Datasets:

kristmh

/

highest_and_high_vs_rest

like 0

summary users can view worklogs in their own issues even when they dont have any time tracking permissions steps to reproduce add log work entries on an issue remove all the timetracking permissions for the reporter sign in as the user account and check for the same issues expected results the log work entries must not be visible to the reporter for all the issues actual results the reporter will be able to see the log work entries in the issues none

dashboard is not showing content correctly when you navigate to double final slash works well

summary changing a png image size to under will cause it to have a black background on firefox steps to reproduce on firefox create a new page add a image with a transparent background through files and images set it to a size under expected results the image should be equally displayed on all sizes actual results the image gets a black blackground instead of the default white

issue summary select list single choice default option none has not removed even its made to mandatory field in field configuration and it should behave same like select list multiple choices select list multiple choices has removed the none from the options when its made as required field steps to reproduce create custom fields of select list single choice and select list multiple choice make them required in field configuration select list single choice still shows none as option in issue screen and the other not expected results behaviour of the select list should be same for both single choice and multiple choices actual results multiple choices select list field removes the none option when its made required and single choice select list still shows it in the configuration set custom field defaultspngthumbnail workaround having a default value selected removes the none option from the select list single choice configure custom field select list single testpngthumbnail set custom field defaults select list single v

deleting a user with an apostraphy in their name causes a sql error this actually exposes a potential sql injection exploit since the username is passed directly to the sql statement and is not parsed for apostraphies example create a user with an apostraphy in their name try to delete the user

my source tree language is set to french rather than automatic when going to commits list i see commit time in format ie rather than when i change source tree language to english it uses format i would expect to use format when using french language and i assume english format steps to reproduce go to tools options change language to french observe a commit where the time should be is now english french languagejpgthumbnail

note this bug report is for jira server using jira cloud see the corresponding bug report panelwhen selecting an issue from a multi issue select widget the jira base url is prepended to the urlpath of the icon of issue types regardless of whether it is hosted locally or remotely

we have identified and fixed a crosssite scripting xss vulnerability in the crucible author mapping affected versions are crucible to inclusive xss vulnerabilities potentially allow an attacker to embed their own javascript into a fisheyecrucible page you can read more about xss attacks at various places on the web including these cgisecuritycom the web application security consortium this issue is reported in our security advisory on these pages

i cant see any add page link on dashboard for the listed spaces nor anything at the space summary but when i open a page from the space i can see add page on the right operations bar

creating remote link from jira to another remote server works perfectly however deleting the link in one server does not remove the corresponding link in the other remote server this can cause inconsistencies when generating reports whose queries depends on the issue links

hi trying to push some stuff to one of my repos and getting the message below started to happen yesterday thank youcodepythoncounting objects donedelta compression using up to threadscompressing objects donewriting objects kib donetotal delta reused delta traceback most recent call lastremote file optpythondomainsbitbucketorgcurrentbitbucketscriptsgithooksprereceive line in remote sysexitprehooksgithooksremote file line in wrapperremote nodes sortednodesnewcsetsremote file line in sortednodesremote return remote file line in remote return remote file line in getremote result selffuncinstanceremote file line in dateremote dt datetimeutcfromtimestampselfcommitcommitterremote file line in getremote result selffuncinstanceremote file line in commitremote return selfreporeporemote failed to lookup object remote failed to parse commit remote failed to parse signature signature too shortcode

when i try to remove a deploy key from bitbucket project i get an error dialog sayingcodeerrorthere was an error communicating with the server please try againcodeand the removing fails i’ve tried refreshing page and logging out in with no success‌i checked developer tools network tab and it seems that the request iscodedelete codejust guessing but shouldn’t the path contain also id for the key to be deleted

when searching for authors i get results for peoples last names if they contain no special characters my name starts with the letter ö and i get no results when searching for myself

both have the same meaning as used by cloverreport fileset used to select files for which to log coverage filter used to exclude specific contexts from the log metrics see also using custom contexts code code

when users dont have permission link issue and make a request link issue post the status return expected status if permissionmanagerhaspermissionlinkissue inwardissue authcontextgetuser throw new inwardissuegetkey

when opening the preferences dialog from sourcetree preferences the window cannot be close with cmdw or by clicking the red close button in top left some settings are saved regardless but the one in particular that i am trying to save preferences git push branches will not save apparently i am trying to change the drop down to upstream it will not save and the window will not close exception from consoleapp pm sourcetree setobjectforkey object cannot be nil key uiusername pm sourcetree corefoundation exceptionpreprocess libobjcadylib objcexceptionthrow corefoundation sourcetree sourcetree sourcetree sourcetree sourcetree sourcetree appkit appkit appkit appkit appkit appkit appkit appkit appkit appkit appkit appkit appkit appkit nsapplicationmain sourcetree sourcetree

in tools options mercurial you can enable extensions that are in your mercurialini but theyre only listed if they have an explicit location this makes sense when the embedded mercurial is in use because you cant use an implied location if the mercurial location isnt known but when the user is using the system mercurial we should allow user extensions with an implicit location because they will have placed these extensions in their own hg install location

step to reproduce the issue create a user called “测试用户” in a page or comment type the following sentence code 测试用户提到测试 code expected behavior the autocomplete suggestion list should show the username actual behavior it is considered as a normal text

hi i created a new repository on the push command was aborted while processing for new pushes i am getting the following errors enlurepohg push newbranch pushing to searching for changes abort abandoned transaction found run hg recoverenlurepohg recover no interrupted transaction availableneed to fix this in order to add new branches to this repository

