|
--- |
|
license: apache-2.0 |
|
--- |
|
--- |
|
license: apache-2.0 |
|
--- |
|
# ProteinForceGPT: Generative strategies for modeling, design and analysis of protein mechanics |
|
|
|
|
|
### Load model |
|
|
|
This model is an autoregressive transformer model in GPT-style, trained to analyze and predict the mechanical properties of a large number of protein sequences. |
|
|
|
The pretraining task is defined as "Sequence<...>" where ... is an amino acid sequence. |
|
|
|
Mechanics-related forward and inverse tasks are: |
|
|
|
```raw |
|
CalculateForce<GEECDCGSPSNP..>, |
|
CalculateEnergy<GEECDCGSPSNP..> |
|
CalculateForceEnergy<GEECDCGSPSNP...> |
|
CalculateForceHistory<GEECDCGSPSNP...> |
|
GenerateForce<0.262> |
|
GenerateForce<0.220> |
|
GenerateForceEnergy<0.262,0.220> |
|
GenerateForceHistory<0.004,0.034,0.125,0.142,0.159,0.102,0.079,0.073,0.131,0.105,0.071,0.058,0.072,0.060,0.049,0.114,0.122,0.108,0.173,0.192,0.208,0.153,0.212,0.222,0.244> |
|
``` |
|
Load pretrained model: |
|
|
|
```python |
|
from transformers import AutoModelForCausalLM, AutoTokenizer |
|
|
|
pretrained_model_name='lamm-mit/ProteinForceGPT' |
|
|
|
tokenizer = AutoTokenizer.from_pretrained(pretrained_model_name, trust_remote_code=True) |
|
tokenizer.pad_token = tokenizer.eos_token |
|
|
|
model_name = pretrained_model_name |
|
|
|
model = AutoModelForCausalLM.from_pretrained( |
|
model_name, |
|
trust_remote_code=True |
|
).to(device) |
|
|
|
model.config.use_cache = False |
|
``` |
|
|
|
Sample inference using the "Sequence<...>" task, where here, the model will simply autocomplete the sequence starting with "AIIAA": |
|
|
|
```python |
|
prompt = "Sequence<GEECDC" |
|
generated = torch.tensor(tokenizer.encode(prompt, add_special_tokens = False)) .unsqueeze(0).to(device) |
|
print(generated.shape, generated) |
|
|
|
sample_outputs = model.generate( |
|
inputs=generated, |
|
eos_token_id =tokenizer.eos_token_id, |
|
do_sample=True, |
|
top_k=500, |
|
max_length = 300, |
|
top_p=0.9, |
|
num_return_sequences=1, |
|
temperature=1, |
|
).to(device) |
|
|
|
for i, sample_output in enumerate(sample_outputs): |
|
print("{}: {}\n\n".format(i, tokenizer.decode(sample_output, skip_special_tokens=True))) |
|
``` |
|
Sample inference using the "CalculateForce<...>" task, where here, the model will calculate the maximum unfolding force of a given sequence: |
|
|
|
```python |
|
prompt = "'CalculateForce<GEECDCGSPSNPCCDAATCKLRPGAQCADGLCCDQCRFKKKRTICRIARGDFPDDRCTGQSADCPRWN>" |
|
generated = torch.tensor(tokenizer.encode(prompt, add_special_tokens = False)) .unsqueeze(0).to(device) |
|
|
|
sample_outputs = model.generate( |
|
inputs=generated, |
|
eos_token_id =tokenizer.eos_token_id, |
|
do_sample=True, |
|
top_k=500, |
|
max_length = 300, |
|
top_p=0.9, |
|
num_return_sequences=3, |
|
temperature=1, |
|
).to(device) |
|
|
|
for i, sample_output in enumerate(sample_outputs): |
|
print("{}: {}\n\n".format(i, tokenizer.decode(sample_output, skip_special_tokens=True))) |
|
``` |
|
Output: |
|
```raw |
|
0: CalculateForce<GEECDCGSPSNPCCDAATCKLRPGAQCADGLCCDQCRFKKKRTICRIARGDFPDDRCTGQSADCPRWN> [0.262]``` |
|
``` |
|
|
|
## Citation |
|
To cite this work: |
|
``` |
|
@article{GhafarollahiBuehler_2024, |
|
title = {ProtAgents: Protein discovery via large language model multi-agent collaborations combining physics and machine learning }, |
|
author = {A. Ghafarollahi, M.J. Buehler}, |
|
journal = {}, |
|
year = {2024}, |
|
volume = {}, |
|
pages = {}, |
|
url = {} |
|
} |
|
``` |