metadata
license: mit
language:
- en
library_name: transformers
tags:
- esm
- esm-2
- sequence classifier
- proteins
- protein language model
pipeline_tag: zero-shot-classification
ESM-2 Sequence Classifier
This is a small sequence classifier trained on synthetic data generate by GPT-4
which classifies protein sequences into three categories enzymes
, receptor_proteins
, and structural_proteins
.
This is trained using facebook/esm2_t6_8M_UR50D, one of the
Meta AI ESM-2 models.
This model is not well tested, and is for experimental purposes. Use with caution.
Using the Model
To use the model, try running:
# Load the trained model and tokenizer
model = EsmForSequenceClassification.from_pretrained("./esm2_t6_8M_UR50D_sequence_classifier_v1")
tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t6_8M_UR50D")
# Suppose these are your new sequences that you want to classify
# Additional Family 0: Enzymes
new_sequences_0 = [
"ACGYLKTPKLADPPVLRGDSSVTKAICKPDPVLEK",
"GVALDECKALDYLPGKPLPMDGKVCQCGSKTPLRP",
"VLPGYTCGELDCKPGKPLPKCGADKTQVATPFLRG",
"TCGALVQYPSCADPPVLRGSDSSVKACKKLDPQDK",
"GALCEECKLCPGADYKPMDGDRLPAAATSKTRPVG",
"PAVDCKKALVYLPKPLPMDGKVCRGSKTPKTRPYG",
"VLGYTCGALDCKPGKPLPKCGADKTQVATPFLRGA",
"CGALVQYPSCADPPVLRGSDSSVKACKKLDPQDKT",
"ALCEECKLCPGADYKPMDGDRLPAAATSKTRPVGK",
"AVDCKKALVYLPKPLPMDGKVCRGSKTPKTRPYGR",
]
# Additional Family 1: Receptor Proteins
new_sequences_1 = [
"VGQRFYGGRQKNRHCELSPLPSACRGSVQGALYTD",
"KDQVLTVPTYACRCCPKMDSKGRVPSTLRVKSARS",
"PLAGVACGRGLDYRCPRKMVPGDLQVTPATQRPYG",
"CGVRLGYPGCADVPLRGRSSFAPRACMKKDPRVTR",
"RKGVAYLYECRKLRCRADYKPRGMDGRRLPKASTT",
"RPTGAVNCKQAKVYRGLPLPMMGKVPRVCRSRRPY",
"RLDGGYTCGQALDCKPGRKPPKMGCADLKSTVATP",
"LGTCRKLVRYPQCADPPVMGRSSFRPKACCRQDPV",
"RVGYAMCSPKLCSCRADYKPPMGDGDRLPKAATSK",
"QPKAVNCRKAMVYRPKPLPMDKGVPVCRSKRPRPY",
]
# Additional Family 2: Structural Proteins
new_sequences_2 = [
"VGKGFRYGSSQKRYLHCQKSALPPSCRRGKGQGSAT",
"KDPTVMTVGTYSCQCPKQDSRGSVQPTSRVKTSRSK",
"PLVGKACGRSSDYKCPGQMVSGGSKQTPASQRPSYD",
"CGKKLVGYPSSKADVPLQGRSSFSPKACKKDPQMTS",
"RKGVASLYCSSKLSCKAQYSKGMSDGRSPKASSTTS",
"RPKSAASCEQAKSYRSLSLPSMKGKVPSKCSRSKRP",
"RSDVSYTSCSQSKDCKPSKPPKMSGSKDSSTVATPS",
"LSTCSKKVAYPSSKADPPSSGRSSFSMKACKKQDPPV",
"RVGSASSEPKSSCSVQSYSKPSMSGDSSPKASSTSK",
"QPSASNCEKMSSYRPSLPSMSKGVPSSRSKSSPPYQ",
]
# Tokenize the sequences and convert to tensors
# Merge all sequences
new_sequences = new_sequences_0 + new_sequences_1 + new_sequences_2
inputs = tokenizer(new_sequences, return_tensors="pt", padding=True, truncation=True)
# Use the model to get the logits
with torch.no_grad():
logits = model(**inputs).logits
# Get the predicted class for each sequence
predicted_class_ids = torch.argmax(logits, dim=-1)
# Print the predicted class for each sequence
for sequence, predicted_class in zip(new_sequences, predicted_class_ids):
print(f"Sequence: {sequence}, Predicted class: {predicted_class.item()}")