Update README.md
Browse files
README.md
CHANGED
|
@@ -20,4 +20,95 @@ outputs probability scores. (How likely is it that this sequence belongs to this
|
|
| 20 |
The way you use this model for a demo is, you paste a protein sequence
|
| 21 |
into the inference box and it outputs the relevant probabilities that certain GO terms are
|
| 22 |
associated with that sequence.
|
| 23 |
-
For example MMSTTHLLVFLLGVVTLTTPTFGTYESPNYGKPPTPVFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPTMYEPPKKEKPEPKPPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPPKKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPPKKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPPNNPPIYEPKPPKPPVYAPPKEEKPKPKPPVYEPPAHEPPYGHYPGHPPLGKPQ
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 20 |
The way you use this model for a demo is, you paste a protein sequence
|
| 21 |
into the inference box and it outputs the relevant probabilities that certain GO terms are
|
| 22 |
associated with that sequence.
|
| 23 |
+
For example MMSTTHLLVFLLGVVTLTTPTFGTYESPNYGKPPTPVFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPTMYEPPKKEKPEPKPPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPPKKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPPKKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPPNNPPIYEPKPPKPPVYAPPKEEKPKPKPPVYEPPAHEPPYGHYPGHPPLGKPQ
|
| 24 |
+
|
| 25 |
+
|
| 26 |
+
outputs the following score
|
| 27 |
+
```
|
| 28 |
+
[
|
| 29 |
+
[
|
| 30 |
+
{
|
| 31 |
+
"label": "GO:0000122",
|
| 32 |
+
"score": 0.29775485396385193
|
| 33 |
+
},
|
| 34 |
+
{
|
| 35 |
+
"label": "GO:0000070",
|
| 36 |
+
"score": 0.10477513074874878
|
| 37 |
+
},
|
| 38 |
+
{
|
| 39 |
+
"label": "GO:0000075",
|
| 40 |
+
"score": 0.08593793958425522
|
| 41 |
+
},
|
| 42 |
+
{
|
| 43 |
+
"label": "GO:0000118",
|
| 44 |
+
"score": 0.05860009789466858
|
| 45 |
+
},
|
| 46 |
+
{
|
| 47 |
+
"label": "GO:0000082",
|
| 48 |
+
"score": 0.05373986065387726
|
| 49 |
+
},
|
| 50 |
+
{
|
| 51 |
+
"label": "GO:0000077",
|
| 52 |
+
"score": 0.03928716108202934
|
| 53 |
+
},
|
| 54 |
+
{
|
| 55 |
+
"label": "GO:0000096",
|
| 56 |
+
"score": 0.03705739229917526
|
| 57 |
+
},
|
| 58 |
+
{
|
| 59 |
+
"label": "GO:0000079",
|
| 60 |
+
"score": 0.02797592058777809
|
| 61 |
+
},
|
| 62 |
+
{
|
| 63 |
+
"label": "GO:0000045",
|
| 64 |
+
"score": 0.026528609916567802
|
| 65 |
+
},
|
| 66 |
+
{
|
| 67 |
+
"label": "GO:0000097",
|
| 68 |
+
"score": 0.026119187474250793
|
| 69 |
+
},
|
| 70 |
+
{
|
| 71 |
+
"label": "GO:0000086",
|
| 72 |
+
"score": 0.019697198644280434
|
| 73 |
+
},
|
| 74 |
+
{
|
| 75 |
+
"label": "GO:0000049",
|
| 76 |
+
"score": 0.018551582470536232
|
| 77 |
+
},
|
| 78 |
+
{
|
| 79 |
+
"label": "GO:0000041",
|
| 80 |
+
"score": 0.016929756850004196
|
| 81 |
+
},
|
| 82 |
+
{
|
| 83 |
+
"label": "GO:0000054",
|
| 84 |
+
"score": 0.015105823054909706
|
| 85 |
+
},
|
| 86 |
+
{
|
| 87 |
+
"label": "GO:0000083",
|
| 88 |
+
"score": 0.01434631273150444
|
| 89 |
+
},
|
| 90 |
+
{
|
| 91 |
+
"label": "GO:0000105",
|
| 92 |
+
"score": 0.013960960321128368
|
| 93 |
+
},
|
| 94 |
+
{
|
| 95 |
+
"label": "GO:0000076",
|
| 96 |
+
"score": 0.013064960949122906
|
| 97 |
+
},
|
| 98 |
+
{
|
| 99 |
+
"label": "GO:0000109",
|
| 100 |
+
"score": 0.012523632496595383
|
| 101 |
+
},
|
| 102 |
+
{
|
| 103 |
+
"label": "GO:0000113",
|
| 104 |
+
"score": 0.012152223847806454
|
| 105 |
+
},
|
| 106 |
+
{
|
| 107 |
+
"label": "GO:0000062",
|
| 108 |
+
"score": 0.01127714291214943
|
| 109 |
+
},
|
| 110 |
+
{
|
| 111 |
+
"label": "GO:0000101",
|
| 112 |
+
"score": 0.011041304096579552
|
| 113 |
+
},
|
| 114 |
+
```
|