File size: 2,518 Bytes
90c7dd4 2d59622 90c7dd4 b9efd83 906448b 2d59622 90c7dd4 580ec07 6aa701a 580ec07 90c7dd4 8bdf5c8 91aea3e 8bdf5c8 483b89f 91aea3e |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 |
---
license: cc-by-nc-nd-4.0
---
# FusOn-pLM: A Fusion Oncoprotein-Specific Language Model via Focused Probabilistic Masking
In this work, we introduce **FusOn-pLM**, a novel pLM that fine-tunes the state-of-the-art [ESM-2-650M](https://huggingface.co/facebook/esm2_t33_650M_UR50D) protein language model (pLM) on fusion oncoprotein sequences, those that drive a large portion of pediatric cancers but are heavily disordered and undruggable. We specifically introduce a novel masked language modeling (MLM) strategy, employing a binding-site probability predictor to focus masking on key amino acid residues, thereby generating more optimal fusion oncoprotein-aware embeddings. Our model improves performance on both fusion oncoprotein-specific benchmarks and disorder prediction tasks in comparison to baseline ESM-2 representations, as well as manually-constructed biophysical embeddings, motivating downstream usage of FusOn-pLM embeddings for therapeutic design tasks targeting these fusions. Please feel free to try out our embeddings and reach out if you have any questions!
**How to generate FusOn-pLM embeddings for your fusion oncoprotein:**
```
from transformers import AutoTokenizer, AutoModel
import torch
# Load the tokenizer and model
model_name = "ChatterjeeLab/FusOn-pLM"
tokenizer = AutoTokenizer.from_pretrained(model_name)
model = AutoModel.from_pretrained(model_name)
# Example fusion oncoprotein sequence: MLLT10:PICALM, associated with Acute Myeloid Leukemia (LAML)
# Amino acids 1-80 are derived from the head gene, MLLT10
# Amino acids 81-119 are derived from the tail gene, PICALM
sequence = "MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQIQFM"
# Tokenize the input sequence
inputs = tokenizer(sequence, return_tensors="pt")
# Get the embeddings
with torch.no_grad():
outputs = model(**inputs)
# The embeddings are in the last_hidden_state tensor
embeddings = outputs.last_hidden_state
# Convert embeddings to numpy array (if needed)
embeddings = embeddings.squeeze(0).numpy()
print("Per-residue embeddings shape:", embeddings.shape)
```
## Repository Authors
[Sophia Vincoff](mailto:sophia.vincoff@duke.edu), PhD Student at Duke University <br>
[Pranam Chatterjee](mailto:pranam.chatterjee@duke.edu), Assistant Professor at Duke University
Reach out to us with any questions! |