Datasets:

librarian-bots

/

model_cards_with_metadata

like 9

vikhyatk/moondream2

vikhyatk

transformers

image-text-to-text

--- license: apache-2.0 pipeline_tag: image-text-to-text --- moondream2 is a small vision language model designed to run efficiently on edge devices. Check out the [GitHub repository](https://github.com/vikhyat/moondream) for details, or try it out on the [Hugging Face Space](https://huggingface.co/spaces/vikhyatk/moondream2)! **Benchmarks** | Release | VQAv2 | GQA | TextVQA | DocVQA | TallyQA<br>(simple/full) | POPE<br>(rand/pop/adv) | | --- | --- | --- | --- | --- | --- | --- | | **2024-07-23** (latest) | 79.4 | 64.9 | 60.2 | 61.9 | 82.0 / 76.8 | 91.3 / 89.7 / 86.9 | | 2024-05-20 | 79.4 | 63.1 | 57.2 | 30.5 | 82.1 / 76.6 | 91.5 / 89.6 / 86.2 | | 2024-05-08 | 79.0 | 62.7 | 53.1 | 30.5 | 81.6 / 76.1 | 90.6 / 88.3 / 85.0 | | 2024-04-02 | 77.7 | 61.7 | 49.7 | 24.3 | 80.1 / 74.2 | - | | 2024-03-13 | 76.8 | 60.6 | 46.4 | 22.2 | 79.6 / 73.3 | - | | 2024-03-06 | 75.4 | 59.8 | 43.1 | 20.9 | 79.5 / 73.2 | - | | 2024-03-04 | 74.2 | 58.5 | 36.4 | - | - | - | **Usage** ```bash pip install transformers einops ``` ```python from transformers import AutoModelForCausalLM, AutoTokenizer from PIL import Image model_id = "vikhyatk/moondream2" revision = "2024-07-23" model = AutoModelForCausalLM.from_pretrained( model_id, trust_remote_code=True, revision=revision ) tokenizer = AutoTokenizer.from_pretrained(model_id, revision=revision) image = Image.open('<IMAGE_PATH>') enc_image = model.encode_image(image) print(model.answer_question(enc_image, "Describe this image.", tokenizer)) ``` The model is updated regularly, so we recommend pinning the model version to a specific release as shown above.

lxyuan/distilbert-base-multilingual-cased-sentiments-student

lxyuan

transformers

text-classification

--- license: apache-2.0 tags: - sentiment-analysis - text-classification - zero-shot-distillation - distillation - zero-shot-classification - debarta-v3 model-index: - name: distilbert-base-multilingual-cased-sentiments-student results: [] datasets: - tyqiangz/multilingual-sentiments language: - en - ar - de - es - fr - ja - zh - id - hi - it - ms - pt --- <!-- This model card has been generated automatically according to the information the Trainer had access to. You should probably proofread and complete it, then remove this comment. --> # distilbert-base-multilingual-cased-sentiments-student This model is distilled from the zero-shot classification pipeline on the Multilingual Sentiment dataset using this [script](https://github.com/huggingface/transformers/tree/main/examples/research_projects/zero-shot-distillation). In reality the multilingual-sentiment dataset is annotated of course, but we'll pretend and ignore the annotations for the sake of example. Teacher model: MoritzLaurer/mDeBERTa-v3-base-mnli-xnli Teacher hypothesis template: "The sentiment of this text is {}." Student model: distilbert-base-multilingual-cased ## Inference example ```python from transformers import pipeline distilled_student_sentiment_classifier = pipeline( model="lxyuan/distilbert-base-multilingual-cased-sentiments-student", return_all_scores=True ) # english distilled_student_sentiment_classifier ("I love this movie and i would watch it again and again!") >> [[{'label': 'positive', 'score': 0.9731044769287109}, {'label': 'neutral', 'score': 0.016910076141357422}, {'label': 'negative', 'score': 0.009985478594899178}]] # malay distilled_student_sentiment_classifier("Saya suka filem ini dan saya akan menontonnya lagi dan lagi!") [[{'label': 'positive', 'score': 0.9760093688964844}, {'label': 'neutral', 'score': 0.01804516464471817}, {'label': 'negative', 'score': 0.005945465061813593}]] # japanese distilled_student_sentiment_classifier("私はこの映画が大好きで、何度も見ます！") >> [[{'label': 'positive', 'score': 0.9342429041862488}, {'label': 'neutral', 'score': 0.040193185210227966}, {'label': 'negative', 'score': 0.025563929229974747}]] ``` ## Training procedure Notebook link: [here](https://github.com/LxYuan0420/nlp/blob/main/notebooks/Distilling_Zero_Shot_multilingual_distilbert_sentiments_student.ipynb) ### Training hyperparameters Result can be reproduce using the following commands: ```bash python transformers/examples/research_projects/zero-shot-distillation/distill_classifier.py \ --data_file ./multilingual-sentiments/train_unlabeled.txt \ --class_names_file ./multilingual-sentiments/class_names.txt \ --hypothesis_template "The sentiment of this text is {}." \ --teacher_name_or_path MoritzLaurer/mDeBERTa-v3-base-mnli-xnli \ --teacher_batch_size 32 \ --student_name_or_path distilbert-base-multilingual-cased \ --output_dir ./distilbert-base-multilingual-cased-sentiments-student \ --per_device_train_batch_size 16 \ --fp16 ``` If you are training this model on Colab, make the following code changes to avoid Out-of-memory error message: ```bash ###### modify L78 to disable fast tokenizer default=False, ###### update dataset map part at L313 dataset = dataset.map(tokenizer, input_columns="text", fn_kwargs={"padding": "max_length", "truncation": True, "max_length": 512}) ###### add following lines to L213 del model print(f"Manually deleted Teacher model, free some memory for student model.") ###### add following lines to L337 trainer.push_to_hub() tokenizer.push_to_hub("distilbert-base-multilingual-cased-sentiments-student") ``` ### Training log ```bash Training completed. Do not forget to share your model on huggingface.co/models =) {'train_runtime': 2009.8864, 'train_samples_per_second': 73.0, 'train_steps_per_second': 4.563, 'train_loss': 0.6473459283913797, 'epoch': 1.0} 100%|███████████████████████████████████████| 9171/9171 [33:29<00:00, 4.56it/s] [INFO|trainer.py:762] 2023-05-06 10:56:18,555 >> The following columns in the evaluation set don't have a corresponding argument in `DistilBertForSequenceClassification.forward` and have been ignored: text. If text are not expected by `DistilBertForSequenceClassification.forward`, you can safely ignore this message. [INFO|trainer.py:3129] 2023-05-06 10:56:18,557 >> ***** Running Evaluation ***** [INFO|trainer.py:3131] 2023-05-06 10:56:18,557 >> Num examples = 146721 [INFO|trainer.py:3134] 2023-05-06 10:56:18,557 >> Batch size = 128 100%|███████████████████████████████████████| 1147/1147 [08:59<00:00, 2.13it/s] 05/06/2023 11:05:18 - INFO - __main__ - Agreement of student and teacher predictions: 88.29% [INFO|trainer.py:2868] 2023-05-06 11:05:18,251 >> Saving model checkpoint to ./distilbert-base-multilingual-cased-sentiments-student [INFO|configuration_utils.py:457] 2023-05-06 11:05:18,251 >> Configuration saved in ./distilbert-base-multilingual-cased-sentiments-student/config.json [INFO|modeling_utils.py:1847] 2023-05-06 11:05:18,905 >> Model weights saved in ./distilbert-base-multilingual-cased-sentiments-student/pytorch_model.bin [INFO|tokenization_utils_base.py:2171] 2023-05-06 11:05:18,905 >> tokenizer config file saved in ./distilbert-base-multilingual-cased-sentiments-student/tokenizer_config.json [INFO|tokenization_utils_base.py:2178] 2023-05-06 11:05:18,905 >> Special tokens file saved in ./distilbert-base-multilingual-cased-sentiments-student/special_tokens_map.json ``` ### Framework versions - Transformers 4.28.1 - Pytorch 2.0.0+cu118 - Datasets 2.11.0 - Tokenizers 0.13.3

