README.md

metadata

widget:
  - text: >-
      MEPLDDLDLLLLEEDSGAEAVPRMEILQKKADAFFAETVLSRGVDNRYLVLAVETKLNERGAEEKHLLITVSQEGEQEVLCILRNGWSSVPVEPGDIIHIEGDCTSEPWIVDDDFGYFILSPDMLISGTSVASSIRCLRRAVLSETFRVSDTATRQMLIGTILHEVFQKAISESFAPEKLQELALQTLREVRHLKEMYRLNLSQDEVRCEVEEYLPSFSKWADEFMHKGTKAEFPQMHLSLPSDSSDRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVKIHRDCKTKYKIMPLELKTGKESNSIEHRGQVILYTLLSQERREDPEAGWLLYLKTGQMYPVPANHLDKRELLKLRNQLAFSLLHRVSRAAAGEEARLLALPQIIEEEKTCKYCSQMGNCALYSRAVEQVHDTSIPEGMRSKIQEGTQHLTRAHLKYFSLWCLMLTLESQSKDTKKSHQSIWLTPASKLEESGNCIGSLVRTEPVKRVCDGHYLHNFQRKNGPMPATNLMAGDRIILSGEERKLFALSKGYVKRIDTAAVTCLLDRNLSTLPETTLFRLDREEKHGDINTPLGNLSKLMENTDSSKRLRELIIDFKEPQFIAYLSSVLPHDAKDTVANILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICALVRILSACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLGQSHKVHPDIQKFTEEEMCRLRSIASLAHLEELYNSHPVVATTCMGISHPMFSRKTFDFCIVDEASQISQPICLGPLFFSRRFVLVGDHKQLPPLVLNREARALGMSESLFKRLERNESAVVQLTIQYRMNRKIMSLSNKLTYEGKLECGSDRVANAVITLPNLKDVRLEFYADYSDNPWLAGVFEPDNPVCFLNTDKVPAPEQIENGGVSNVTEARLIVFLTSTFIKAGCSPSDIGIIAPYRQQLRTITDLLARSSVGMVEVNTVDKYQGRDKSLILVSFVRSNEDGTLGELLKDWRRLNVAITRAKHKLILLGSVSSLKRF
    example_title: Protein Sequence 1
  - text: >-
      MNSVTVSHAPYYIVYHDDWEPVMSQLVEFYNEVASWLLRDETSPIPPKFFIQLKQMLRNKRVCVCGILPYPIDGTGVPFESPNFTKKSIKEIASSISRLTGVIDYKGYNLNIIDGVIPWNYYLSCKLGETKSHAIYWDKISKLLLQHITKHVSVLYCLGKTDFSNIRAKLESPVTTIVGYHPAARDRQFEKDRSFEIINELLELDNKVPINWAQGFIY
    example_title: Protein Sequence 2
  - text: >-
      MNSVTVSHAPYTIAYHDDWEPVMSQLVEFYNEAASWLLRDETSPIPSKFNIQLKQPLRNKRVCVFGIDPYPKDGTGVPFESPNFTKKSIKEIASSISRLMGVIDYEGYNLNIIDGVIPWNYYLSCKLGETKSHAIYWDKISKLLLQHITKHVSVLYCLGKTDFSNIRAKLESPVTTIVGYHPSARDRQFEKDRSFEIINVLLELDNKVPLNWAQGFIY
    example_title: Protein Sequence 3
license: mit
datasets:
  - AmelieSchreiber/general_binding_sites
language:
  - en
metrics:
  - precision
  - recall
  - f1
library_name: transformers
tags:
  - biology
  - esm
  - esm2
  - ESM-2
  - protein language model

ESM-2 for General Protein Binding Site Prediction

This model is trained to predict general binding sites of proteins using on the sequence. This is a finetuned version of esm2_t6_8M_UR50D, trained on this dataset. The data is not filtered by family, and thus the model may be overfit to some degree. In the Hugging Face Inference API widget to the right there are three protein sequence examples. The first is a DNA binding protein (see UniProt entry here). Note there is significant overlap in the predicted binding sites and the binding sites given in UniProt.