the snapshot zipfile which is dpeloyed to maven contains zero byte files after unzipping this file we see that the infinitydb data file is zero byte meaning inifitydb does not start if this file is removed fisheye starts but the jsps are zero bytes noformat find size more adminindexjsp adminapiindexjsp annotcssjsp apiindexjsp cruindexjsp profileindexjsp repositoriesjspf simpletestjsp testechojsp testescapeechojsp testgravatarsheetjsp testsessiontestjsp webinfdecoratorsatladminpagedecoratorjsp webinfdecoratorsatlgeneralpagedecoratorjsp webinfdecoratorsatlpopuppagedecoratorjsp webinfdecoratorscruciblereporttabdecoratorjsp webinfdecoratorsfisheyepopupdecoratorjsp webinfdecoratorsfisheyereporttabdecoratorjsp webinfdecoratorsfisheyeuserprofiletabdecoratorjsp webinfjspacceptinvitejsp webinfjspactivitystreamjsp webinfjspactivitystreamrssjsp webinfjspadminaddadvancedlinkerjsp webinfjspadminaddallowexcludejsp webinfjspadminaddallowincludejsp webinfjspadminaddhidedirjsp webinfjspadminaddrepositoryjsp webinfjspadminaddsimplelinkerjsp webinfjspadminaddtarballexcludejsp webinfjspadminaddusermappingjsp webinfjspadminaddviewcvsmappingjsp webinfjspadminajpauthconfirmdeletejsp webinfjspadminajpautheditjsp webinfjspadminauthtestjsp webinfjspadminbackupjsp webinfjspadminbackupprogressjsp webinfjspadminbackupprogressajaxresponsejsp webinfjspadminchangeadminpasswordjsp webinfjspadmincontentadminjsp webinfjspadmincrowdauthconfirmdeletejsp webinfjspadmincrowdautheditjsp webinfjspadmincustomautheditjsp webinfjspadmineditenablechangesetdiscussionjsp webinfjspadmineditadvancedlinkerjsp webinfjspadmineditallowexcludejsp webinfjspadmineditallowincludejsp webinfjspadmineditavatartypejsp webinfjspadmineditcrusettingsjsp webinfjspadmineditdefaultviewcvsmappingjsp webinfjspadmineditdefectclassificationsjsp webinfjspadmineditfrontpagejsp webinfjspadmineditgitconfigjsp webinfjspadminedithgconfigjsp webinfjspadminedithidedirjsp webinfjspadmineditlicensejsp webinfjspadmineditrepositoryjsp webinfjspadmineditrepositorycommitsyntaxjsp webinfjspadmineditrepositorysecurityjsp webinfjspadmineditrepositorywatchesjsp webinfjspadmineditreppropertiesjsp webinfjspadmineditresourcesjsp webinfjspadmineditserversettingsjsp webinfjspadmineditsimplelinkerjsp webinfjspadmineditsmtpconfigjsp webinfjspadmineditsvnconfigjsp webinfjspadmineditsysadminsjsp webinfjspadminedittarballexcludejsp webinfjspadminedittarballmaxfilesjsp webinfjspadmineditupdatepollingjsp webinfjspadmineditupdatercvsjsp webinfjspadmineditupdaterpolledjsp webinfjspadmineditusermappingjsp webinfjspadmineditusermappingrepjsp webinfjspadmineditviewcvsmappingjsp webinfjspadminerrorjsp webinfjspadmingroupaddjsp webinfjspadmingroupconfirmdeletejsp webinfjspadmingroupeditjsp webinfjspadmingroupsjsp webinfjspadmingwtjsp webinfjspadminheaderjspf webinfjspadminheadercontentsjspf webinfjspadminhostauthconfirmdeletejsp webinfjspadminhostautheditjsp webinfjspadminindexmaintjsp webinfjspadminjiraserversupdatejiraserverjsp webinfjspadminjiraserversviewjiraserversjsp webinfjspadminldapconfirmdeletejsp webinfjspadminldapeditjsp webinfjspadminloginjsp webinfjspadminmenujspf webinfjspadminmigrateprogressajaxjsp webinfjspadminrepoccbranchexclusionjsp webinfjspadminrepoccbranchinclusionjsp webinfjspadminrepoccccaddjspf webinfjspadminrepocccceditjspf webinfjspadminrepoccccviewjspf webinfjspadminrepocvscvsaddjspf webinfjspadminrepocvscvseditjspf webinfjspadminrepocvscvsviewjspf webinfjspadminrepogitgitaddjspf webinfjspadminrepogitgiteditjspf webinfjspadminrepogitgitviewjspf webinfjspadminrepohghgaddjspf webinfjspadminrepohghgeditjspf webinfjspadminrepohghgviewjspf webinfjspadminreposvnsvnaddjspf webinfjspadminreposvnsvneditjspf webinfjspadminreposvnsvnsymbolicjspf webinfjspadminreposvnsvnviewjspf webinfjspadminschedulebackupjsp webinfjspadminsecurityadminjsp webinfjspadminsendtestemailjsp webinfjspadminshowactionerrorsboxjspf webinfjspadminshowactionmessagestablejspf webinfjspadminshutdownaskjsp webinfjspadminshutdowndonejsp webinfjspadminsysinfojsp webinfjspadmintestrepositorylogjspf webinfjspadminuseraddjsp webinfjspadminuseradminjsp webinfjspadminuserconfirmdeletejsp webinfjspadminusereditjsp webinfjspadminusergroupsjsp webinfjspadminuserlogoutjsp webinfjspadminusermappingadminjsp webinfjspadminusermappingconfirmdeletejsp webinfjspadminuserpasswordjsp webinfjspadminuserrenamejsp webinfjspadminusersconfirmdeletejsp webinfjspadminuserviewjsp webinfjspadminviewfisheyeprojectjsp webinfjspadminviewpluginsjsp webinfjspadminviewpropertiesjspf webinfjspadminviewrepositoryjsp webinfjspadminviewrepositorydefaultsjsp webinfjspadminviewrepositorylistjsp webinfjspadminviewserversettingsjsp webinfjspadminviewurlmappingsjsp webinfjspadminapihelpjsp webinfjspajaxchangelogconstraintsfinderrespjsp webinfjspannotatenotfoundjsp webinfjspchangelogcalendarjsp webinfjspchangelogdirjsp webinfjspchangesetjsp webinfjspchangesetshowfilejsp webinfjspchangesetpageajaxresponsejsp webinfjspchangesettooltipjsp webinfjspchartjsp webinfjspcommittercommitterjsp webinfjspcommittercommittersummaryajaxjsp webinfjspcommonauiscriptandstyleincludesjspf webinfjspcommoncrfooterjspf webinfjspcommonevalbarjspf webinfjspcommonexceededuserlimitjsp webinfjspcommonfefooterjspf webinfjspcommonmaintenancejsp webinfjspcommonmaintenancejsonjsp webinfjspcommonrenewmessagejspf webinfjspcommonsharedfooterjspf webinfjspcrucibleadmindatabasedatabasejsp webinfjspcrucibleadmindatabasedbtestbadresultjsp webinfjspcrucibleadmindatabasedbtestgoodresultjsp webinfjspcrucibleadmindatabaseeditdatabasejsp webinfjspcrucibleadminpermissioncreateagilepsajaxresponsejsp webinfjspcrucibleadminpermissioneditpermissionschemejsp webinfjspcrucibleadminpermissioneditpsactionjsp webinfjspcrucibleadminpermissionpermissionschemeerrorjsp webinfjspcrucibleadminpermissionpermissionschemesjsp webinfjspcrucibleadminprojectlistprojectsjsp webinfjspcrucibleadminprojectpreviewjsp webinfjspcrucibleadminprojectprojectdeletejsp webinfjspcrucibleadminprojectprojectformjsp webinfjspcrucibleadminsnippetsnippetjsp webinfjspcruciblecommonajaxerrorjsp webinfjspcruciblecommonajaxusererrorjsp webinfjspcruciblecommonchangestateajaxrespjsp webinfjspcruciblecommongeneralerrorjsp webinfjspcruciblecommonglobalcruciblescriptandstyleincludesjspf webinfjspcruciblecommonnopermissionjsp webinfjspcruciblecommonnoreviewjsp webinfjspcruciblecommonnotcruuserjsp webinfjspcruciblecommonremoterequestajaxerrorjsp webinfjspcruciblecommonsimpleajaxresponsejsp webinfjspcruciblecommonstorestickypreferenceresponsejsp webinfjspcruciblecreateajaxconstraintfinderjsp webinfjspcruciblecreateanchorpatchrespjsp webinfjspcruciblecreatechangediffdropdownjsp webinfjspcruciblecreatecreateforwardbacklinksjspf webinfjspcruciblecreatecreateselectattachmentjspf webinfjspcruciblecreatecreateselectpatchjspf webinfjspcruciblecreatecreateselectrevisionsbrowsejspf webinfjspcruciblecreatecreateselectrevisionsbrowsedirlistjsp webinfjspcruciblecreatecreateselectrevisionschangelogjspf webinfjspcruciblecreatecreateselectrevisionssearchjspf webinfjspcruciblecreatecreateselectrevisionssuggestionsjspf webinfjspcruciblecreatecreatereviewlandingpagejsp webinfjspcruciblecreatedirlistfilesjspf webinfjspcruciblecreateeditchangerevresponsejsp webinfjspcruciblecreateeditdetailsjsp webinfjspcruciblecreateeditselectrevisionsjsp