meta-llama/Llama-2-13b-chat-hf

meta-llama

transformers

text-generation

--- extra_gated_heading: You need to share contact information with Meta to access this model extra_gated_prompt: >- ### LLAMA 2 COMMUNITY LICENSE AGREEMENT "Agreement" means the terms and conditions for use, reproduction, distribution and modification of the Llama Materials set forth herein. "Documentation" means the specifications, manuals and documentation accompanying Llama 2 distributed by Meta at https://ai.meta.com/resources/models-and-libraries/llama-downloads/. "Licensee" or "you" means you, or your employer or any other person or entity (if you are entering into this Agreement on such person or entity's behalf), of the age required under applicable laws, rules or regulations to provide legal consent and that has legal authority to bind your employer or such other person or entity if you are entering in this Agreement on their behalf. "Llama 2" means the foundational large language models and software and algorithms, including machine-learning model code, trained model weights, inference-enabling code, training-enabling code, fine-tuning enabling code and other elements of the foregoing distributed by Meta at ai.meta.com/resources/models-and-libraries/llama-downloads/. "Llama Materials" means, collectively, Meta's proprietary Llama 2 and documentation (and any portion thereof) made available under this Agreement. "Meta" or "we" means Meta Platforms Ireland Limited (if you are located in or, if you are an entity, your principal place of business is in the EEA or Switzerland) and Meta Platforms, Inc. (if you are located outside of the EEA or Switzerland). By clicking "I Accept" below or by using or distributing any portion or element of the Llama Materials, you agree to be bound by this Agreement. 1. License Rights and Redistribution. a. Grant of Rights. You are granted a non-exclusive, worldwide, non- transferable and royalty-free limited license under Meta's intellectual property or other rights owned by Meta embodied in the Llama Materials to use, reproduce, distribute, copy, create derivative works of, and make modifications to the Llama Materials. b. Redistribution and Use. i. If you distribute or make the Llama Materials, or any derivative works thereof, available to a third party, you shall provide a copy of this Agreement to such third party. ii. If you receive Llama Materials, or any derivative works thereof, from a Licensee as part of an integrated end user product, then Section 2 of this Agreement will not apply to you. iii. You must retain in all copies of the Llama Materials that you distribute the following attribution notice within a "Notice" text file distributed as a part of such copies: "Llama 2 is licensed under the LLAMA 2 Community License, Copyright (c) Meta Platforms, Inc. All Rights Reserved." iv. Your use of the Llama Materials must comply with applicable laws and regulations (including trade compliance laws and regulations) and adhere to the Acceptable Use Policy for the Llama Materials (available at https://ai.meta.com/llama/use-policy), which is hereby incorporated by reference into this Agreement. v. You will not use the Llama Materials or any output or results of the Llama Materials to improve any other large language model (excluding Llama 2 or derivative works thereof). 2. Additional Commercial Terms. If, on the Llama 2 version release date, the monthly active users of the products or services made available by or for Licensee, or Licensee's affiliates, is greater than 700 million monthly active users in the preceding calendar month, you must request a license from Meta, which Meta may grant to you in its sole discretion, and you are not authorized to exercise any of the rights under this Agreement unless or until Meta otherwise expressly grants you such rights. 3. Disclaimer of Warranty. UNLESS REQUIRED BY APPLICABLE LAW, THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS THEREFROM ARE PROVIDED ON AN "AS IS" BASIS, WITHOUT WARRANTIES OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING, WITHOUT LIMITATION, ANY WARRANTIES OF TITLE, NON-INFRINGEMENT, MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE. YOU ARE SOLELY RESPONSIBLE FOR DETERMINING THE APPROPRIATENESS OF USING OR REDISTRIBUTING THE LLAMA MATERIALS AND ASSUME ANY RISKS ASSOCIATED WITH YOUR USE OF THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS. 4. Limitation of Liability. IN NO EVENT WILL META OR ITS AFFILIATES BE LIABLE UNDER ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, TORT, NEGLIGENCE, PRODUCTS LIABILITY, OR OTHERWISE, ARISING OUT OF THIS AGREEMENT, FOR ANY LOST PROFITS OR ANY INDIRECT, SPECIAL, CONSEQUENTIAL, INCIDENTAL, EXEMPLARY OR PUNITIVE DAMAGES, EVEN IF META OR ITS AFFILIATES HAVE BEEN ADVISED OF THE POSSIBILITY OF ANY OF THE FOREGOING. 5. Intellectual Property. a. No trademark licenses are granted under this Agreement, and in connection with the Llama Materials, neither Meta nor Licensee may use any name or mark owned by or associated with the other or any of its affiliates, except as required for reasonable and customary use in describing and redistributing the Llama Materials. b. Subject to Meta's ownership of Llama Materials and derivatives made by or for Meta, with respect to any derivative works and modifications of the Llama Materials that are made by you, as between you and Meta, you are and will be the owner of such derivative works and modifications. c. If you institute litigation or other proceedings against Meta or any entity (including a cross-claim or counterclaim in a lawsuit) alleging that the Llama Materials or Llama 2 outputs or results, or any portion of any of the foregoing, constitutes infringement of intellectual property or other rights owned or licensable by you, then any licenses granted to you under this Agreement shall terminate as of the date such litigation or claim is filed or instituted. You will indemnify and hold harmless Meta from and against any claim by any third party arising out of or related to your use or distribution of the Llama Materials. 6. Term and Termination. The term of this Agreement will commence upon your acceptance of this Agreement or access to the Llama Materials and will continue in full force and effect until terminated in accordance with the terms and conditions herein. Meta may terminate this Agreement if you are in breach of any term or condition of this Agreement. Upon termination of this Agreement, you shall delete and cease use of the Llama Materials. Sections 3, 4 and 7 shall survive the termination of this Agreement. 7. Governing Law and Jurisdiction. This Agreement will be governed and construed under the laws of the State of California without regard to choice of law principles, and the UN Convention on Contracts for the International Sale of Goods does not apply to this Agreement. The courts of California shall have exclusive jurisdiction of any dispute arising out of this Agreement. ### Llama 2 Acceptable Use Policy Meta is committed to promoting safe and fair use of its tools and features, including Llama 2. If you access or use Llama 2, you agree to this Acceptable Use Policy (“Policy”). The most recent copy of this policy can be found at [ai.meta.com/llama/use-policy](http://ai.meta.com/llama/use-policy). #### Prohibited Uses We want everyone to use Llama 2 safely and responsibly. You agree you will not use, or allow others to use, Llama 2 to: 1. Violate the law or others’ rights, including to: 1. Engage in, promote, generate, contribute to, encourage, plan, incite, or further illegal or unlawful activity or content, such as: 1. Violence or terrorism 2. Exploitation or harm to children, including the solicitation, creation, acquisition, or dissemination of child exploitative content or failure to report Child Sexual Abuse Material 3. Human trafficking, exploitation, and sexual violence 4. The illegal distribution of information or materials to minors, including obscene materials, or failure to employ legally required age-gating in connection with such information or materials. 5. Sexual solicitation 6. Any other criminal activity 2. Engage in, promote, incite, or facilitate the harassment, abuse, threatening, or bullying of individuals or groups of individuals 3. Engage in, promote, incite, or facilitate discrimination or other unlawful or harmful conduct in the provision of employment, employment benefits, credit, housing, other economic benefits, or other essential goods and services 4. Engage in the unauthorized or unlicensed practice of any profession including, but not limited to, financial, legal, medical/health, or related professional practices 5. Collect, process, disclose, generate, or infer health, demographic, or other sensitive personal or private information about individuals without rights and consents required by applicable laws 6. Engage in or facilitate any action or generate any content that infringes, misappropriates, or otherwise violates any third-party rights, including the outputs or results of any products or services using the Llama 2 Materials 7. Create, generate, or facilitate the creation of malicious code, malware, computer viruses or do anything else that could disable, overburden, interfere with or impair the proper working, integrity, operation or appearance of a website or computer system 2. Engage in, promote, incite, facilitate, or assist in the planning or development of activities that present a risk of death or bodily harm to individuals, including use of Llama 2 related to the following: 1. Military, warfare, nuclear industries or applications, espionage, use for materials or activities that are subject to the International Traffic Arms Regulations (ITAR) maintained by the United States Department of State 2. Guns and illegal weapons (including weapon development) 3. Illegal drugs and regulated/controlled substances 4. Operation of critical infrastructure, transportation technologies, or heavy machinery 5. Self-harm or harm to others, including suicide, cutting, and eating disorders 6. Any content intended to incite or promote violence, abuse, or any infliction of bodily harm to an individual 3. Intentionally deceive or mislead others, including use of Llama 2 related to the following: 1. Generating, promoting, or furthering fraud or the creation or promotion of disinformation 2. Generating, promoting, or furthering defamatory content, including the creation of defamatory statements, images, or other content 3. Generating, promoting, or further distributing spam 4. Impersonating another individual without consent, authorization, or legal right 5. Representing that the use of Llama 2 or outputs are human-generated 6. Generating or facilitating false online engagement, including fake reviews and other means of fake online engagement 4. Fail to appropriately disclose to end users any known dangers of your AI system Please report any violation of this Policy, software “bug,” or other problems that could lead to a violation of this Policy through one of the following means: * Reporting issues with the model: [github.com/facebookresearch/llama](http://github.com/facebookresearch/llama) * Reporting risky content generated by the model: [developers.facebook.com/llama_output_feedback](http://developers.facebook.com/llama_output_feedback) * Reporting bugs and security concerns: [facebook.com/whitehat/info](http://facebook.com/whitehat/info) * Reporting violations of the Acceptable Use Policy or unlicensed uses of Llama: [LlamaUseReport@meta.com](mailto:LlamaUseReport@meta.com) extra_gated_fields: First Name: text Last Name: text Date of birth: date_picker Country: country Affiliation: text geo: ip_location By clicking Submit below I accept the terms of the license and acknowledge that the information I provide will be collected stored processed and shared in accordance with the Meta Privacy Policy: checkbox extra_gated_description: >- The information you provide will be collected, stored, processed and shared in accordance with the [Meta Privacy Policy](https://www.facebook.com/privacy/policy/). extra_gated_button_content: Submit language: - en pipeline_tag: text-generation tags: - facebook - meta - pytorch - llama - llama-2 license: llama2 --- # **Llama 2** Llama 2 is a collection of pretrained and fine-tuned generative text models ranging in scale from 7 billion to 70 billion parameters. This is the repository for the 13B fine-tuned model, optimized for dialogue use cases and converted for the Hugging Face Transformers format. Links to other models can be found in the index at the bottom. ## Model Details *Note: Use of this model is governed by the Meta license. In order to download the model weights and tokenizer, please visit the [website](https://ai.meta.com/resources/models-and-libraries/llama-downloads/) and accept our License before requesting access here.* Meta developed and publicly released the Llama 2 family of large language models (LLMs), a collection of pretrained and fine-tuned generative text models ranging in scale from 7 billion to 70 billion parameters. Our fine-tuned LLMs, called Llama-2-Chat, are optimized for dialogue use cases. Llama-2-Chat models outperform open-source chat models on most benchmarks we tested, and in our human evaluations for helpfulness and safety, are on par with some popular closed-source models like ChatGPT and PaLM. **Model Developers** Meta **Variations** Llama 2 comes in a range of parameter sizes — 7B, 13B, and 70B — as well as pretrained and fine-tuned variations. **Input** Models input text only. **Output** Models generate text only. **Model Architecture** Llama 2 is an auto-regressive language model that uses an optimized transformer architecture. The tuned versions use supervised fine-tuning (SFT) and reinforcement learning with human feedback (RLHF) to align to human preferences for helpfulness and safety. ||Training Data|Params|Content Length|GQA|Tokens|LR| |---|---|---|---|---|---|---| |Llama 2|*A new mix of publicly available online data*|7B|4k|&#10007;|2.0T|3.0 x 10^-4| |Llama 2|*A new mix of publicly available online data*|13B|4k|&#10007;|2.0T|3.0 x 10^-4| |Llama 2|*A new mix of publicly available online data*|70B|4k|&#10004;|2.0T|1.5 x 10^-4| *Llama 2 family of models.* Token counts refer to pretraining data only. All models are trained with a global batch-size of 4M tokens. Bigger models - 70B -- use Grouped-Query Attention (GQA) for improved inference scalability. **Model Dates** Llama 2 was trained between January 2023 and July 2023. **Status** This is a static model trained on an offline dataset. Future versions of the tuned models will be released as we improve model safety with community feedback. **License** A custom commercial license is available at: [https://ai.meta.com/resources/models-and-libraries/llama-downloads/](https://ai.meta.com/resources/models-and-libraries/llama-downloads/) **Research Paper** ["Llama-2: Open Foundation and Fine-tuned Chat Models"](arxiv.org/abs/2307.09288) ## Intended Use **Intended Use Cases** Llama 2 is intended for commercial and research use in English. Tuned models are intended for assistant-like chat, whereas pretrained models can be adapted for a variety of natural language generation tasks. To get the expected features and performance for the chat versions, a specific formatting needs to be followed, including the `INST` and `<<SYS>>` tags, `BOS` and `EOS` tokens, and the whitespaces and breaklines in between (we recommend calling `strip()` on inputs to avoid double-spaces). See our reference code in github for details: [`chat_completion`](https://github.com/facebookresearch/llama/blob/main/llama/generation.py#L212). **Out-of-scope Uses** Use in any manner that violates applicable laws or regulations (including trade compliance laws).Use in languages other than English. Use in any other way that is prohibited by the Acceptable Use Policy and Licensing Agreement for Llama 2. ## Hardware and Software **Training Factors** We used custom training libraries, Meta's Research Super Cluster, and production clusters for pretraining. Fine-tuning, annotation, and evaluation were also performed on third-party cloud compute. **Carbon Footprint** Pretraining utilized a cumulative 3.3M GPU hours of computation on hardware of type A100-80GB (TDP of 350-400W). Estimated total emissions were 539 tCO2eq, 100% of which were offset by Meta’s sustainability program. ||Time (GPU hours)|Power Consumption (W)|Carbon Emitted(tCO₂eq)| |---|---|---|---| |Llama 2 7B|184320|400|31.22| |Llama 2 13B|368640|400|62.44| |Llama 2 70B|1720320|400|291.42| |Total|3311616||539.00| **CO₂ emissions during pretraining.** Time: total GPU time required for training each model. Power Consumption: peak power capacity per GPU device for the GPUs used adjusted for power usage efficiency. 100% of the emissions are directly offset by Meta's sustainability program, and because we are openly releasing these models, the pretraining costs do not need to be incurred by others. ## Training Data **Overview** Llama 2 was pretrained on 2 trillion tokens of data from publicly available sources. The fine-tuning data includes publicly available instruction datasets, as well as over one million new human-annotated examples. Neither the pretraining nor the fine-tuning datasets include Meta user data. **Data Freshness** The pretraining data has a cutoff of September 2022, but some tuning data is more recent, up to July 2023. ## Evaluation Results In this section, we report the results for the Llama 1 and Llama 2 models on standard academic benchmarks.For all the evaluations, we use our internal evaluations library. |Model|Size|Code|Commonsense Reasoning|World Knowledge|Reading Comprehension|Math|MMLU|BBH|AGI Eval| |---|---|---|---|---|---|---|---|---|---| |Llama 1|7B|14.1|60.8|46.2|58.5|6.95|35.1|30.3|23.9| |Llama 1|13B|18.9|66.1|52.6|62.3|10.9|46.9|37.0|33.9| |Llama 1|33B|26.0|70.0|58.4|67.6|21.4|57.8|39.8|41.7| |Llama 1|65B|30.7|70.7|60.5|68.6|30.8|63.4|43.5|47.6| |Llama 2|7B|16.8|63.9|48.9|61.3|14.6|45.3|32.6|29.3| |Llama 2|13B|24.5|66.9|55.4|65.8|28.7|54.8|39.4|39.1| |Llama 2|70B|**37.5**|**71.9**|**63.6**|**69.4**|**35.2**|**68.9**|**51.2**|**54.2**| **Overall performance on grouped academic benchmarks.** *Code:* We report the average pass@1 scores of our models on HumanEval and MBPP. *Commonsense Reasoning:* We report the average of PIQA, SIQA, HellaSwag, WinoGrande, ARC easy and challenge, OpenBookQA, and CommonsenseQA. We report 7-shot results for CommonSenseQA and 0-shot results for all other benchmarks. *World Knowledge:* We evaluate the 5-shot performance on NaturalQuestions and TriviaQA and report the average. *Reading Comprehension:* For reading comprehension, we report the 0-shot average on SQuAD, QuAC, and BoolQ. *MATH:* We report the average of the GSM8K (8 shot) and MATH (4 shot) benchmarks at top 1. |||TruthfulQA|Toxigen| |---|---|---|---| |Llama 1|7B|27.42|23.00| |Llama 1|13B|41.74|23.08| |Llama 1|33B|44.19|22.57| |Llama 1|65B|48.71|21.77| |Llama 2|7B|33.29|**21.25**| |Llama 2|13B|41.86|26.10| |Llama 2|70B|**50.18**|24.60| **Evaluation of pretrained LLMs on automatic safety benchmarks.** For TruthfulQA, we present the percentage of generations that are both truthful and informative (the higher the better). For ToxiGen, we present the percentage of toxic generations (the smaller the better). |||TruthfulQA|Toxigen| |---|---|---|---| |Llama-2-Chat|7B|57.04|**0.00**| |Llama-2-Chat|13B|62.18|**0.00**| |Llama-2-Chat|70B|**64.14**|0.01| **Evaluation of fine-tuned LLMs on different safety datasets.** Same metric definitions as above. ## Ethical Considerations and Limitations Llama 2 is a new technology that carries risks with use. Testing conducted to date has been in English, and has not covered, nor could it cover all scenarios. For these reasons, as with all LLMs, Llama 2’s potential outputs cannot be predicted in advance, and the model may in some instances produce inaccurate, biased or other objectionable responses to user prompts. Therefore, before deploying any applications of Llama 2, developers should perform safety testing and tuning tailored to their specific applications of the model. Please see the Responsible Use Guide available at [https://ai.meta.com/llama/responsible-use-guide/](https://ai.meta.com/llama/responsible-use-guide) ## Reporting Issues Please report any software “bug,” or other problems with the models through one of the following means: - Reporting issues with the model: [github.com/facebookresearch/llama](http://github.com/facebookresearch/llama) - Reporting problematic content generated by the model: [developers.facebook.com/llama_output_feedback](http://developers.facebook.com/llama_output_feedback) - Reporting bugs and security concerns: [facebook.com/whitehat/info](http://facebook.com/whitehat/info) ## Llama Model Index |Model|Llama2|Llama2-hf|Llama2-chat|Llama2-chat-hf| |---|---|---|---|---| |7B| [Link](https://huggingface.co/meta-llama/Llama-2-7b) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-chat-hf)| |13B| [Link](https://huggingface.co/meta-llama/Llama-2-13b) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-chat-hf)| |70B| [Link](https://huggingface.co/meta-llama/Llama-2-70b) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-chat-hf)|

