Spaces:
Running
Running
File size: 5,907 Bytes
c0a3508 8ee0f47 c0a3508 8ee0f47 c0a3508 8ee0f47 c0a3508 740f561 c0a3508 8ee0f47 c0a3508 8ee0f47 c0a3508 8ee0f47 c0a3508 8ee0f47 c0a3508 eae99f5 c0a3508 eae99f5 c0a3508 2f0c31f c0a3508 d5cd179 c0a3508 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 |
import streamlit as st
import pandas as pd
import numpy as np
import re
from PIL import Image
import webbrowser
from rdkit import Chem
from rdkit.Chem import AllChem
from rdkit.Chem import Draw
from rdkit.Chem import rdChemReactions as Reactions
import tensorflow as tf
from tensorflow import keras
from keras.preprocessing import sequence
from keras.utils import pad_sequences
import keras
from keras import backend as K
from keras.models import load_model
import argparse
import h5py
import pdb
seq_rdic = ['A', 'I', 'L', 'V', 'F', 'W', 'Y', 'N', 'C', 'Q', 'M',
'S', 'T', 'D', 'E', 'R', 'H', 'K', 'G', 'P', 'O', 'U', 'X', 'B', 'Z']
seq_dic = {w: i+1 for i, w in enumerate(seq_rdic)}
@st.cache_data
def encodeSeq(seq, seq_dic):
if pd.isnull(seq):
return [0]
else:
return [seq_dic[aa] for aa in seq]
@st.cache_resource
def load_modelfile(model_string):
loaded_model = tf.keras.models.load_model(model_string)
return loaded_model
@st.cache_data
def prot_feature_gen_from_str_input(prot_input_str, prot_len=2500):
Prot_ID = prot_input_str.split(':')[0]
Prot_seq = prot_input_str.split(':')[1]
Prot_seq = Prot_seq.replace(" ", "")
prot_dataframe = pd.DataFrame(
{'Protein_ID': Prot_ID, 'Sequence': Prot_seq}, index=[0])
prot_dataframe.set_index('Protein_ID')
prot_dataframe["encoded_sequence"] = prot_dataframe.Sequence.map(
lambda a: encodeSeq(a, seq_dic))
prot_feature = pad_sequences(
prot_dataframe["encoded_sequence"].values, prot_len)
return prot_feature, Prot_ID
@st.cache_data
def mol_feature_gen_from_str_input(mol_str, kegg_id_flag, kegg_df):
if kegg_id_flag == 1:
KEGG_ID = mol_str
kegg_id_loc = kegg_df.index[kegg_df.Compound_ID == KEGG_ID][0]
KEGG_ID_info = kegg_df.loc[kegg_id_loc]
KEGG_ID_info_df = KEGG_ID_info.to_frame().T.set_index('Compound_ID')
final_return = KEGG_ID_info_df
final_id = KEGG_ID
else:
try:
mol_ID = mol_str.split(':')[0]
mol_smiles = mol_str.split(':')[1]
mol = Chem.MolFromSmiles(mol_smiles)
fp1 = AllChem.GetMorganFingerprintAsBitVect(
mol, useChirality=True, radius=2, nBits=2048)
fp_list = list(np.array(fp1).astype(float))
fp_str = list(map(str, fp_list))
mol_fp = '\t'.join(fp_str)
mol_dict = {}
mol_dict['Compound_ID'] = mol_ID
mol_dict['Smiles'] = mol_smiles
mol_dict['morgan_fp_r2'] = mol_fp
mol_info_df = pd.DataFrame(mol_dict, index=[0])
mol_info_df = mol_info_df.set_index('Compound_ID')
final_return = mol_info_df
final_id = mol_ID
except Exception as error:
print('Something wrong with molecule input string...' + repr(error))
return final_return, final_id
@st.cache_data
def act_df_gen_mol_feature(mol_id, prot_id):
act_df = pd.DataFrame(
{'Protein_ID': prot_id, 'Compound_ID': mol_id}, index=[0])
return act_df
@st.cache_data
def compound_feature_gen_df_input(act_df, comp_df, comp_len=2048, comp_vec='morgan_fp_r2'):
act_df = pd.merge(act_df, comp_df, left_on='Compound_ID', right_index=True)
comp_feature = np.stack(act_df[comp_vec].map(lambda fp: fp.split("\t")))
comp_feature = comp_feature.astype('float')
return comp_feature
@st.cache_data
def model_prediction(compound_feature, enz_feature, model):
prediction_vals = model.predict([compound_feature, enz_feature])
return prediction_vals[0][0]
def main():
graph = tf.compat.v1.get_default_graph()
ld_model = tf.keras.models.load_model('./CNN_model_final/Final_model.model')
KEGG_compound_read = pd.read_csv('./CNN_data_kegg/kegg_compound.csv', index_col = 'Compound_ID')
kegg_df = KEGG_compound_read.reset_index()
st.image('./Streamlit/header.png', use_column_width=True)
st.subheader('Enzyme-Substrate Activity Predictor ')
st.subheader('Enzyme sequence')
st.caption('Please follow the input format show in the text box--> id:Sequence')
enz_str = st.text_input('', value="A0A4P8WFA8:MTKRVLVTGGAGFLGSHLCERLLSEGHEVICLDNFGSGRRKNIKEFEDHPSFKVNDRDVRISESLPSVDRIYHLASRASPADFTQFPVNIALANTQGTRRLLDQARACDARMVFASTSEVYGDPKVHPQPETYTGNVNIRGARGCYDESKRFGETLTVAYQRKYDVDARTVRIFNTYGPRMRPDDGRVVPTFVTQALRGDDLTIYGDGEQTRSFCYVDDLIEGLISLMRVDNPEHNVYNIGKENERTIKELAYEVLGLTDTESDIVYEPLPEDDPGQRRPDITRAKTELDWEPKISLREGLEDTITYFDN")
# url = 'https://www.genome.jp/dbget-bin/www_bget?rn:R00801'
# if st.button('KEformat example'):
# webbrowser.open_new_tab(url)
st.subheader('Substrate ')
st.caption('Please follow the input format show in the text box--> KEGG id or click the checkbox')
comp_str = st.text_input('', value="C00149")
if st.checkbox('If you are entering smiles string click here'):
add_info = st.text_area('Additional information (id: Smiles):', "C00149:O[C@@H](CC([O-])=O)C([O-])=O")
else:
add_info = ''
if st.button("Predict"):
# if session_state.button_search:
# st.subheader('Enzyme-Substrate activity score')
with st.spinner('Calculating...'):
try:
# st.write('I am inside')
prot_feature, prot_id = prot_feature_gen_from_str_input(enz_str)
if len(add_info) == 0:
kegg_id_flag = 1
comp_feature, comp_id = mol_feature_gen_from_str_input(comp_str, kegg_id_flag, kegg_df)
else:
kegg_id_flag = 0
comp_feature, comp_id = mol_feature_gen_from_str_input(add_info, kegg_id_flag, kegg_df)
act_dataframe = act_df_gen_mol_feature(comp_id, prot_id)
# st.write(act_dataframe)
compound_feature = compound_feature_gen_df_input(act_dataframe, comp_feature)
# st.write(compound_feature)
except Exception as e:
st.write('Error somewhere...' + repr(e))
# st.write(compound_feature)
# st.write(prot_feature)
# keras.backend.clear_session()
y = ld_model.predict([compound_feature, prot_feature])
subheaderstring = 'EnzRank Score for '+ prot_id + '-' + comp_id + ' pair:'
st.subheader(subheaderstring)
st.write(str(y[0][0]))
if __name__ == '__main__':
main()
|