.normalize(model.vision_proj(query_output.last_hidden_state), dim=-1)
#
# image_feats_all = concat_all_gather(image_feats)
#
# functions = ['transmembrane transporter activity', 'nickel cation transmembrane transporter activity', 'nickel cation binding', 'atp hydrolysis activity', 'atp hydrolysis', 'cadmium binding', 'abc-type nickel transmembrane transporter activity', 'abc-type nickel transporter activity', 'nickel transmembrane transporter activity', 'atp binding']
# for text in functions:
# with torch.no_grad():
# # text = 'flavin adenine dinucleotide binding'
# text_tokens = model.tokenizer(
# text,
# padding="max_length",
# truncation=True,
# max_length=model.max_txt_len,
# return_tensors="pt",
# ).to(device)
# text_output = model.Qformer.bert(
# text_tokens.input_ids,
# attention_mask=text_tokens.attention_mask,
# return_dict=True,
# )
#
# text_feat = F.normalize(
# model.text_proj(text_output.last_hidden_state[:, 0, :]), dim=-1
# )
#
# text_feat_all = concat_all_gather(text_feat)
# sim_q2t = torch.matmul(image_feats.unsqueeze(1), text_feat_all.unsqueeze(-1)).squeeze()
# sim_i2t, _ = sim_q2t.max(-1)
# print('sim_i2t: {}'.format(sim_i2t))
#
# # # text-query similarity: [batch_size, batch_size*num_gpu, num_query_tokens]
# # sim_t2q = torch.matmul(
# # text_feat.unsqueeze(1).unsqueeze(1), image_feats_all.permute(0, 2, 1)
# # ).squeeze()
# #
# # # text-image similarity: aggregate across all query tokens
# # sim_t2i, _ = sim_t2q.max(-1)
# # print('sim_t2i: {}'.format(sim_t2i))
|