myshell-ai/MeloTTS-English

myshell-ai

transformers

text-to-speech

--- license: mit language: - ko pipeline_tag: text-to-speech --- # MeloTTS MeloTTS is a **high-quality multi-lingual** text-to-speech library by [MyShell.ai](https://myshell.ai). Supported languages include: | Model card | Example | | --- | --- | | [English](https://huggingface.co/myshell-ai/MeloTTS-English-v2) (American) | [Link](https://myshell-public-repo-hosting.s3.amazonaws.com/myshellttsbase/examples/en/EN-US/speed_1.0/sent_000.wav) | | [English](https://huggingface.co/myshell-ai/MeloTTS-English-v2) (British) | [Link](https://myshell-public-repo-hosting.s3.amazonaws.com/myshellttsbase/examples/en/EN-BR/speed_1.0/sent_000.wav) | | [English](https://huggingface.co/myshell-ai/MeloTTS-English-v2) (Indian) | [Link](https://myshell-public-repo-hosting.s3.amazonaws.com/myshellttsbase/examples/en/EN_INDIA/speed_1.0/sent_000.wav) | | [English](https://huggingface.co/myshell-ai/MeloTTS-English-v2) (Australian) | [Link](https://myshell-public-repo-hosting.s3.amazonaws.com/myshellttsbase/examples/en/EN-AU/speed_1.0/sent_000.wav) | | [English](https://huggingface.co/myshell-ai/MeloTTS-English-v2) (Default) | [Link](https://myshell-public-repo-hosting.s3.amazonaws.com/myshellttsbase/examples/en/EN-Default/speed_1.0/sent_000.wav) | | [Spanish](https://huggingface.co/myshell-ai/MeloTTS-Spanish) | [Link](https://myshell-public-repo-hosting.s3.amazonaws.com/myshellttsbase/examples/es/ES/speed_1.0/sent_000.wav) | | [French](https://huggingface.co/myshell-ai/MeloTTS-French) | [Link](https://myshell-public-repo-hosting.s3.amazonaws.com/myshellttsbase/examples/fr/FR/speed_1.0/sent_000.wav) | | [Chinese](https://huggingface.co/myshell-ai/MeloTTS-Chinese) (mix EN) | [Link](https://myshell-public-repo-hosting.s3.amazonaws.com/myshellttsbase/examples/zh/ZH/speed_1.0/sent_008.wav) | | [Japanese](https://huggingface.co/myshell-ai/MeloTTS-Japanese) | [Link](https://myshell-public-repo-hosting.s3.amazonaws.com/myshellttsbase/examples/jp/JP/speed_1.0/sent_000.wav) | | [Korean](https://huggingface.co/myshell-ai/MeloTTS-Korean/) | [Link](https://myshell-public-repo-hosting.s3.amazonaws.com/myshellttsbase/examples/kr/KR/speed_1.0/sent_000.wav) | Some other features include: - The Chinese speaker supports `mixed Chinese and English`. - Fast enough for `CPU real-time inference`. ## Usage ### Without Installation An unofficial [live demo](https://huggingface.co/spaces/mrfakename/MeloTTS) is hosted on Hugging Face Spaces. #### Use it on MyShell There are hundreds of TTS models on MyShell, much more than MeloTTS. See examples [here](https://github.com/myshell-ai/MeloTTS/blob/main/docs/quick_use.md#use-melotts-without-installation). More can be found at the widget center of [MyShell.ai](https://app.myshell.ai/robot-workshop). ### Install and Use Locally Follow the installation steps [here](https://github.com/myshell-ai/MeloTTS/blob/main/docs/install.md#linux-and-macos-install) before using the following snippet: ```python from melo.api import TTS # Speed is adjustable speed = 1.0 # CPU is sufficient for real-time inference. # You can set it manually to 'cpu' or 'cuda' or 'cuda:0' or 'mps' device = 'auto' # Will automatically use GPU if available # English text = "Did you ever hear a folk tale about a giant turtle?" model = TTS(language='EN', device=device) speaker_ids = model.hps.data.spk2id # American accent output_path = 'en-us.wav' model.tts_to_file(text, speaker_ids['EN-US'], output_path, speed=speed) # British accent output_path = 'en-br.wav' model.tts_to_file(text, speaker_ids['EN-BR'], output_path, speed=speed) # Indian accent output_path = 'en-india.wav' model.tts_to_file(text, speaker_ids['EN_INDIA'], output_path, speed=speed) # Australian accent output_path = 'en-au.wav' model.tts_to_file(text, speaker_ids['EN-AU'], output_path, speed=speed) # Default accent output_path = 'en-default.wav' model.tts_to_file(text, speaker_ids['EN-Default'], output_path, speed=speed) ``` ## Join the Community **Open Source AI Grant** We are actively sponsoring open-source AI projects. The sponsorship includes GPU resources, fundings and intellectual support (collaboration with top research labs). We welcome both reseach and engineering projects, as long as the open-source community needs them. Please contact [Zengyi Qin](https://www.qinzy.tech/) if you are interested. **Contributing** If you find this work useful, please consider contributing to the GitHub [repo](https://github.com/myshell-ai/MeloTTS). - Many thanks to [@fakerybakery](https://github.com/fakerybakery) for adding the Web UI and CLI part. ## License This library is under MIT License, which means it is free for both commercial and non-commercial use. ## Acknowledgements This implementation is based on [TTS](https://github.com/coqui-ai/TTS), [VITS](https://github.com/jaywalnut310/vits), [VITS2](https://github.com/daniilrobnikov/vits2) and [Bert-VITS2](https://github.com/fishaudio/Bert-VITS2). We appreciate their awesome work.