webinfjspcruciblecreatefindjiraforreviewresponsejsp webinfjspcruciblecreateloadfullhistorydropdownjsp webinfjspcruciblecreatenewreviewfromchangesetajaxrespjsp webinfjspcruciblecreatesearchadvancedformjspf webinfjspcruciblecreatesearchresultlistjspf webinfjspcruciblecreatesearchresultlistbycsjspf webinfjspcruciblecreatesearchresultlistbydirjspf webinfjspcruciblecreatesearchresultlistbyfilejspf webinfjspcruciblecreatesearchresultlistbyrevjspf webinfjspcruciblecreatesearchsimpleformjspf webinfjspcruciblecreateselectprojectdialogajaxrespjsp webinfjspcruciblecreateselectsuggestedreviewsreviewjspf webinfjspcruciblecrureviewtooltipjsp webinfjspcruciblehomedashboardjsp webinfjspcruciblejiragetjiraresponsejsp webinfjspcruciblejirajiratimeresponsejsp webinfjspcruciblejiraupdatedjiratimejsp webinfjspcrucibleprojectprojectjsp webinfjspcruciblereviewmonolithicaddfrxcommentrespjsp webinfjspcruciblereviewmonolithicaddgeneralcommentrespjsp webinfjspcruciblereviewmonolithicaddreplyrespjsp webinfjspcruciblereviewmonolithicbasiccommentajaxrespjsp webinfjspcruciblereviewmonolithiccommentformsjspf webinfjspcruciblereviewmonolithiccommentissueajaxrespjsp webinfjspcruciblereviewmonolithiccommentissueassignableusersajaxrespjsp webinfjspcruciblereviewmonolithicconfirmcontentforactivereviewersjspf webinfjspcruciblereviewmonolithicconfirmcontentforclosereceiptjspf webinfjspcruciblereviewmonolithicconfirmcontentforothersdraftsjspf webinfjspcruciblereviewmonolithicconfirmcontentforowndraftsjspf webinfjspcruciblereviewmonolithicconfirmcontentforreceiptjspf webinfjspcruciblereviewmonolithicconfirmcontentforreviewupdatedjspf webinfjspcruciblereviewmonolithicconfirmcontentforunreadcommentsjspf webinfjspcruciblereviewmonolithicconfirmcontentreviewstodojspf webinfjspcruciblereviewmonolithicdisplayfrxinnerdivjsp webinfjspcruciblereviewmonolithicelementidsjspf webinfjspcruciblereviewmonolithicgetreviewerstatusjsonjsp webinfjspcruciblereviewmonolithiclinkedreviewjsp webinfjspcruciblereviewmonolithicmulticommentissueajaxrespjsp webinfjspcruciblereviewmonolithicredisplayfrxdivjsp webinfjspcruciblereviewmonolithicresolveallsubtasksajaxrespjsp webinfjspcruciblereviewmonolithicretrievecommentsresponsejsp webinfjspcruciblereviewmonolithicretrievenewfrxsresponsejsp webinfjspcruciblereviewmonolithicretrievereviewdetailsresponsejsp webinfjspcruciblereviewmonolithicreviewbodyjspf webinfjspcruciblereviewmonolithicreviewjsp webinfjspcruciblereviewmonolithicreviewupdatedresponsejsp webinfjspcruciblereviewmonolithicworkedjsp webinfjspcruciblereviewmonolithicwwerrorsjspf webinfjspcruciblereviewmonolithicwwmessagesjspf webinfjspcruciblereviewsnippetcreatesnippetjsp webinfjspcruciblereviewsnippetprintsnippetjsp webinfjspcruciblereviewsnippetsnippetreviewjsp webinfjspcruciblereviewwikinotationjspf webinfjspcruciblereviewhistoryvisjsp webinfjspcruciblereviewhistorywrapperjsp webinfjspcruciblereviewhistoryjsp webinfjspcruciblereviewallcommentsjsp webinfjspcruciblereviewsjsp webinfjspcruciblerssrssstatesjsp webinfjspcruciblerssrssjsp webinfjspcruciblerssrssreviewfilterjsp webinfjspcruciblesearchajaxcrucibleuserfinderrespjsp webinfjspcruciblesearchajaxprojectfinderrespjsp webinfjspcruciblesearchajaxrepositoryfinderrespjsp webinfjspcruciblesearchajaxreviewerfinderrespjsp webinfjspcruciblesearchajaxreviewfinderrespjsp webinfjspcruciblesearchajaxsuggestreviewersresponsejsp webinfjspcruciblesearchcommentsearchresultsjsp webinfjspcruciblesearchsearchresultsjsp webinfjspcruciblesendallcommentsemailjsp webinfjspcruciblesendallcommentsemaildialogjspf webinfjspcrucibleupdateupdatereviewobjectivesresponsejsp webinfjspcrucibleupdateupdatereviewsummaryresponsejsp webinfjspcrucibleupdateupdatereviewtitleresponsejsp webinfjspcrucibleupdateupdatesnippetsyntaxresponsejsp webinfjspcruciblewikipreviewjsp webinfjspdirlistjsp webinfjspdirtreeloadfilepaneajaxresponsejsp webinfjspdirtreeloadsubtreeajaxresponsejsp webinfjspemptyjsp webinfjspfileannotationchartmapajaxrespjsp webinfjspfilediffpagejsonjsp webinfjspfilefileannotationjsp webinfjspfilefilehistoryjsp webinfjspfilefilehistorycontentsrespjsp webinfjspfilefileviewjsp webinfjspfilefileviewcontentshtmlrespjsp webinfjspfilefileviewjsonannotationrespjsp webinfjspfilefileviewsidebysidediffhtmlrespjsp webinfjspglobalscriptandstyleincludesjspf webinfjspglobalscriptvarsjspf webinfjspjiraissueerrorjsp webinfjspjiraissueinlinejsp webinfjspjiraissuetooltipjsp webinfjsploginjsp webinfjsploginjsonjsp webinfjsplogoutjsp webinfjspmainheadincjspf webinfjspmostactivecommittersjsp webinfjspnochangesetjsp webinfjsppasswordreseterrorjsp webinfjsppasswordresetsuccessjsp webinfjspprofileauthormappingjsp webinfjspprofilechangepasswordjsp webinfjspprofileeditdisplaysettingsjsp webinfjspprofileeditemailjsp webinfjspprofileeditmappingjsp webinfjspprofileeditreviewsettingsjsp webinfjspprofileeditsettingsfakeajaxresponsejsp webinfjspprofileerrorjsp webinfjspprofileheaderjspf webinfjspprofileshowwatchesjsp webinfjspprojectjsp webinfjspprojectlistjsp webinfjspprojectloclegendjsp webinfjsprdiffusagejsp webinfjspreportlistjsp webinfjsprepositorydisabledjsp webinfjsprepositorylistjsp webinfjsprepositorynotrunningjsp webinfjsprequestpasswordresetjsp webinfjsprequestpasswordresetsuccessjsp webinfjspsearchquickglobalquickajaxresultsjsp webinfjspsearchquickglobalquickresultsjsp webinfjspsearchquickquickajaxresultsjsp webinfjspsearchquickquickresultsjsp webinfjspsearchsearchresultsjsp webinfjspsetupcrulicensejsp webinfjspsetupdisplayjsp webinfjspsetupfelicensejsp webinfjspsetupfinishedjsp webinfjspsetupincludecruciblejsp webinfjspsetupincludefisheyejsp webinfjspsetuppasswordjsp webinfjspsignupjsp webinfjspstaraddstarajaxresponsejsp webinfjspstargetstarlabelajaxresponsejsp webinfjspstarremovestarajaxresponsejsp webinfjspstarstaraccordionajaxbodyjsp webinfjspstarstaraccordionajaxnumberjsp webinfjspstarstardropdownajaxjsp webinfjspsvnsvnchangesetjspf webinfjspuseranonhomejsp webinfjspuserglobaluserlistjsp webinfjspuserrepositoryuserlistjsp webinfjspuseruserjsp webinfjspuseruserhomejsp webinfjspuserusersummaryajaxjsp webinfjspuserloclegendjsp webinftagscruabbreviatedwikitexttag webinftagscruaccordianboxtag webinftagscruactivityactivityitemlayouttag webinftagscruactivityactivitystreamtag webinftagscruactivityactivitytoolbaritemstag webinftagscruactivityactivitytypedescriptiontag webinftagscruactivitychangesetcommenttag webinftagscruactivitycommentdescriptiontag webinftagscruactivitycommitchartsboxtag webinftagscruactivityitemdatetag webinftagscruactivityitemjiratag webinftagscruactivityitemlisttag webinftagscruactivityitemreviewercompletiontag webinftagscruactivityitemreviewerjointag webinftagscruactivityitemreviewstatechangetag webinftagscruactivitylocchartboxtag webinftagscruactivitymultichangesetcommentstag webinftagscruactivitystreamfiltertag webinftagscruadmindatabasedbeditconfigformtag webinftagscruadmingwtdeclarelegacyadminpagetag webinftagscruadmingwtembedmenusettingstag webinftagscruadmingwtinsertadminpagecontenttag webinftagscruadminofferreindextag webinftagscruadminofferrestarttag webinftagscrubackupitemselectiontag webinftagscrubinaryprefchangingclasstag webinftagscruchangelognavtag webinftagscruchangesetchangesetsidebartag webinftagscruchangesetchangesetsidebaritemtag webinftagscruchangesetrevisionlisttag