The second and third were obtained using EvoProtGrad a Markov Chain Monte Carlo method of (in silico) directed evolution of proteins based on a form of Gibbs sampling. The mutatant-type protein sequences in theory should have similar binding sites to the wild-type protein sequence, but perhaps with higher binding affinity. Testing this out on the model, we see the two proteins indeed have the same binding sites, which validates to some degree that the model has learned to predict binding sites well (and that EvoProtGrad works as intended).

Training

epoch 3:
Training Loss Validation Loss Precision	Recall	 F1	      Auc
0.031100	  0.074720	      0.684798	0.966856 0.801743 0.980853

wandb: 	lr: 0.0004977045729600779
wandb: 	lr_scheduler_type: cosine
wandb: 	max_grad_norm: 0.5
wandb: 	num_train_epochs: 3
wandb: 	per_device_train_batch_size: 8
wandb: 	weight_decay: 0.025

Using the Model

Try pasting a protein sequence into the cell on the right and clicking on "Compute". For example, try

MNSVTVSHAPYTIAYHDDWEPVMSQLVEFYNEAASWLLRDETSPIPSKFNIQLKQPLRNKRVCVFGIDPYPKDGTGVPFESPNFTKKSIKEIASSISRLMGVIDYEGYNLNIIDGVIPWNYYLSCKLGETKSHAIYWDKISKLLLQHITKHVSVLYCLGKTDFSNIRAKLESPVTTIVGYHPSARDRQFEKDRSFEIINVLLELDNKVPLNWAQGFIY

To use the model, try running:

import torch
from transformers import AutoModelForTokenClassification, AutoTokenizer

def predict_binding_sites(model_path, protein_sequences):
    """
    Predict binding sites for a collection of protein sequences.

    Parameters:
    - model_path (str): Path to the saved model.
    - protein_sequences (List[str]): List of protein sequences.

    Returns:
    - List[List[str]]: Predicted labels for each sequence.
    """

    # Load tokenizer and model
    tokenizer = AutoTokenizer.from_pretrained(model_path)
    model = AutoModelForTokenClassification.from_pretrained(model_path)

    # Ensure model is in evaluation mode
    model.eval()

    # Tokenize sequences
    inputs = tokenizer(protein_sequences, return_tensors="pt", padding=True, truncation=True)

    # Move to the same device as model and obtain logits
    with torch.no_grad():
        logits = model(**inputs).logits

    # Obtain predicted labels
    predicted_labels = torch.argmax(logits, dim=-1).cpu().numpy()

    # Convert label IDs to human-readable labels
    id2label = model.config.id2label
    human_readable_labels = [[id2label[label_id] for label_id in sequence] for sequence in predicted_labels]

    return human_readable_labels

# Usage:
model_path = "AmelieSchreiber/esm2_t6_8M_general_binding_sites_v2"  # Replace with your model's path
unseen_proteins = [
    "MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD", 
    "MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIAVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPSLGFFKVKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD", 
    "MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEAVFVGSYARNTWLKGSLEIAVFLLFPEEFSKEELRERGLEIEKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKELEGRIKGKENEVRLLKGFLKANGIYGAEYAVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPSLGFFKVKHPLEIEPERLRKIVEERGTAVFMVKFRKPDIVDDNLYPQLRRASRKIFEFLERNNFMPLRSAFKASEEFCYLLFECQIKEISDVFRRMGPLFEDERNVKKFLSRNRALRPFIENGRWWIFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFEIISGEKLFKEPVTAELCRMMGVKD", 
    "MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEAVFVGSYARNTWLKGSLEIAVFLLFPEEFSKEELRERGLEIEKAVLDSYGIRYAEHPYVHGVVKGVELDVVPCYKLKEPKNIKSAVDRTPFHHKELEGRIKGKENEYRSLKGFLKANGIYGAEYAVRGFSGYLCELLIVFYGSFLETVKNARRWTRKTVIDVAKGEVRKGEEFFVVDPVDEKRNVAALLSLDNLARFVHLCREFMEAVSLGFFKVKHPLEIEPERLRKIVEERGTAVFMVKFRKPDIVDDNLYPQLRRASRKIFEFLERNNFMPLRRAFKASEEFCYLLFEQQIKEISDVFRRMGPLFEDERNVKKFLSRNRALRPFIENGRWWIFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFEIIEGEKLFKEPVTAELCRMMGVKD"
]  # Replace with your unseen protein sequences
predictions = predict_binding_sites(model_path, unseen_proteins)
predictions