llava-hf/llava-1.5-7b-hf

llava-hf

transformers

image-text-to-text

--- language: - en datasets: - liuhaotian/LLaVA-Instruct-150K pipeline_tag: image-text-to-text inference: false arxiv: 2304.08485 license: llama2 tags: - vision - image-text-to-text --- # LLaVA Model Card  Below is the model card of Llava model 7b, which is copied from the original Llava model card that you can find [here](https://huggingface.co/liuhaotian/llava-v1.5-13b). Check out also the Google Colab demo to run Llava on a free-tier Google Colab instance: [](https://colab.research.google.com/drive/1qsl6cd2c8gGtEW1xV5io7S8NHh-Cp1TV?usp=sharing) Or check out our Spaces demo! [](https://huggingface.co/spaces/llava-hf/llava-4bit) ## Model details **Model type:** LLaVA is an open-source chatbot trained by fine-tuning LLaMA/Vicuna on GPT-generated multimodal instruction-following data. It is an auto-regressive language model, based on the transformer architecture. **Model date:** LLaVA-v1.5-7B was trained in September 2023. **Paper or resources for more information:** https://llava-vl.github.io/ ## How to use the model First, make sure to have `transformers >= 4.35.3`. The model supports multi-image and multi-prompt generation. Meaning that you can pass multiple images in your prompt. Make sure also to follow the correct prompt template (`USER: xxx\nASSISTANT:`) and add the token `<image>` to the location where you want to query images: ### Using `pipeline`: Below we used [`"llava-hf/llava-1.5-7b-hf"`](https://huggingface.co/llava-hf/llava-1.5-7b-hf) checkpoint. ```python from transformers import pipeline from PIL import Image import requests model_id = "llava-hf/llava-1.5-7b-hf" pipe = pipeline("image-to-text", model=model_id) url = "https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/tasks/ai2d-demo.jpg" image = Image.open(requests.get(url, stream=True).raw) # Define a chat histiry and use `apply_chat_template` to get correctly formatted prompt # Each value in "content" has to be a list of dicts with types ("text", "image") conversation = [ { "role": "user", "content": [ {"type": "text", "text": "What does the label 15 represent? (1) lava (2) core (3) tunnel (4) ash cloud"}, {"type": "image"}, ], }, ] prompt = processor.apply_chat_template(conversation, add_generation_prompt=True) outputs = pipe(image, prompt=prompt, generate_kwargs={"max_new_tokens": 200}) print(outputs) >>> {"generated_text": "\nUSER: What does the label 15 represent? (1) lava (2) core (3) tunnel (4) ash cloud\nASSISTANT: Lava"} ``` ### Using pure `transformers`: Below is an example script to run generation in `float16` precision on a GPU device: ```python import requests from PIL import Image import torch from transformers import AutoProcessor, LlavaForConditionalGeneration model_id = "llava-hf/llava-1.5-7b-hf" model = LlavaForConditionalGeneration.from_pretrained( model_id, torch_dtype=torch.float16, low_cpu_mem_usage=True, ).to(0) processor = AutoProcessor.from_pretrained(model_id) # Define a chat histiry and use `apply_chat_template` to get correctly formatted prompt # Each value in "content" has to be a list of dicts with types ("text", "image") conversation = [ { "role": "user", "content": [ {"type": "text", "text": "What are these?"}, {"type": "image"}, ], }, ] prompt = processor.apply_chat_template(conversation, add_generation_prompt=True) image_file = "http://images.cocodataset.org/val2017/000000039769.jpg" raw_image = Image.open(requests.get(image_file, stream=True).raw) inputs = processor(images=raw_image, text=prompt, return_tensors='pt').to(0, torch.float16) output = model.generate(**inputs, max_new_tokens=200, do_sample=False) print(processor.decode(output[0][2:], skip_special_tokens=True)) ``` ### Model optimization #### 4-bit quantization through `bitsandbytes` library First make sure to install `bitsandbytes`, `pip install bitsandbytes` and make sure to have access to a CUDA compatible GPU device. Simply change the snippet above with: ```diff model = LlavaForConditionalGeneration.from_pretrained( model_id, torch_dtype=torch.float16, low_cpu_mem_usage=True, + load_in_4bit=True ) ``` #### Use Flash-Attention 2 to further speed-up generation First make sure to install `flash-attn`. Refer to the [original repository of Flash Attention](https://github.com/Dao-AILab/flash-attention) regarding that package installation. Simply change the snippet above with: ```diff model = LlavaForConditionalGeneration.from_pretrained( model_id, torch_dtype=torch.float16, low_cpu_mem_usage=True, + use_flash_attention_2=True ).to(0) ``` ## License Llama 2 is licensed under the LLAMA 2 Community License, Copyright (c) Meta Platforms, Inc. All Rights Reserved.