webinftagscruchoosegroupstag webinftagscruchoosesingleusertag webinftagscruchooseuserstag webinftagscrucommittermappingstag webinftagscrucommitterpopuptag webinftagscrucontentviewtabstag webinftagscrucruonlychecktag webinftagscrucustomfilterformtag webinftagscrudatetimeselectortag webinftagscrudiffbinarytag webinftagscrudiffrenderereachlinetag webinftagscrudiffrenderereachwholelinetag webinftagscrudiffrenderernavhandlestag webinftagscrudiffrenderertag webinftagscrudirlistfiletabletag webinftagscrudirlisttoolbartag webinftagscrudirtreebranchselectortag webinftagscrudirtreenewdirtreeboxtag webinftagscrudirtreenewdirtreetaskbartag webinftagscrudurationtag webinftagscruerrorrepositoriestag webinftagscruerrorboxtag webinftagscrufilehistannotlegendtag webinftagscrufilehistnavigationlinktag webinftagscrufilehistotherrevlinktag webinftagscrufilehistrevisiondetailtag webinftagscrufilehistrevisiontabletag webinftagscrufilehisttoolbartag webinftagscrufilterboxtag webinftagscrufilteredreviewdetailsheaderlinktag webinftagscrufilterlinklisttag webinftagscrufootertag webinftagscrugeneralerrorcontenttag webinftagscrugeneralinfocontenttag webinftagscruglobaltoolbartag webinftagscrugravatarimgtag webinftagscruheaderbreadcrumbstag webinftagscruheadertag webinftagscruhelptag webinftagscruhelppoplinktag webinftagscruideicontag webinftagscrujirajiraissuetag webinftagscrujirajiramappingformtag webinftagscrujsonannotationtag webinftagscrujsonannotationfiletag webinftagscrujumptochangesetwarningtag webinftagscrulicensewarningstag webinftagscrulinktocommittertag webinftagscrulinktoprojecttag webinftagscrulinktoreptag webinftagscrulinktorevisiontag webinftagscrulinktousertag webinftagscrulinkuserorcommittertag webinftagscrulocchangetag webinftagscruloginformtag webinftagscrumastheadtag webinftagscrumastheadheadtag webinftagscrumultislurpwarningstag webinftagscrupagedresultstag webinftagscrupagingnavtag webinftagscrupathiconclasstag webinftagscrupathtruncatedtag webinftagscrupostloadresourcestag webinftagscruprintrevisionstatustag webinftagscruprofiletabstag webinftagscruprojecttoolbartag webinftagscruprojectlisttag webinftagscruquicksearchtag webinftagscruquicksearchmatchtag webinftagscruquicksearchresultspagetag webinftagscrurenderdirectorytag webinftagscrurepoperationstag webinftagscrureporttoolbartag webinftagscrureviewhistorycommentlinktag webinftagscrureviewhistoryhistoryitemtag webinftagscrureviewhistoryrevisionlinktag webinftagscrureviewhistorytimelinedescriptiontag webinftagscrureviewfilterlinkstag webinftagscrureviewtabletag webinftagscrureviewupdatedwarningtag webinftagscrurevisionchangeclasstag webinftagscrurevisionlinkstag webinftagscruscmchangesettag webinftagscruscmchangesetholdertag webinftagscruscmcustomchangesetdetailstag webinftagscruscmdescribechangesettag webinftagscruscmdirinfotag webinftagscrusearchadvancedformtag webinftagscrusearchresultlisttag webinftagscrusearchresultlisttabulartag webinftagscrusearchsearchaccordionboxtag webinftagscrusearchsimpleformtag webinftagscrusearchtoolbartag webinftagscrusearchtruncationwarningtag webinftagscrusegmentedpathlinktag webinftagscrusetuplicensetag webinftagscrusidebysidediffjsontag webinftagscrusidebysidefilejsontag webinftagscrusinglepanelpagecontenttag webinftagscruslurpwarningdialogtag webinftagscruslurpwarningstag webinftagscrusortabletabletag webinftagscrustarbriefstardescriptiontag webinftagscrustarmorestarslinktag webinftagscrustarstartag webinftagscrustarstardropdownlistbodytag webinftagscrustarstartabletag webinftagscrustartablerowtag webinftagscrustartablerowformattag webinftagscrusystemmessagestag webinftagscruthreepanelpagecontenttag webinftagscrutoolsdropdowntag webinftagscruualcredentialsrequiredtag webinftagscruuserhomecontenttabstag webinftagscruuserusertabletag webinftagscruuseremailtag webinftagscruuserpopuptag webinftagscruvisactivitycalendartag webinftagscruviscommitactivitycharttag webinftagscruvisdynamicchartboxestag webinftagscruvisloccharttag webinftagscruvislocchartwaybackspeccharttag webinftagscruwatchlinktag webinftagscruwebitembuttontag webinftagscruwebitemicontag webinftagscruwebitemlinktag webinftagscruwebitemtooltiptag webinftagscruwikipreviewtag webinftagscruyesnoprefchangingclasstag webinftagsreviewalsoviewingtag webinftagsreviewblamehovertag webinftagsreviewchangerevisiondetailtag webinftagsreviewcommentcountstag webinftagsreviewcommentelementidstag webinftagsreviewcommentrenderertag webinftagsreviewcommentresultrenderertag webinftagsreviewconfirmapproveajsdialogtag webinftagsreviewconfirmclosereceiptajsdialogtag webinftagsreviewconfirmcompleteajsdialogtag webinftagsreviewconfirmcontentforincompletefrxstag webinftagsreviewconfirmcontentforjiraconnectionerrortag webinftagsreviewconfirmcontentforunresolvedsubtaskstag webinftagsreviewconfirmdeleteajsdialogtag webinftagsreviewconfirmreceiptajsdialogtag webinftagsreviewconfirmsummaryajsdialogtag webinftagsreviewcreateselectprojectajsdialogtag webinftagsreviewcreateselectprojectdialogcontenttag webinftagsreviewcreateselectsuggestedreviewajsdialogtag webinftagsreviewcreateselectsuggestedreviewdialogcontenttag webinftagsreviewcreatefilehistorydropdowntag webinftagsreviewcreateissuedialogtag webinftagsreviewdiffhiddenlinecommentstag webinftagsreviewdifflinetag webinftagsreviewdifflinecommentstag webinftagsreviewdiffoptionsformajaxtag webinftagsreviewdiffrendererblanklinetag webinftagsreviewdiffrendererplugingutterstag webinftagsreviewdiffrenderertag webinftagsrevieweditdetailstag webinftagsreviewfrxfrxoutertag webinftagsreviewfrxcontrolstag webinftagsreviewfrxdisplaytag webinftagsreviewfrxinnertag webinftagsreviewfrxmodelloadertag webinftagsreviewfrxrevisiontocrurevisionmaptag webinftagsreviewfrxslidertag webinftagsreviewinsertconstraintsformtag webinftagsreviewinsertcustomfieldstag webinftagsreviewinsertcustomfieldsjsarraytag webinftagsreviewjiradisplaytag webinftagsreviewjiraedittag webinftagsreviewjiratitletag webinftagsreviewjsoncommenttag webinftagsreviewlinkedreviewstag webinftagsreviewparticipantslisttag webinftagsreviewparticipantsreviewerlisttag webinftagsreviewparticipantsrsstag webinftagsreviewpatchcontrolstag webinftagsreviewpatchlisttag webinftagsreviewprimeactiontag webinftagsreviewprojectagereporttag webinftagsreviewprojectcommentreporttag webinftagsreviewprojectdefectmetricreporttag webinftagsreviewprojectreviewsreporttag webinftagsreviewreplyrenderertag webinftagsreviewreviewdetailstag webinftagsreviewreviewdetailsparticipantrowtag webinftagsreviewreviewdetailsparticipantstag webinftagsreviewreviewfrxnavlisttag webinftagsreviewreviewheadtag webinftagsreviewreviewlinktag webinftagsreviewreviewmetainfotag webinftagsreviewreviewmetalinkstag webinftagsreviewreviewobjectivestag webinftagsreviewreviewoverviewitemtag webinftagsreviewreviewpagetag webinftagsreviewreviewresultlistviewtag webinftagsreviewreviewsidebartag webinftagsreviewreviewtoolbartag webinftagsreviewreviewupdatemessagetag webinftagsreviewsearchdefectmetricreporttag webinftagsreviewsnippetsnippetpagetag webinftagsreviewstateactionstag webinftagsreviewstatetexttag webinftagsreviewsubmittimetoissuedialogtag webinftagsreviewsystemcruciblereviewwebitemstag webinftagsreviewunlinkreviewtag webinftagswidgetautocompletetag wikitestwikirenderspacingjsp wikitestwikirenderjsp noformat