albert/albert-base-v2

albert

transformers

fill-mask

--- language: en license: apache-2.0 datasets: - bookcorpus - wikipedia --- # ALBERT Base v2 Pretrained model on English language using a masked language modeling (MLM) objective. It was introduced in [this paper](https://arxiv.org/abs/1909.11942) and first released in [this repository](https://github.com/google-research/albert). This model, as all ALBERT models, is uncased: it does not make a difference between english and English. Disclaimer: The team releasing ALBERT did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description ALBERT is a transformers model pretrained on a large corpus of English data in a self-supervised fashion. This means it was pretrained on the raw texts only, with no humans labelling them in any way (which is why it can use lots of publicly available data) with an automatic process to generate inputs and labels from those texts. More precisely, it was pretrained with two objectives: - Masked language modeling (MLM): taking a sentence, the model randomly masks 15% of the words in the input then run the entire masked sentence through the model and has to predict the masked words. This is different from traditional recurrent neural networks (RNNs) that usually see the words one after the other, or from autoregressive models like GPT which internally mask the future tokens. It allows the model to learn a bidirectional representation of the sentence. - Sentence Ordering Prediction (SOP): ALBERT uses a pretraining loss based on predicting the ordering of two consecutive segments of text. This way, the model learns an inner representation of the English language that can then be used to extract features useful for downstream tasks: if you have a dataset of labeled sentences for instance, you can train a standard classifier using the features produced by the ALBERT model as inputs. ALBERT is particular in that it shares its layers across its Transformer. Therefore, all layers have the same weights. Using repeating layers results in a small memory footprint, however, the computational cost remains similar to a BERT-like architecture with the same number of hidden layers as it has to iterate through the same number of (repeating) layers. This is the second version of the base model. Version 2 is different from version 1 due to different dropout rates, additional training data, and longer training. It has better results in nearly all downstream tasks. This model has the following configuration: - 12 repeating layers - 128 embedding dimension - 768 hidden dimension - 12 attention heads - 11M parameters ## Intended uses & limitations You can use the raw model for either masked language modeling or next sentence prediction, but it's mostly intended to be fine-tuned on a downstream task. See the [model hub](https://huggingface.co/models?filter=albert) to look for fine-tuned versions on a task that interests you. Note that this model is primarily aimed at being fine-tuned on tasks that use the whole sentence (potentially masked) to make decisions, such as sequence classification, token classification or question answering. For tasks such as text generation you should look at model like GPT2. ### How to use You can use this model directly with a pipeline for masked language modeling: ```python >>> from transformers import pipeline >>> unmasker = pipeline('fill-mask', model='albert-base-v2') >>> unmasker("Hello I'm a [MASK] model.") [ { "sequence":"[CLS] hello i'm a modeling model.[SEP]", "score":0.05816134437918663, "token":12807, "token_str":"▁modeling" }, { "sequence":"[CLS] hello i'm a modelling model.[SEP]", "score":0.03748830780386925, "token":23089, "token_str":"▁modelling" }, { "sequence":"[CLS] hello i'm a model model.[SEP]", "score":0.033725276589393616, "token":1061, "token_str":"▁model" }, { "sequence":"[CLS] hello i'm a runway model.[SEP]", "score":0.017313428223133087, "token":8014, "token_str":"▁runway" }, { "sequence":"[CLS] hello i'm a lingerie model.[SEP]", "score":0.014405295252799988, "token":29104, "token_str":"▁lingerie" } ] ``` Here is how to use this model to get the features of a given text in PyTorch: ```python from transformers import AlbertTokenizer, AlbertModel tokenizer = AlbertTokenizer.from_pretrained('albert-base-v2') model = AlbertModel.from_pretrained("albert-base-v2") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='pt') output = model(**encoded_input) ``` and in TensorFlow: ```python from transformers import AlbertTokenizer, TFAlbertModel tokenizer = AlbertTokenizer.from_pretrained('albert-base-v2') model = TFAlbertModel.from_pretrained("albert-base-v2") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='tf') output = model(encoded_input) ``` ### Limitations and bias Even if the training data used for this model could be characterized as fairly neutral, this model can have biased predictions: ```python >>> from transformers import pipeline >>> unmasker = pipeline('fill-mask', model='albert-base-v2') >>> unmasker("The man worked as a [MASK].") [ { "sequence":"[CLS] the man worked as a chauffeur.[SEP]", "score":0.029577180743217468, "token":28744, "token_str":"▁chauffeur" }, { "sequence":"[CLS] the man worked as a janitor.[SEP]", "score":0.028865724802017212, "token":29477, "token_str":"▁janitor" }, { "sequence":"[CLS] the man worked as a shoemaker.[SEP]", "score":0.02581118606030941, "token":29024, "token_str":"▁shoemaker" }, { "sequence":"[CLS] the man worked as a blacksmith.[SEP]", "score":0.01849772222340107, "token":21238, "token_str":"▁blacksmith" }, { "sequence":"[CLS] the man worked as a lawyer.[SEP]", "score":0.01820771023631096, "token":3672, "token_str":"▁lawyer" } ] >>> unmasker("The woman worked as a [MASK].") [ { "sequence":"[CLS] the woman worked as a receptionist.[SEP]", "score":0.04604868218302727, "token":25331, "token_str":"▁receptionist" }, { "sequence":"[CLS] the woman worked as a janitor.[SEP]", "score":0.028220869600772858, "token":29477, "token_str":"▁janitor" }, { "sequence":"[CLS] the woman worked as a paramedic.[SEP]", "score":0.0261906236410141, "token":23386, "token_str":"▁paramedic" }, { "sequence":"[CLS] the woman worked as a chauffeur.[SEP]", "score":0.024797942489385605, "token":28744, "token_str":"▁chauffeur" }, { "sequence":"[CLS] the woman worked as a waitress.[SEP]", "score":0.024124596267938614, "token":13678, "token_str":"▁waitress" } ] ``` This bias will also affect all fine-tuned versions of this model. ## Training data The ALBERT model was pretrained on [BookCorpus](https://yknzhu.wixsite.com/mbweb), a dataset consisting of 11,038 unpublished books and [English Wikipedia](https://en.wikipedia.org/wiki/English_Wikipedia) (excluding lists, tables and headers). ## Training procedure ### Preprocessing The texts are lowercased and tokenized using SentencePiece and a vocabulary size of 30,000. The inputs of the model are then of the form: ``` [CLS] Sentence A [SEP] Sentence B [SEP] ``` ### Training The ALBERT procedure follows the BERT setup. The details of the masking procedure for each sentence are the following: - 15% of the tokens are masked. - In 80% of the cases, the masked tokens are replaced by `[MASK]`. - In 10% of the cases, the masked tokens are replaced by a random token (different) from the one they replace. - In the 10% remaining cases, the masked tokens are left as is. ## Evaluation results When fine-tuned on downstream tasks, the ALBERT models achieve the following results: | | Average | SQuAD1.1 | SQuAD2.0 | MNLI | SST-2 | RACE | |----------------|----------|----------|----------|----------|----------|----------| |V2 | |ALBERT-base |82.3 |90.2/83.2 |82.1/79.3 |84.6 |92.9 |66.8 | |ALBERT-large |85.7 |91.8/85.2 |84.9/81.8 |86.5 |94.9 |75.2 | |ALBERT-xlarge |87.9 |92.9/86.4 |87.9/84.1 |87.9 |95.4 |80.7 | |ALBERT-xxlarge |90.9 |94.6/89.1 |89.8/86.9 |90.6 |96.8 |86.8 | |V1 | |ALBERT-base |80.1 |89.3/82.3 | 80.0/77.1|81.6 |90.3 | 64.0 | |ALBERT-large |82.4 |90.6/83.9 | 82.3/79.4|83.5 |91.7 | 68.5 | |ALBERT-xlarge |85.5 |92.5/86.1 | 86.1/83.1|86.4 |92.4 | 74.8 | |ALBERT-xxlarge |91.0 |94.8/89.3 | 90.2/87.4|90.8 |96.9 | 86.5 | ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-1909-11942, author = {Zhenzhong Lan and Mingda Chen and Sebastian Goodman and Kevin Gimpel and Piyush Sharma and Radu Soricut}, title = {{ALBERT:} {A} Lite {BERT} for Self-supervised Learning of Language Representations}, journal = {CoRR}, volume = {abs/1909.11942}, year = {2019}, url = {http://arxiv.org/abs/1909.11942}, archivePrefix = {arXiv}, eprint = {1909.11942}, timestamp = {Fri, 27 Sep 2019 13:04:21 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1909-11942.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

pyannote/speaker-diarization-3.0

pyannote

pyannote-audio

automatic-speech-recognition

--- tags: - pyannote - pyannote-audio - pyannote-audio-pipeline - audio - voice - speech - speaker - speaker-diarization - speaker-change-detection - voice-activity-detection - overlapped-speech-detection - automatic-speech-recognition license: mit extra_gated_prompt: "The collected information will help acquire a better knowledge of pyannote.audio userbase and help its maintainers improve it further. Though this pipeline uses MIT license and will always remain open-source, we will occasionnally email you about premium pipelines and paid services around pyannote." extra_gated_fields: Company/university: text Website: text --- Using this open-source model in production? Consider switching to [pyannoteAI](https://www.pyannote.ai) for better and faster options. # 🎹 Speaker diarization 3.0 This pipeline has been trained by Séverin Baroudi with [pyannote.audio](https://github.com/pyannote/pyannote-audio) `3.0.0` using a combination of the training sets of AISHELL, AliMeeting, AMI, AVA-AVD, DIHARD, Ego4D, MSDWild, REPERE, and VoxConverse. It ingests mono audio sampled at 16kHz and outputs speaker diarization as an [`Annotation`](http://pyannote.github.io/pyannote-core/structure.html#annotation) instance: * stereo or multi-channel audio files are automatically downmixed to mono by averaging the channels. * audio files sampled at a different rate are resampled to 16kHz automatically upon loading. ## Requirements 1. Install [`pyannote.audio`](https://github.com/pyannote/pyannote-audio) `3.0` with `pip install pyannote.audio` 2. Accept [`pyannote/segmentation-3.0`](https://hf.co/pyannote/segmentation-3.0) user conditions 3. Accept [`pyannote/speaker-diarization-3.0`](https://hf.co/pyannote-speaker-diarization-3.0) user conditions 4. Create access token at [`hf.co/settings/tokens`](https://hf.co/settings/tokens). ## Usage ```python # instantiate the pipeline from pyannote.audio import Pipeline pipeline = Pipeline.from_pretrained( "pyannote/speaker-diarization-3.0", use_auth_token="HUGGINGFACE_ACCESS_TOKEN_GOES_HERE") # run the pipeline on an audio file diarization = pipeline("audio.wav") # dump the diarization output to disk using RTTM format with open("audio.rttm", "w") as rttm: diarization.write_rttm(rttm) ``` ### Processing on GPU `pyannote.audio` pipelines run on CPU by default. You can send them to GPU with the following lines: ```python import torch pipeline.to(torch.device("cuda")) ``` Real-time factor is around 2.5% using one Nvidia Tesla V100 SXM2 GPU (for the neural inference part) and one Intel Cascade Lake 6248 CPU (for the clustering part). In other words, it takes approximately 1.5 minutes to process a one hour conversation. ### Processing from memory Pre-loading audio files in memory may result in faster processing: ```python waveform, sample_rate = torchaudio.load("audio.wav") diarization = pipeline({"waveform": waveform, "sample_rate": sample_rate}) ``` ### Monitoring progress Hooks are available to monitor the progress of the pipeline: ```python from pyannote.audio.pipelines.utils.hook import ProgressHook with ProgressHook() as hook: diarization = pipeline("audio.wav", hook=hook) ``` ### Controlling the number of speakers In case the number of speakers is known in advance, one can use the `num_speakers` option: ```python diarization = pipeline("audio.wav", num_speakers=2) ``` One can also provide lower and/or upper bounds on the number of speakers using `min_speakers` and `max_speakers` options: ```python diarization = pipeline("audio.wav", min_speakers=2, max_speakers=5) ``` ## Benchmark This pipeline has been benchmarked on a large collection of datasets. Processing is fully automatic: * no manual voice activity detection (as is sometimes the case in the literature) * no manual number of speakers (though it is possible to provide it to the pipeline) * no fine-tuning of the internal models nor tuning of the pipeline hyper-parameters to each dataset ... with the least forgiving diarization error rate (DER) setup (named *"Full"* in [this paper](https://doi.org/10.1016/j.csl.2021.101254)): * no forgiveness collar * evaluation of overlapped speech | Benchmark | [DER%](. "Diarization error rate") | [FA%](. "False alarm rate") | [Miss%](. "Missed detection rate") | [Conf%](. "Speaker confusion rate") | Expected output | File-level evaluation | | ------------------------------------------------------------------------------------------------------------------------------------------- | ---------------------------------- | --------------------------- | ---------------------------------- | ----------------------------------- | ----------------------------------------------------------------------------------------------------------------------------- | ----------------------------------------------------------------------------------------------------------------------------- | | [AISHELL-4](http://www.openslr.org/111/) | 12.3 | 3.8 | 4.4 | 4.1 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AISHELL.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AISHELL.SpeakerDiarization.Benchmark.test.eval) | | [AliMeeting (*channel 1*)](https://www.openslr.org/119/) | 24.3 | 4.4 | 10.0 | 9.9 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AliMeeting.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AliMeeting.SpeakerDiarization.Benchmark.test.eval) | | [AMI (*headset mix,*](https://groups.inf.ed.ac.uk/ami/corpus/) [*only_words*)](https://github.com/BUTSpeechFIT/AMI-diarization-setup) | 19.0 | 3.6 | 9.5 | 5.9 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AMI.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AMI.SpeakerDiarization.Benchmark.test.eval) | | [AMI (*array1, channel 1,*](https://groups.inf.ed.ac.uk/ami/corpus/) [*only_words)*](https://github.com/BUTSpeechFIT/AMI-diarization-setup) | 22.2 | 3.8 | 11.2 | 7.3 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AMI-SDM.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AMI-SDM.SpeakerDiarization.Benchmark.test.eval) | | [AVA-AVD](https://arxiv.org/abs/2111.14448) | 49.1 | 10.8 | 15.7| 22.5 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AVA-AVD.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AVA-AVD.SpeakerDiarization.Benchmark.test.eval) | | [DIHARD 3 (*Full*)](https://arxiv.org/abs/2012.01477) | 21.7 | 6.2 | 8.1 | 7.3 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/DIHARD.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/DIHARD.SpeakerDiarization.Benchmark.test.eval) | | [MSDWild](https://x-lance.github.io/MSDWILD/) | 24.6 | 5.8 | 8.0 | 10.7 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/MSDWILD.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/MSDWILD.SpeakerDiarization.Benchmark.test.eval) | | [REPERE (*phase 2*)](https://islrn.org/resources/360-758-359-485-0/) | 7.8 | 1.8 | 2.6 | 3.5 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/REPERE.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/REPERE.SpeakerDiarization.Benchmark.test.eval) | | [VoxConverse (*v0.3*)](https://github.com/joonson/voxconverse) | 11.3 | 4.1 | 3.4 | 3.8 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/VoxConverse.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/VoxConverse.SpeakerDiarization.Benchmark.test.eval) | ## Citations ```bibtex @inproceedings{Plaquet23, author={Alexis Plaquet and Hervé Bredin}, title={{Powerset multi-class cross entropy loss for neural speaker diarization}}, year=2023, booktitle={Proc. INTERSPEECH 2023}, } ``` ```bibtex @inproceedings{Bredin23, author={Hervé Bredin}, title={{pyannote.audio 2.1 speaker diarization pipeline: principle, benchmark, and recipe}}, year=2023, booktitle={Proc. INTERSPEECH 2023}, } ```

CompVis/stable-diffusion-safety-checker

CompVis

transformers

--- tags: - clip --- # Model Card for stable-diffusion-safety-checker # Model Details ## Model Description More information needed - **Developed by:** More information needed - **Shared by [Optional]:** CompVis - **Model type:** Image Identification - **Language(s) (NLP):** More information needed - **License:** More information needed - **Parent Model:** [CLIP](https://huggingface.co/openai/clip-vit-large-patch14) - **Resources for more information:** - [CLIP Paper](https://arxiv.org/abs/2103.00020) - [Stable Diffusion Model Card](https://github.com/CompVis/stable-diffusion/blob/main/Stable_Diffusion_v1_Model_Card.md) # Uses ## Direct Use This model can be used for identifying NSFW image The CLIP model devlopers note in their [model card](https://huggingface.co/openai/clip-vit-large-patch14) : >The primary intended users of these models are AI researchers. We primarily imagine the model will be used by researchers to better understand robustness, generalization, and other capabilities, biases, and constraints of computer vision models. ## Downstream Use [Optional] More information needed. ## Out-of-Scope Use The model is not intended to be used with transformers but with diffusers. This model should also not be used to intentionally create hostile or alienating environments for people. # Bias, Risks, and Limitations Significant research has explored bias and fairness issues with language models (see, e.g., [Sheng et al. (2021)](https://aclanthology.org/2021.acl-long.330.pdf) and [Bender et al. (2021)](https://dl.acm.org/doi/pdf/10.1145/3442188.3445922)). Predictions generated by the model may include disturbing and harmful stereotypes across protected classes; identity characteristics; and sensitive, social, and occupational groups. The CLIP model devlopers note in their [model card](https://huggingface.co/openai/clip-vit-large-patch14) : > We find that the performance of CLIP - and the specific biases it exhibits - can depend significantly on class design and the choices one makes for categories to include and exclude. We tested the risk of certain kinds of denigration with CLIP by classifying images of people from Fairface into crime-related and non-human animal categories. We found significant disparities with respect to race and gender. Additionally, we found that these disparities could shift based on how the classes were constructed. > We also tested the performance of CLIP on gender, race and age classification using the Fairface dataset (We default to using race categories as they are constructed in the Fairface dataset.) in order to assess quality of performance across different demographics. We found accuracy >96% across all races for gender classification with ‘Middle Eastern’ having the highest accuracy (98.4%) and ‘White’ having the lowest (96.5%). Additionally, CLIP averaged ~93% for racial classification and ~63% for age classification ## Recommendations Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations. # Training Details ## Training Data More information needed ## Training Procedure ### Preprocessing More information needed ### Speeds, Sizes, Times More information needed # Evaluation ## Testing Data, Factors & Metrics ### Testing Data More information needed ### Factors More information needed ### Metrics More information needed ## Results More information needed # Model Examination More information needed # Environmental Impact Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). - **Hardware Type:** More information needed - **Hours used:** More information needed - **Cloud Provider:** More information needed - **Compute Region:** More information needed - **Carbon Emitted:** More information needed # Technical Specifications [optional] ## Model Architecture and Objective The CLIP model devlopers note in their [model card](https://huggingface.co/openai/clip-vit-large-patch14) : > The base model uses a ViT-L/14 Transformer architecture as an image encoder and uses a masked self-attention Transformer as a text encoder. These encoders are trained to maximize the similarity of (image, text) pairs via a contrastive loss. ## Compute Infrastructure More information needed ### Hardware More information needed ### Software More information needed. # Citation **BibTeX:** More information needed **APA:** More information needed # Glossary [optional] More information needed # More Information [optional] More information needed # Model Card Authors [optional] CompVis in collaboration with Ezi Ozoani and the Hugging Face team # Model Card Contact More information needed # How to Get Started with the Model Use the code below to get started with the model. <details> <summary> Click to expand </summary> ```python from transformers import AutoProcessor, SafetyChecker processor = AutoProcessor.from_pretrained("CompVis/stable-diffusion-safety-checker") safety_checker = SafetyChecker.from_pretrained("CompVis/stable-diffusion-safety-checker") ``` </details>

stabilityai/sdxl-turbo

stabilityai

diffusers

text-to-image

--- pipeline_tag: text-to-image inference: false license: other license_name: sai-nc-community license_link: https://huggingface.co/stabilityai/sdxl-turbo/blob/main/LICENSE.md --- # SDXL-Turbo Model Card <!-- Provide a quick summary of what the model is/does. -->  SDXL-Turbo is a fast generative text-to-image model that can synthesize photorealistic images from a text prompt in a single network evaluation. A real-time demo is available here: http://clipdrop.co/stable-diffusion-turbo Please note: For commercial use, please refer to https://stability.ai/license. ## Model Details ### Model Description SDXL-Turbo is a distilled version of [SDXL 1.0](https://huggingface.co/stabilityai/stable-diffusion-xl-base-1.0), trained for real-time synthesis. SDXL-Turbo is based on a novel training method called Adversarial Diffusion Distillation (ADD) (see the [technical report](https://stability.ai/research/adversarial-diffusion-distillation)), which allows sampling large-scale foundational image diffusion models in 1 to 4 steps at high image quality. This approach uses score distillation to leverage large-scale off-the-shelf image diffusion models as a teacher signal and combines this with an adversarial loss to ensure high image fidelity even in the low-step regime of one or two sampling steps. - **Developed by:** Stability AI - **Funded by:** Stability AI - **Model type:** Generative text-to-image model - **Finetuned from model:** [SDXL 1.0 Base](https://huggingface.co/stabilityai/stable-diffusion-xl-base-1.0) ### Model Sources For research purposes, we recommend our `generative-models` Github repository (https://github.com/Stability-AI/generative-models), which implements the most popular diffusion frameworks (both training and inference). - **Repository:** https://github.com/Stability-AI/generative-models - **Paper:** https://stability.ai/research/adversarial-diffusion-distillation - **Demo:** http://clipdrop.co/stable-diffusion-turbo ## Evaluation   The charts above evaluate user preference for SDXL-Turbo over other single- and multi-step models. SDXL-Turbo evaluated at a single step is preferred by human voters in terms of image quality and prompt following over LCM-XL evaluated at four (or fewer) steps. In addition, we see that using four steps for SDXL-Turbo further improves performance. For details on the user study, we refer to the [research paper](https://stability.ai/research/adversarial-diffusion-distillation). ## Uses ### Direct Use The model is intended for both non-commercial and commercial usage. You can use this model for non-commercial or research purposes under this [license](https://huggingface.co/stabilityai/sdxl-turbo/blob/main/LICENSE.md). Possible research areas and tasks include - Research on generative models. - Research on real-time applications of generative models. - Research on the impact of real-time generative models. - Safe deployment of models which have the potential to generate harmful content. - Probing and understanding the limitations and biases of generative models. - Generation of artworks and use in design and other artistic processes. - Applications in educational or creative tools. For commercial use, please refer to https://stability.ai/membership. Excluded uses are described below. ### Diffusers ``` pip install diffusers transformers accelerate --upgrade ``` - **Text-to-image**: SDXL-Turbo does not make use of `guidance_scale` or `negative_prompt`, we disable it with `guidance_scale=0.0`. Preferably, the model generates images of size 512x512 but higher image sizes work as well. A **single step** is enough to generate high quality images. ```py from diffusers import AutoPipelineForText2Image import torch pipe = AutoPipelineForText2Image.from_pretrained("stabilityai/sdxl-turbo", torch_dtype=torch.float16, variant="fp16") pipe.to("cuda") prompt = "A cinematic shot of a baby racoon wearing an intricate italian priest robe." image = pipe(prompt=prompt, num_inference_steps=1, guidance_scale=0.0).images[0] ``` - **Image-to-image**: When using SDXL-Turbo for image-to-image generation, make sure that `num_inference_steps` * `strength` is larger or equal to 1. The image-to-image pipeline will run for `int(num_inference_steps * strength)` steps, *e.g.* 0.5 * 2.0 = 1 step in our example below. ```py from diffusers import AutoPipelineForImage2Image from diffusers.utils import load_image import torch pipe = AutoPipelineForImage2Image.from_pretrained("stabilityai/sdxl-turbo", torch_dtype=torch.float16, variant="fp16") pipe.to("cuda") init_image = load_image("https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/diffusers/cat.png").resize((512, 512)) prompt = "cat wizard, gandalf, lord of the rings, detailed, fantasy, cute, adorable, Pixar, Disney, 8k" image = pipe(prompt, image=init_image, num_inference_steps=2, strength=0.5, guidance_scale=0.0).images[0] ``` ### Out-of-Scope Use The model was not trained to be factual or true representations of people or events, and therefore using the model to generate such content is out-of-scope for the abilities of this model. The model should not be used in any way that violates Stability AI's [Acceptable Use Policy](https://stability.ai/use-policy). ## Limitations and Bias ### Limitations - The generated images are of a fixed resolution (512x512 pix), and the model does not achieve perfect photorealism. - The model cannot render legible text. - Faces and people in general may not be generated properly. - The autoencoding part of the model is lossy. ### Recommendations The model is intended for both non-commercial and commercial usage. ## How to Get Started with the Model Check out https://github.com/Stability-AI/generative-models