confluenceatlassiancom comment threading was turned off mysteriously on the upgrade need to check other prefs

michael did some investigation on the comments made in this thread it seems like a cloverdatabase instance is retained by the renderfileaction class via a static field used for thread local initialisation

note this bug report is for confluence server using confluence cloud see the corresponding bug report panelwe are running the current version of tc on it says your license entitles you to the confluence team calendars source for the period of your license but there is only source for version please make available the source for tc and the other versions of course incidentally is marked as unreleased in this jira instance please correct that too

note this bug report is for jira cloud using jira server see the corresponding bug report summarycloud to server import fails due to unknown environment cloud backup created from jira build jira server steps to reproduce generate backup from cloud instance restore to jira server expected resultsthe import will complete actual resultsthe below exception is thrown in the atlassianjiralog file and the import error anonymous securesetupimportjspa error importing data javalangillegalargumentexception could not find entity for entityname upgradetaskhistoryjavalangillegalargumentexception could not find entity for entityname upgradetaskhistory at at at at at at orgapachexercesparsersabstractsaxparserstartelementunknown source at orgapachexercesparsersabstractxmldocumentparseremptyelementunknown source at orgapachexercesimplxmldocumentfragmentscannerimplscanstartelementunknown source at orgapachexercesimplxmldocumentfragmentscannerimplfragmentcontentdispatcherdispatchunknown source at orgapachexercesimplxmldocumentfragmentscannerimplscandocumentunknown source at source at source at orgapachexercesparsersxmlparserparseunknown source at orgapachexercesparsersabstractsaxparserparseunknown source at orgapachexercesjaxpsaxparserimpljaxpsaxparserparseunknown source at at at at at at at at at at at at at at to the failure the following error is also info anonymous securesetupimportjspa failed to parse value for element upgradetaskhistoryauditlogjavalangillegalargumentexception could not find entity for entityname upgradetaskhistoryauditlog at at at at at at at orgapachexercesparsersabstractsaxparserstartelementunknown source at orgapachexercesparsersabstractxmldocumentparseremptyelementunknown source at orgapachexercesimplxmldocumentfragmentscannerimplscanstartelementunknown source at orgapachexercesimplxmldocumentfragmentscannerimplfragmentcontentdispatcherdispatchunknown source at orgapachexercesimplxmldocumentfragmentscannerimplscandocumentunknown source at source at source at orgapachexercesparsersxmlparserparseunknown source at orgapachexercesparsersabstractsaxparserparseunknown source at orgapachexercesjaxpsaxparserimpljaxpsaxparserparseunknown source at at at at at at at at at at at at at workaround unzip the backup run the following command to remove these entries egrep v upgradetaskhistoryauditlogupgradetaskhistory entitiesxml entitiespurgedxml run the command to rezip the backup mv entitiespurgedxml entitiesxml zip r mybackupfilezip entitiesxml activeobjectsxml restore should now complete successfully

coming to the bitbucket front page for the first time quite hard to see how to search for the repository you want there are multiple text input boxes but they are all for login andor openid input not that obvious that you must click on the repositories linka prominent serach box entitled find repository or similar would help a lot

jira agile fails because of the marker limit for ms sql server queries to reproduce when there is an additional rank custom field during upgrade jira agile will try to delete the ranks for this custom field if the duplicate rank field has more than records then upgrade fails result upgrade is completed without any failures use switching databases to use a database server eg postgresql that does not have this restriction information stacktrace noformat info administrator undo done class info administrator undo class info administrator finding issue ranking records for custom field rank info administrator deleting issue ranking records for custom field rank error administrator upgrade failed null javalangreflectinvocationtargetexception at method at sunreflectnativemethodaccessorimplinvokeunknown source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at at at source at at at at javalangreflectmethodinvokeunknown source at at at at at at at at at at at at at at at at at source at at at at at at at javalangreflectmethodinvokeunknown source at at source at javalangreflectmethodinvokeunknown source at at source at at at at at at javalangreflectmethodinvokeunknown source at at at at at at at at at at at at javalangreflectmethodinvokeunknown source at at source at javalangreflectmethodinvokeunknown source at at at at at at at at at at at at at at at at at source at at at at at javalangreflectmethodinvokeunknown source at at source at javalangreflectmethodinvokeunknown source at at source at at javalangreflectmethodinvokeunknown source at at at at at at at at at at at at at at at at at source at at at at at at at at at at at at at at at javautilconcurrentfuturetaskrununknown source at javautilconcurrentthreadpoolexecutorrunworkerunknown source at javautilconcurrentthreadpoolexecutorworkerrununknown source at javalangthreadrununknown source caused by comatlassianactiveobjectsinternalactiveobjectssqlexception there was a sql exception thrown by the active objects library database namemicrosoft sql server minor major namejtds type jdbc driver for ms sql server and sybase javasqlsqlexception prepared or callable statement has more than parameter markers at at at javalangreflectmethodinvokeunknown source at at at at at at at at at at at at at at at at at source at at at more caused by javasqlsqlexception prepared or callable statement has more than parameter markers at at at at at at at at javalangreflectmethodinvokeunknown source at at at source at at at more noformat

summary recently users are having issues related to the access to the billing details section specifically the following message is displayed quote we cant load this page right now quote steps to reproduce its unclear whats causing the issue but its confirmed to be browser related for the affected usersinstances the following steps can be followed be sure to be part of the siteadmins group so the site administration content can be accessed click on the application navigator site administration click on billing on the sidebar and select any of the options eg payment details expected results the content of the payment details should be loaded actual results no content is loaded only the we cant load this page right now information is displayed from the affected users either accessing the browser through incognito mode or making sure to clear all the cachecookies tied to the atlassian products

hi i want to reduce the notifications sent by jira indeed my email provider does not want messages sent exceeds a quota we send nearly notifications per day you have a solution to reduce this number when my provider blocks all system notifications are stuck in the queue the provider considers that a certain number it is spam being sent what can be done regards

note this bug report is for jira service desk cloud using jira service desk server see the corresponding bug report go to settings request types and then click edit fields for any of request fill in display names in russian greek or some other language using a nonlatin alphabet you can copy and paste this save and refreshresult nonlatin characters are lost question marks are shown insteadthe same problem exists for request names

issue summary currently when you trying to restrict a group with a capital letter for instance confluence page restriction autopopulated the group to lower letter and the restricted page disappear from the page tree steps to reproduce create a group and name it with a capital letter at the beginning for instance create a page and restrict the page to noticed that is autopopulated in the page restriction the page disappear from the page tree expected results page showing in the page tree actual results the restricted page disappears from the page tree workaround currently there is no known workaround for this behavior a workaround will be added here when available

hi our engineers are complaining that they are getting spammed by crucible putting at risk the implementation of crucible in the company i pointed them out to the review tab in their profile settings to set notifcation on comments to no but they are still getting the mass of emails when one of the reviewers makes a comment please let me know what could be the cause of this issue thanks

summary cvs repositories linked repositories are not available for selection in a source code checkout task for deployment environments steps to reproduce add a cvs linked repository at bamboo administration linked repositories add a source code checkout task to a deployment environment expected results cvs repository is available for selection actual results cvs repository is not available in the dropdown workaround none

reports in jira are unlimited in scope we had bots bring down jira because they anonymous followed links and brought lots of each into memory we should limit the report issues to a certain size or number of issues and we should ban anonymous people running reports at all probably

i have a project with the name büro berlin and a key bürobafter entering a bug for this project i get redirected to when selecting this bug from the issue navigator then the url is both urls work in msie however i think they should be the same and i think special characters such as umlauts must be properly encoded when using in an url at least i have never seen umlaut characters in an url

when you first load the login page in the form appears in the top left hand corner and then jumps into the correct position

i have a user building graphs using the xml view of a filter pulling back records from jira in the previous version we were running there was no limit to the number of records which could be pulled when referencing the xml view url with the new version we are on there is a tempmax variable which seems to limit the number of records returned by the query and when this number is increased very much we get the following error xml parsing error not wellformedlocation line number column high precision event timer drivercomment by rufus archon deletewilliam today this query failed without modifying the tempmax fieldquery and failurexml parsing error not wellformedlocation line number column high precision event timer driver

note this bug report is for jira server using jira cloud see the corresponding bug report description when user opened exported filter to xls file the exported xls file will open on blank sheet on libre office calc theres a possibility that this issue is related to libre office instead of jira since it can be opened using libre office findings when the attached file is opened using text editor you will see all the content inside ran xml validator against the attached file heres all the error returned noformat the reference to entity r must end with the delimiter the element type meta must be terminated by the matching endtag the element type img must be terminated by the matching endtag the element type tbody must be terminated by the matching endtag noformat steps to reproduce search or select any filter in jira click view excel and it will generate xls file open the file using libre office calc blank sheet will be displayed even though the file has content inside workaround open the generated file in libre office calc

note this bug report is for confluence server using confluence cloud see the corresponding bug report panelhi we have several projects with each their own board i am working on moving a lot of items from one board to the other these items all have attachments after having moved quite a lot of items i found out i couldnt open the attachments that where attached to the moved items among them are images text files and spreadsheets please dont tell me they are lost forever that would be a big problem hope to hear from you soon we are using this version

getting an internal server error when i try to disable the job api check noformat javalangillegalargumentexception cannot save merged build definitions at at at at source at at at at at at at at at source at at source at at at at at at at at at at at source at at at at at at at source at at at at at at at at at source at at at method noformat see the attached html file for the complete error page