microsoft/layoutlmv2-base-uncased

microsoft

transformers

--- language: en license: cc-by-nc-sa-4.0 --- # LayoutLMv2 **Multimodal (text + layout/format + image) pre-training for document AI** The documentation of this model in the Transformers library can be found [here](https://huggingface.co/docs/transformers/model_doc/layoutlmv2). [Microsoft Document AI](https://www.microsoft.com/en-us/research/project/document-ai/) | [GitHub](https://github.com/microsoft/unilm/tree/master/layoutlmv2) ## Introduction LayoutLMv2 is an improved version of LayoutLM with new pre-training tasks to model the interaction among text, layout, and image in a single multi-modal framework. It outperforms strong baselines and achieves new state-of-the-art results on a wide variety of downstream visually-rich document understanding tasks, including , including FUNSD (0.7895 → 0.8420), CORD (0.9493 → 0.9601), SROIE (0.9524 → 0.9781), Kleister-NDA (0.834 → 0.852), RVL-CDIP (0.9443 → 0.9564), and DocVQA (0.7295 → 0.8672). [LayoutLMv2: Multi-modal Pre-training for Visually-Rich Document Understanding](https://arxiv.org/abs/2012.14740) Yang Xu, Yiheng Xu, Tengchao Lv, Lei Cui, Furu Wei, Guoxin Wang, Yijuan Lu, Dinei Florencio, Cha Zhang, Wanxiang Che, Min Zhang, Lidong Zhou, ACL 2021

microsoft/beit-base-patch16-224-pt22k-ft22k

microsoft

transformers

image-classification

--- license: apache-2.0 tags: - image-classification - vision datasets: - imagenet - imagenet-21k --- # BEiT (base-sized model, fine-tuned on ImageNet-22k) BEiT model pre-trained in a self-supervised fashion on ImageNet-22k - also called ImageNet-21k (14 million images, 21,841 classes) at resolution 224x224, and fine-tuned on the same dataset at resolution 224x224. It was introduced in the paper [BEIT: BERT Pre-Training of Image Transformers](https://arxiv.org/abs/2106.08254) by Hangbo Bao, Li Dong and Furu Wei and first released in [this repository](https://github.com/microsoft/unilm/tree/master/beit). Disclaimer: The team releasing BEiT did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description The BEiT model is a Vision Transformer (ViT), which is a transformer encoder model (BERT-like). In contrast to the original ViT model, BEiT is pretrained on a large collection of images in a self-supervised fashion, namely ImageNet-21k, at a resolution of 224x224 pixels. The pre-training objective for the model is to predict visual tokens from the encoder of OpenAI's DALL-E's VQ-VAE, based on masked patches. Next, the model was fine-tuned in a supervised fashion on ImageNet (also referred to as ILSVRC2012), a dataset comprising 1 million images and 1,000 classes, also at resolution 224x224. Images are presented to the model as a sequence of fixed-size patches (resolution 16x16), which are linearly embedded. Contrary to the original ViT models, BEiT models do use relative position embeddings (similar to T5) instead of absolute position embeddings, and perform classification of images by mean-pooling the final hidden states of the patches, instead of placing a linear layer on top of the final hidden state of the [CLS] token. By pre-training the model, it learns an inner representation of images that can then be used to extract features useful for downstream tasks: if you have a dataset of labeled images for instance, you can train a standard classifier by placing a linear layer on top of the pre-trained encoder. One typically places a linear layer on top of the [CLS] token, as the last hidden state of this token can be seen as a representation of an entire image. Alternatively, one can mean-pool the final hidden states of the patch embeddings, and place a linear layer on top of that. ## Intended uses & limitations You can use the raw model for image classification. See the [model hub](https://huggingface.co/models?search=microsoft/beit) to look for fine-tuned versions on a task that interests you. ### How to use Here is how to use this model to classify an image of the COCO 2017 dataset into one of the 1,000 ImageNet classes: ```python from transformers import BeitImageProcessor, BeitForImageClassification from PIL import Image import requests url = 'http://images.cocodataset.org/val2017/000000039769.jpg' image = Image.open(requests.get(url, stream=True).raw) processor = BeitImageProcessor.from_pretrained('microsoft/beit-base-patch16-224-pt22k-ft22k') model = BeitForImageClassification.from_pretrained('microsoft/beit-base-patch16-224-pt22k-ft22k') inputs = processor(images=image, return_tensors="pt") outputs = model(**inputs) logits = outputs.logits # model predicts one of the 21,841 ImageNet-22k classes predicted_class_idx = logits.argmax(-1).item() print("Predicted class:", model.config.id2label[predicted_class_idx]) ``` Currently, both the feature extractor and model support PyTorch. ## Training data The BEiT model was pretrained on [ImageNet-21k](http://www.image-net.org/), a dataset consisting of 14 million images and 21k classes, and fine-tuned on the same dataset. ## Training procedure ### Preprocessing The exact details of preprocessing of images during training/validation can be found [here](https://github.com/microsoft/unilm/blob/master/beit/datasets.py). Images are resized/rescaled to the same resolution (224x224) and normalized across the RGB channels with mean (0.5, 0.5, 0.5) and standard deviation (0.5, 0.5, 0.5). ### Pretraining For all pre-training related hyperparameters, we refer to page 15 of the [original paper](https://arxiv.org/abs/2106.08254). ## Evaluation results For evaluation results on several image classification benchmarks, we refer to tables 1 and 2 of the original paper. Note that for fine-tuning, the best results are obtained with a higher resolution. Of course, increasing the model size will result in better performance. ### BibTeX entry and citation info ```@article{DBLP:journals/corr/abs-2106-08254, author = {Hangbo Bao and Li Dong and Furu Wei}, title = {BEiT: {BERT} Pre-Training of Image Transformers}, journal = {CoRR}, volume = {abs/2106.08254}, year = {2021}, url = {https://arxiv.org/abs/2106.08254}, archivePrefix = {arXiv}, eprint = {2106.08254}, timestamp = {Tue, 29 Jun 2021 16:55:04 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2106-08254.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ``` ```bibtex @inproceedings{deng2009imagenet, title={Imagenet: A large-scale hierarchical image database}, author={Deng, Jia and Dong, Wei and Socher, Richard and Li, Li-Jia and Li, Kai and Fei-Fei, Li}, booktitle={2009 IEEE conference on computer vision and pattern recognition}, pages={248--255}, year={2009}, organization={Ieee} } ```