note this bug report is for confluence cloud using confluence server see the corresponding bug report paneldear technicians and supportthe html code makro makes more work than it is supposed to ease thingseach time that i try to copy a code from notepadnotepad to the html makro it automatically removes all quotation marks and returns the destructive impact this has on the code i think is not mentionablei kindly ask you to fix this

note this bug report is for confluence server using confluence cloud see the corresponding bug report panelwe know that on windows we need to tweak the windows registry like below to make office connector works this is not scalable for customers with large number of dispersed users we should create a tool to help make confluence administrators life easier by configuring the registry automatically

expected behavior capture for jira plugin should be compatible with jira actual behavior capture for jira is marked as incompatible with jira however its functionality seems to be unaffected steps to reproduce install jira go to administration addons find new addons capture for jira will not be found because according to its marketplace page it doesnt have any version compatible with jira workaround download the jar file for the latest version of capture for jira from mpac and upload it manually into jira through administration addons manage addons we arent aware of any incompatibility problems but we cannot guarantee full functionality without a certified compatible version

my hg commits cannot be pushed to my repository server because of a permission error however sourcetree crashes right after

note this bug report is for confluence cloud using confluence server see the corresponding bug report panelproblem when using the drag and drop feature to move issues on team calendars the blow error is receivedquoteuh oh looks like something unexpectedly went wrong please check the confluence log filequotethe log file has no errors or a stack

stack trace error oauth rpcxmlrpc exception executing sql update create table issueid bigint not null nextid bigint primary keyissueid javasqlsqlexception there is already an object named in the database at at at at at at at at at at at at at at at at at at at at method at at at at at at at at at at at at at at at at at at at at source at at source at at at at at at at at at at at at at method at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at

no error handling on the bitbucket tab means if a problem occurs communicating with bitbucket then jira doesnt handle the exception correctly and the tabs turn off

if the address does not have an associated name the search is run using generalutiladdresspersonal this is not appropriate

note this bug report is for jira service desk server using jira service desk cloud see the corresponding bug report summary when an agent listed in request participant adds a comment to trigger an automation transition on comment the automation is not triggered steps to reproduce add an automation to transition on comment add an agent as a request participant login as the agent add a comment expected results issue is transitioned actual results issue is not transitioned no workaround at the moment

issue summary jira imports from trello boards no longer work that seems to be because of a change in trello security policies that were announced two months ago steps to reproduce go to jiras external system import select trello and follow the steps expected results the trello board and cards are imported to a jira project actual results error message noformat invalid returnurl wildcard allowed origins are no longer supported contact the developer see noformat workaround there is no workaround the external system importer must be fixed

issue summary the dropdown menu inserted in html macro doesnt present the drop list when adding a page layout to the page steps to reproduce enable the html module in the confluence html macros plugin located in the manage apps view create a page with a html macro insert html code to present a dropdown menu publish page test without page layout edit page and add a page layout formatting doesnt matter screen shot at pmpngthumbnail expected results drop down menu displays listed items as expected screen shot at pmpngthumbnail actual results the list doesnt render screen shot at pmpngthumbnail workaround currently there is no known workaround for this behavior a workaround will be added here when available

note this bug report is for confluence cloud using confluence server see the corresponding bug report panelwe would like to give access to all commission and eu institutions members to the page register of roadmaps eu legislation digital screening under space isa action at least for viewing and commentinghow should we proceed it seems that we do not have the rights to do that but require a global administrator to do so as indicated in the message below anonymous users cant view this space because global anonymous use confluence permission is currently turned off you should ask a global administrator to grant anonymous users permission to use confluence initially we wanted the group to access the page register of roadmaps eu legislation digital screening under space isa action while we managed the permissions accordingly this does not work they cannot access the following page

note this bug report is for confluence cloud using confluence server see the corresponding bug report panelwe received an external security report from monendra sahu that is vulnerable to clickjacking this can be fixed by sending a xframeoptions header with a value of sameorigin this will prevent answers from being displayed in frames on other websites see for more information

when i switched to an month old branch and source tree fetched older revisions to go back in time to that branch user interface showed this broken lines and nonmatching colours see attached screenshot

summary when you capture a screenshot then copy and paste it to confluence editor the image will appear broken when published environment firefox confluence steps to reproduce open confluence using firefox edit a confluence page capture a screenshot using lightshot screenshot copy and paste it to confluence editor publish the page expected results the screenshot should be attached to the page and it should be visible after published actual results the screenshot is not attached to the page and its appearing broken image after published use another browser to insert screenshots like chrome

when a page contains headings with international characters the fragment identifier the id attribute of the corresponding heading should not be url encoded confluence is incorrectly encoding this id attribute which breaks the interpage links created by the toc macro in firefox steps to reproduce create a page containing lots of blank lines followed by the heading á in the beginning of the page include the toc macro which will create a link to the a section save the page using firefox click on the link in the toc expected results the browser should scroll to the a section actual results nothing happens at first i thought this was a firefox bug but it turns out its a confluence bug additional details

i know how difficult could be but if you include iso valueslower than it will be very useful because it can avoid overexposing without filtering on high levels of lightgreat work alex and team

summary due to a longer project role name the remove option in the people tab gets overlapped steps to reproduce create a project role with a long name eg users hr bpo external users go to the people tab in project settings associate a usergroup with the new role created peoplepngthumbnail screenshot at expected results the long project role name should not overlap the remove option actual results the long project role name overlaps the remove option no workaround

issue summary jql like time to done breached returns an error error occurred communicating with the server please reload the page and try again if there are a lot of time metric with the same name steps to reproduce login to the instance go to advance search and run a jql against an sla that has many goals eg we will see an error error occurred communicating with the server please reload the page and try again reload the page we will see a internal server error expected results jql should give the results actual results error occurred communicating with the server please reload the page and try again with a stack overflow exception in the logs workaround only workaround we have currently is to reduce the number of sla goals in order for the jql to work fine this can be done by deleting the unused service desk projects

egcontext name my stuffjavascript span onclickboardseditctxmy could be fixed using

note this bug report is for confluence server using confluence cloud see the corresponding bug report steps to reproduce create a page add a junit report macro the macro browser preview renders error code error rendering macro junitreport error parsing junit report file javanetmalformedurlexception no protocol code this is probably related to

the mobile login page for confluence doesnt work properly in ondemand because it isnt properly redirected to the common indra login page for gappsenabled instances this means it doesnt work at all ideally wed build a responsive ui for our login and signup screens as covered under however a shortterm solution might be to adjust the filtering which redirects the confluence login pages to jira in ondemand so that these work for the mobile login page as well originally reported by as

issue summary occasionally the deployment plan appears to be misconfigured the ui shows that shared artifacts in the build plan are missing and artifacts cant be downloaded in deployment task steps to reproduce unable it appears random expected results deployment runs and succeeds as expected actual results the below exception is thrown in the deployment log noformat unable to download artifact shared artifact pattern anchored at noformat workaround if the deployment is managed in the ui resave the deployment tasks using the affected artifacts if the deployment is managed with bamboo specs edit the deployments spec to update the tasks for that deployment environment

steps preview an image on a page with other content drop a pinned comment on the image in preview click on the button on the pin drop comment what happened the page behind the preview is moving up and down when the button is clicked what should have happened no change in the page could this be a zindex problem

steps to reproduce make a comment then make a reply to the comment edit the reply make a change and save click on a new line in the snippet the comment form does not appear if you click on the reply to an existing comment and make a reply then the problem disappears and you can make new comments again

issue summary group picker with a restricted context does not show up in the approval configuration steps to reproduce create a multigroup picker field add it to the issue screen in go to the workflow for and click on configure approval for any workflow status ad you can see the custom field next update the context of the group custom field to be restricted to all issues in the go back to the workflows to configure approval for any workflow status expected results you can still see the group custom field actual results the group custom field is not visible workaround do not restrict the context of the group custom field

try following url replace username and password

environment crowd or stash jira steps to reproduce install crowd enable internal crowd user directory create a user in internal directory define an application connector for stash allow all to authenticate select enable aliasing under options install stash create a new user directory for crowd leave the default options click the button to test observe the following error in error sysadmin wszuva post pluginsservletembeddedcrowdconfigurecrowd caceaconfigurationcontroller configuration test failed for user directory type comatlassiancrowdexceptionruntimeoperationfailedexception error from crowd server propagated to here via rest api check the crowd server logs for details the validated object is null at at at at at at at at at at at at at at at at at at javautilconcurrentthreadpoolexecutorrunworkerunknown source at javalangthreadrununknown source frames trimmed caused by comatlassiancrowdexceptionoperationfailedexception error from crowd server propagated to here via rest api check the crowd server logs for details the validated object is null at at at at at common frames omitted caused by comatlassiancrowdintegrationrestservicecrowdrestexception the validated object is null at at at common frames omittednoformat observe the following error in error uncaught exception thrown by rest service the validated object is null javalangnullpointerexception the validated object is null at at at at source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at at at at at at at at at source at source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at at at at at at at source at at at at source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at at at at at at at at at source at source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at at at source at source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at at source at source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at at at at at at at at at at at at at at at at at source at at at at method at sunreflectnativemethodaccessorimplinvokeunknown source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at javautilconcurrentthreadpoolexecutorrunworkerunknown source at javautilconcurrentthreadpoolexecutorworkerrununknown source at at javalangthreadrununknown sourcenoformat workaround disable enable aliasing

issue summary user seeing internal server error when exporting excel for users at space analytic steps to reproduce navigate to space whose analytics you want to view click analytics in the sidebar the space analytics appear click the users tab click the ellipses on the top right of the page click export excel expected results the excel file will be downloaded actual results user seeing internal server error message workaround currently there is no known workaround for this behavior a workaround will be added here when available

hi friends why this message when i wanth push in my repositoryfailed to connect to bitbucketcom port network is unreachableare days from i have this message someone can hel me please

i have watchers on pages that are not receiving any emails i tried test emails and they work fine following is the stack trace of them error noformat error run there was an exception thrown trying to dispatch event from the invoker singleparametermethodlistenerinvokermethodpublic void comatlassianconfluencemailnotificationlistenerspageeventtodetachedpageeventtransformerlistenerhandleupdatedcomatlassianconfluenceeventeventscontentpagepageupdateevent url confluencepagesdoeditpageaction page username xxx referer action doeditpage javalangruntimeexception javalangnullpointerexception at at at at at at at at at source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at at at at at at at source at at at at source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at at at at at at at at at at at source at at at method at sunreflectnativemethodaccessorimplinvokeunknown source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at javalangthreadrununknown source caused by javalangnullpointerexception at at at at at at at source at sunreflectdelegatingmethodaccessorimplinvokeunknown source at javalangreflectmethodinvokeunknown source at more noformat the mailserver is set to be localhost but even pointing it to the relay server generated the same error this started to happen after i upgraded confluence i believe the previous version was

issue summary importexport operations are severely compromised due to an internal error for both jira and confluence cloud backups are also not generated environment jira cloud confluence cloud steps to reproduce try to generate a backup in both jira and confluence try to import a site backup in jira or a space in confluence expected results import or export would be generated backup would be generated actual results an error gets displayed internal error unable to create zip file but dont worry well fix it for you you just need to contact atlassian support and paste in this error message timestamp and your instance details timestamp options if you have your network tab on your browser open you will see several error response codes notes workaround for backups backup without attachments

the issue when using self signed certificates for ssl the apache modauthnzcrowd module crowd apache connector rejects the certificate regardless of configuration on the crowd server the symptoms when setting crowdurl to a https value in apache you will receive a error through the browser looking in the apache errorlog you will see failed to send authentication request curlcode this is returned by the curl library that the module uses to make its connection and error code from the curl library can be found here curlesslcacert peer certificate cannot be authenticated with known ca certificates a quick look at the curl manual reveals this option determines whether curl verifies the authenticity of the peers certificate a value of means curl verifies zero means it doesnt the solution see attached patch file simple one liner fix

summary documentation theme addon can get enabled automatically when we reenable confluence quicknav addon environment confluence steps to reproduce go to manage addons and view all addons disable confluence quicknav addon disable documentation theme addon enable confluence quicknav addon refresh the page and look for documentation theme addon expected results the documentation theme addon should remain disabled actual results the documentation theme addon is enabled automatically additional notes affects the below system addons as well confluence easyuser admin

when a user creates an ldap based directory ad sunone openldap apacheds etc the only directory types that are currently concerned about a password encoder type are openldap and apacheds however crowd is setting a passwordencoder for directories that do not care

summary the banner letting users know that their maintenance is about to expire is shown to admin level users however the rest endpoint that handles hiding the banner requires sysadmin level privileges this means that hiding the banner as an admin can never succeed and the banner will continue to be shown steps to reproduce create user give user admin permission enter license that expires in under days try to dismiss the banner that is shown expected results the banner is dismissed actual results the banner is not dismissed and appears on subsequent page loads a unauthorized error is logged to the browser console temporarily elevate the users permission to sysadmin to dismiss the banner or lower the users permission below admin the banner is only shown to users with admin or higher permission

when you switch to the remote repository source tree crashes i use github and bitbucket im sure that my password is correct adding remote repositories as well accompanied by a crash

issue summary when changing a color of any of the options under color scheme the links also change color to what should be the default steps to reproduce go to general configuration color scheme reset color scheme to default the links color will be set to blue however on the dashboard they appear as navy blue screen shot at screen shot at change any color but the links expected results the default color for the links should be blue already actual results even with the default color set to blue if nothings changed under color scheme the links will all be navy blue workaround if youd like to keep the navy blue while changing other colors on the color scheme use the hexadecimal color

some time ago when i had an unmapped user it was possible to click on the question mark in either the overview or commit tab and assign a bitbucket username to itthis is no longer possible it still shows the question mark but i can no longer click on it tested on firefox and chrome however it does work when viewing a single commit there i can click on the question mark

looks like broke something mail is getting repeatedly archivedhappened on dec and there are pages in the confluence space up from yesterdayhere is the short and sweet test space since clicking on the conlufence mail archive causes a timeoutalso points out a scaling problem since clicking on a large mail archive fails

i tried to configure cvs repository to my project directory which contains checkedout copy of a projecti got messageerror occurred while updating the cvs repository obtaining cvs log or parsing the cvs log please consult the log file for more details i checked out the console end found the following stacktracesee belowhow can i avoid error error occurred while updating the cvs repository obtaining cvs log or parsing the cvs logjavalangnullpointerexception at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at

note this bug report is for confluence server using confluence cloud see the corresponding bug report panelhi this happend a second time now and i think it worth to open a ticket the upgrade to confluence fails when thumbnails have special characters like german umlauts or is this a configuration issue code debug docleanupaftercompletion closing hibernate session after transaction debug closesession closing hibernate session debug trace trace eg debug configureeventchecks adding eventcheck of class comatlassianconfluencesetupjohnsonwebappcontextpathcheck error contextinitialized upgrade failed application will not start upgrade task failed class comatlassianconfluenceupgradeupgradetaskpurgethumbnailsupgradetask comatlassianconfluenceupgradeupgradeexception upgrade task failed class comatlassianconfluenceupgradeupgradetaskpurgethumbnailsupgradetask at at at at at at at at at at at at at at method at at at at at error contextinitialized errors were encountered during upgrade error contextinitialized error removing thumbnails directory from confluence home debug getbean returning cached instance of singleton bean lifecyclemanager debug gettransaction using transaction object debug gettransaction creating new transaction with name propagationrequiredisolationdefault debug dobegin opened new session for hibernate transaction code thanks peter

when jira dvcs connector is performing a long synchronisation from bitbucket cloud memcache from bitbucket side is expiring bitbucket returns error to jirasteps to reproduce in jira software link bitbucket cloud under the dvcs account configuration jira will then start adding the corresponding repository under certain circumstances sometimes jira fails to perform the synchronisation and bitbucket cloud returns error results bitbucket return error resultsjira dvcs connector is not aware of the memcache expiring and failed to reestablish a reconnection during this event bitbucket returns error jira bug ticket

the commit template settings screen has layout issues

note this bug report is for confluence cloud using confluence server see the corresponding bug report panelhiplease see my initial post here thanks

has a same bug with please correct it as soon as possible

the us govt is recommending users should uninstall quicktime for windows in order to assist users transition we need to drop support for quicktime plugin from multimedia plugins and use the video tag instead

see attached html and logfile for symptoms related to transaction management changes made for

note this bug report is for confluence cloud using confluence server see the corresponding bug report summarywhen copying a page with a large amount of attachments either in high number or large in size in the same space it generates an error saving is not possible at the steps to reproduce step attach attachments or several large attachments to a page and save it attempt to copy the page in the same space and save iti was not able to reproduce it if i saved and moved it to another space it only reproduced if i was making a copy renaming it and saving it within the same space expected resultspage copies with attachments successfully actual resultspage will error in saving is not possible at the moment it will finally save if you wait for a short period of time it doesnt appear to copy over all the attachments in my testing it seems that it copies only the active attachments in the body content the below exception is thrown in the xxxxxxxlog filenoformaterror execute could not synchronize database state with referer url wikirestapicontent traceid username error convertserviceexception no status code found for exception converting to internal server error url wikirestapicontent traceid username orgspringframeworkormhibernatehibernatesystemexception could not update nested exception is netsfhibernatehibernateexception could not update at caused by netsfhibernatehibernateexception could not update at at at at at at at at at at at at caused by netsfhibernatestaleobjectstateexception row was updated or deleted by another transaction or unsavedvalue mapping was incorrect for comatlassianconfluencepagesattachment instance with identifier at at run cannot convert execution error url wikipluginsdraganddropuploadaction traceid username referer action orgspringframeworkormhibernatehibernatesystemexception could not update nested exception is netsfhibernatehibernateexception could not update at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at caused by netsfhibernatehibernateexception could not update at at at at at at at at at caused by netsfhibernatestaleobjectstateexception row was updated or deleted by another transaction or unsavedvalue mapping was incorrect for comatlassianconfluencepagesattachment instance with identifier at at moreerror run cannot convert execution error url wikipluginsdraganddropuploadaction traceid username referer action orgspringframeworkormhibernatehibernatesystemexception could not update nested exception is netsfhibernatehibernateexception could not update at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at caused by netsfhibernatehibernateexception could not update at at at at at at at at at caused by netsfhibernatestaleobjectstateexception row was updated or deleted by another transaction or unsavedvalue mapping was incorrect for comatlassianconfluencepagesattachment instance with identifier at at morenoformat notesit seems during the draft there isnt enough time perform the copydraftconversion before the saving action is complete you wait a moment it will eventually save also you could potentially copy and save it to another space and move the copy back into the original source space

steps to reproduce set up a one node cluster either populate the instance with a lot of data or disable index flushing job so that reindexing will block index flush from happening during startup stop the node remove confluencehomejournalmainindex file start the node and let reindexing complete restart the node outcome reindexing is triggered again suggested fix update journal id to be the id of the latest entry in journalentry table at the beginning of reindexing

issue summary when you verify a domain but dont claim the accounts and want to set up a security policy eg saml a message saying you need to verify a domain is displayed even if you have already done that steps to reproduce verify a domain try to set up saml expected results a message saying you should claim the accounts should be displayed actual results instead a message saying you need to verify the domain is displayed workaround currently there is no known workaround for this behavior a workaround will be added here when available

the following stack backtrace occurs reliably when adding a new file to an existing repository the path to the file within the repository is aa forms to sortbzambarano qms training sopsvc‐ the path to the repository is cgitrepostraining the backtrace is error fatal error systemcollectionsgenerickeynotfoundexception the given key was not present in the dictionary at i at atlassianwpfcontrolpathtrimmingtextblockpathtrimmingtextblocktrimtextstring text typeface typeface double fontsize double parentalwidth at atlassianwpfcontrolpathtrimmingtextblockpathtrimmingtextblockapplytrimmedtexttextblock textblock string text at atlassianwpfcontrolpathtrimmingtextblockpathtrimmingtextblocktextpropertychangeddependencyobject d dependencypropertychangedeventargs e at atlassianwpfcontrolpathtrimmingtextblockpathtrimmingtextblockonsizechangedobject sender sizechangedeventargs sizechangedeventargs at sender eventargs e type managertype at systemwindowsweakeventmanagerdelivereventtolistobject sender eventargs args listenerlist list at systemwindowsweakeventmanagerdelivereventobject sender eventargs args at systemwindowsroutedeventargsinvokehandlerdelegate handler object target at systemwindowseventrouteinvokehandlersimplobject source routedeventargs args boolean reraised at systemwindowsuielementraiseeventimpldependencyobject sender routedeventargs args at systemwindowsframeworkelementonrendersizechangedsizechangedinfo sizeinfo at systemwindowscontextlayoutmanagerfiresizechangedevents at systemwindowscontextlayoutmanagerupdatelayout at systemwindowscontextlayoutmanagerupdatelayoutcallbackobject arg at systemwindowsmediamediacontextfireinvokeonrendercallbacks at systemwindowsmediamediacontextrendermessagehandlercoreobject resizedcompositiontarget at systemwindowsmediamediacontextrendermessagehandlerobject resizedcompositiontarget at systemwindowsthreadingexceptionwrapperinternalrealcalldelegate callback object args numargs at msinternalthreadingexceptionfilterhelpertrycatchwhenobject source delegate method object args numargs delegate catchhandler

see for more details

under certain conditions fetching the status of a workbox notification can oome the server this was observed on od instance rdcgroupatlassiannet via zoome link to oome details the truncated stack trace that blows the stack out and causes the oome is noformat at javalangoutofmemoryerrorv at javautilarrayscopyofcic at orgapachetomcatdbcpdbcpdelegatingresultsetgetobjectljavalangstringljavalangobject at netjavaaoentitymanagerfindljavalangclassljavalangstringlnetjavaaoquerylnetjavaaorawentity at netjavaaoentitymanagerfindljavalangclasslnetjavaaoquerylnetjavaaorawentity at comatlassianactiveobjectsinternalentitymanagedactiveobjectsfindljavalangclasslnetjavaaoquerylnetjavaaorawentity at comatlassianactiveobjectsosgitenantawareactiveobjectsfindljavalangclasslnetjavaaoquerylnetjavaaorawentity at comatlassianmyworkhostdaoaoaonotificationdaogetitemstatuslcomatlassianmyworkmodelnotificationlcomatlassianmyworkmodelstatus at comatlassianmyworkhostdaoaoaonotificationdaocreatelcomatlassianmyworkmodelnotificationljavautildatelcomatlassianmyworkmodelnotification at comatlassianmyworkhostdaoaoaonotificationdaocreatelcomatlassianmyworkmodelnotificationlcomatlassianmyworkmodelnotification noformat looking at the calling code in aonotificationdaogetitemstatus we see codejava for aonotification other aofindaonotificationclass selectwhereuser and globalid getstringkeyforusernamenotificationgetuser globalid return othergetstatus code here we have a for loop that returns from the method on the first loop iteration however the call to aofind is unbounded and so potentially can return a very large result set it doesnt matter that the for loop only wants the first one it appears that if a given notification has a large number of associated aonotifications for that user then memory usaqe will be high and may trigger an oome this method needs to be rewritten to limit the size of the result set to a single item

if the global anonymous permission to access is disabled the user still have to login in order to reset his password steps to reproduce disable the access permission for anonymous users at the admin global permissions logout and try to reset your password using the cant access your account link you will receive an email with a link click on the link result you will be redirected to a login page not a reset password page if you login with the correct password the reset page is then displayed but this is not useful when the user forgot his password

note this bug report is for confluence server using confluence cloud see the corresponding bug report panelwe dont style lists in email notifications so indented items have a bullet that doesnt look the same as it does on a confluence page see screenshot

we have varlibstashtmp as tmpfs mount all be fine until some of our plugin not filling this mount point entirely after that stash cant create merge commit and fail in pr with hey you have conflicts but no conflicts actually code caused by comatlassianstashexceptioncommandfailedexception usrbingit merge m merge pull request in projectrepo from to someotherbranch noff log exited with code saying fatal unable to write gitindex code after this error pr is frozen in always have conflicts but no conflicts actually state follow tryings not help restart stash it cleanup caches on start stop stash remove anythin in tmp caches start stash delete references in repository in stashrefs and refs namespaces numeriuos declinereopen only one thing that help in this situation git fsck full in repo on server cos code checking objects done error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry error invalid reflog entry checking connectivity done code

login to create a dashboard and add some try to share the there is no option share dashboard under the tools user should be able to share the dashboard

issue summary unable to delete field options in nextgen project field affected any dropdown fields environment affects only nextgen projects steps to reproduce create a dropdown field in nextgen project with multiple options save the settings now delete a few options save the settings verify again of the options are deleted we can observe that the options are indeed deleted now navigate to the board or issues of the project go back to project settings issue type select the dropdown field observe that the removed options are manifested back again expected results the options of the field should be deleted actual results the options are not deleted workaround currently there is no known workaround for this behavior a workaround will be added here when available

a bug was introduced in version of the lucidchart plugin for confluence ondemand that unintentionally set the default state of the plugin to enabled this is contrary to the intended behaviour of the plugin which should be disabled in every instance until the customer explicitly enables it

i have a user who only has view permissions to a space logging on as that user i went to the info tab of a page the copy operation appeared and i was able click the link edit the copied page and save it this must be a security hole