meta-llama/Meta-Llama-3-8B-Instruct

meta-llama

transformers

text-generation

--- language: - en pipeline_tag: text-generation tags: - facebook - meta - pytorch - llama - llama-3 license: llama3 extra_gated_prompt: >- ### META LLAMA 3 COMMUNITY LICENSE AGREEMENT Meta Llama 3 Version Release Date: April 18, 2024 "Agreement" means the terms and conditions for use, reproduction, distribution and modification of the Llama Materials set forth herein. "Documentation" means the specifications, manuals and documentation accompanying Meta Llama 3 distributed by Meta at https://llama.meta.com/get-started/. "Licensee" or "you" means you, or your employer or any other person or entity (if you are entering into this Agreement on such person or entity’s behalf), of the age required under applicable laws, rules or regulations to provide legal consent and that has legal authority to bind your employer or such other person or entity if you are entering in this Agreement on their behalf. "Meta Llama 3" means the foundational large language models and software and algorithms, including machine-learning model code, trained model weights, inference-enabling code, training-enabling code, fine-tuning enabling code and other elements of the foregoing distributed by Meta at https://llama.meta.com/llama-downloads. "Llama Materials" means, collectively, Meta’s proprietary Meta Llama 3 and Documentation (and any portion thereof) made available under this Agreement. "Meta" or "we" means Meta Platforms Ireland Limited (if you are located in or, if you are an entity, your principal place of business is in the EEA or Switzerland) and Meta Platforms, Inc. (if you are located outside of the EEA or Switzerland). 1. License Rights and Redistribution. a. Grant of Rights. You are granted a non-exclusive, worldwide, non-transferable and royalty-free limited license under Meta’s intellectual property or other rights owned by Meta embodied in the Llama Materials to use, reproduce, distribute, copy, create derivative works of, and make modifications to the Llama Materials. b. Redistribution and Use. i. If you distribute or make available the Llama Materials (or any derivative works thereof), or a product or service that uses any of them, including another AI model, you shall (A) provide a copy of this Agreement with any such Llama Materials; and (B) prominently display “Built with Meta Llama 3” on a related website, user interface, blogpost, about page, or product documentation. If you use the Llama Materials to create, train, fine tune, or otherwise improve an AI model, which is distributed or made available, you shall also include “Llama 3” at the beginning of any such AI model name. ii. If you receive Llama Materials, or any derivative works thereof, from a Licensee as part of an integrated end user product, then Section 2 of this Agreement will not apply to you. iii. You must retain in all copies of the Llama Materials that you distribute the following attribution notice within a “Notice” text file distributed as a part of such copies: “Meta Llama 3 is licensed under the Meta Llama 3 Community License, Copyright © Meta Platforms, Inc. All Rights Reserved.” iv. Your use of the Llama Materials must comply with applicable laws and regulations (including trade compliance laws and regulations) and adhere to the Acceptable Use Policy for the Llama Materials (available at https://llama.meta.com/llama3/use-policy), which is hereby incorporated by reference into this Agreement. v. You will not use the Llama Materials or any output or results of the Llama Materials to improve any other large language model (excluding Meta Llama 3 or derivative works thereof). 2. Additional Commercial Terms. If, on the Meta Llama 3 version release date, the monthly active users of the products or services made available by or for Licensee, or Licensee’s affiliates, is greater than 700 million monthly active users in the preceding calendar month, you must request a license from Meta, which Meta may grant to you in its sole discretion, and you are not authorized to exercise any of the rights under this Agreement unless or until Meta otherwise expressly grants you such rights. 3. Disclaimer of Warranty. UNLESS REQUIRED BY APPLICABLE LAW, THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS THEREFROM ARE PROVIDED ON AN “AS IS” BASIS, WITHOUT WARRANTIES OF ANY KIND, AND META DISCLAIMS ALL WARRANTIES OF ANY KIND, BOTH EXPRESS AND IMPLIED, INCLUDING, WITHOUT LIMITATION, ANY WARRANTIES OF TITLE, NON-INFRINGEMENT, MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE. YOU ARE SOLELY RESPONSIBLE FOR DETERMINING THE APPROPRIATENESS OF USING OR REDISTRIBUTING THE LLAMA MATERIALS AND ASSUME ANY RISKS ASSOCIATED WITH YOUR USE OF THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS. 4. Limitation of Liability. IN NO EVENT WILL META OR ITS AFFILIATES BE LIABLE UNDER ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, TORT, NEGLIGENCE, PRODUCTS LIABILITY, OR OTHERWISE, ARISING OUT OF THIS AGREEMENT, FOR ANY LOST PROFITS OR ANY INDIRECT, SPECIAL, CONSEQUENTIAL, INCIDENTAL, EXEMPLARY OR PUNITIVE DAMAGES, EVEN IF META OR ITS AFFILIATES HAVE BEEN ADVISED OF THE POSSIBILITY OF ANY OF THE FOREGOING. 5. Intellectual Property. a. No trademark licenses are granted under this Agreement, and in connection with the Llama Materials, neither Meta nor Licensee may use any name or mark owned by or associated with the other or any of its affiliates, except as required for reasonable and customary use in describing and redistributing the Llama Materials or as set forth in this Section 5(a). Meta hereby grants you a license to use “Llama 3” (the “Mark”) solely as required to comply with the last sentence of Section 1.b.i. You will comply with Meta’s brand guidelines (currently accessible at https://about.meta.com/brand/resources/meta/company-brand/ ). All goodwill arising out of your use of the Mark will inure to the benefit of Meta. b. Subject to Meta’s ownership of Llama Materials and derivatives made by or for Meta, with respect to any derivative works and modifications of the Llama Materials that are made by you, as between you and Meta, you are and will be the owner of such derivative works and modifications. c. If you institute litigation or other proceedings against Meta or any entity (including a cross-claim or counterclaim in a lawsuit) alleging that the Llama Materials or Meta Llama 3 outputs or results, or any portion of any of the foregoing, constitutes infringement of intellectual property or other rights owned or licensable by you, then any licenses granted to you under this Agreement shall terminate as of the date such litigation or claim is filed or instituted. You will indemnify and hold harmless Meta from and against any claim by any third party arising out of or related to your use or distribution of the Llama Materials. 6. Term and Termination. The term of this Agreement will commence upon your acceptance of this Agreement or access to the Llama Materials and will continue in full force and effect until terminated in accordance with the terms and conditions herein. Meta may terminate this Agreement if you are in breach of any term or condition of this Agreement. Upon termination of this Agreement, you shall delete and cease use of the Llama Materials. Sections 3, 4 and 7 shall survive the termination of this Agreement. 7. Governing Law and Jurisdiction. This Agreement will be governed and construed under the laws of the State of California without regard to choice of law principles, and the UN Convention on Contracts for the International Sale of Goods does not apply to this Agreement. The courts of California shall have exclusive jurisdiction of any dispute arising out of this Agreement. ### Meta Llama 3 Acceptable Use Policy Meta is committed to promoting safe and fair use of its tools and features, including Meta Llama 3. If you access or use Meta Llama 3, you agree to this Acceptable Use Policy (“Policy”). The most recent copy of this policy can be found at [https://llama.meta.com/llama3/use-policy](https://llama.meta.com/llama3/use-policy) #### Prohibited Uses We want everyone to use Meta Llama 3 safely and responsibly. You agree you will not use, or allow others to use, Meta Llama 3 to: 1. Violate the law or others’ rights, including to: 1. Engage in, promote, generate, contribute to, encourage, plan, incite, or further illegal or unlawful activity or content, such as: 1. Violence or terrorism 2. Exploitation or harm to children, including the solicitation, creation, acquisition, or dissemination of child exploitative content or failure to report Child Sexual Abuse Material 3. Human trafficking, exploitation, and sexual violence 4. The illegal distribution of information or materials to minors, including obscene materials, or failure to employ legally required age-gating in connection with such information or materials. 5. Sexual solicitation 6. Any other criminal activity 2. Engage in, promote, incite, or facilitate the harassment, abuse, threatening, or bullying of individuals or groups of individuals 3. Engage in, promote, incite, or facilitate discrimination or other unlawful or harmful conduct in the provision of employment, employment benefits, credit, housing, other economic benefits, or other essential goods and services 4. Engage in the unauthorized or unlicensed practice of any profession including, but not limited to, financial, legal, medical/health, or related professional practices 5. Collect, process, disclose, generate, or infer health, demographic, or other sensitive personal or private information about individuals without rights and consents required by applicable laws 6. Engage in or facilitate any action or generate any content that infringes, misappropriates, or otherwise violates any third-party rights, including the outputs or results of any products or services using the Llama Materials 7. Create, generate, or facilitate the creation of malicious code, malware, computer viruses or do anything else that could disable, overburden, interfere with or impair the proper working, integrity, operation or appearance of a website or computer system 2. Engage in, promote, incite, facilitate, or assist in the planning or development of activities that present a risk of death or bodily harm to individuals, including use of Meta Llama 3 related to the following: 1. Military, warfare, nuclear industries or applications, espionage, use for materials or activities that are subject to the International Traffic Arms Regulations (ITAR) maintained by the United States Department of State 2. Guns and illegal weapons (including weapon development) 3. Illegal drugs and regulated/controlled substances 4. Operation of critical infrastructure, transportation technologies, or heavy machinery 5. Self-harm or harm to others, including suicide, cutting, and eating disorders 6. Any content intended to incite or promote violence, abuse, or any infliction of bodily harm to an individual 3. Intentionally deceive or mislead others, including use of Meta Llama 3 related to the following: 1. Generating, promoting, or furthering fraud or the creation or promotion of disinformation 2. Generating, promoting, or furthering defamatory content, including the creation of defamatory statements, images, or other content 3. Generating, promoting, or further distributing spam 4. Impersonating another individual without consent, authorization, or legal right 5. Representing that the use of Meta Llama 3 or outputs are human-generated 6. Generating or facilitating false online engagement, including fake reviews and other means of fake online engagement 4. Fail to appropriately disclose to end users any known dangers of your AI system Please report any violation of this Policy, software “bug,” or other problems that could lead to a violation of this Policy through one of the following means: * Reporting issues with the model: [https://github.com/meta-llama/llama3](https://github.com/meta-llama/llama3) * Reporting risky content generated by the model: developers.facebook.com/llama_output_feedback * Reporting bugs and security concerns: facebook.com/whitehat/info * Reporting violations of the Acceptable Use Policy or unlicensed uses of Meta Llama 3: LlamaUseReport@meta.com extra_gated_fields: First Name: text Last Name: text Date of birth: date_picker Country: country Affiliation: text geo: ip_location By clicking Submit below I accept the terms of the license and acknowledge that the information I provide will be collected stored processed and shared in accordance with the Meta Privacy Policy: checkbox extra_gated_description: The information you provide will be collected, stored, processed and shared in accordance with the [Meta Privacy Policy](https://www.facebook.com/privacy/policy/). extra_gated_button_content: Submit widget: - example_title: Hello messages: - role: user content: Hey my name is Julien! How are you? - example_title: Winter holidays messages: - role: system content: You are a helpful and honest assistant. Please, respond concisely and truthfully. - role: user content: Can you recommend a good destination for Winter holidays? - example_title: Programming assistant messages: - role: system content: You are a helpful and honest code and programming assistant. Please, respond concisely and truthfully. - role: user content: Write a function that computes the nth fibonacci number. inference: parameters: max_new_tokens: 300 stop: - <|end_of_text|> - <|eot_id|> --- ## Model Details Meta developed and released the Meta Llama 3 family of large language models (LLMs), a collection of pretrained and instruction tuned generative text models in 8 and 70B sizes. The Llama 3 instruction tuned models are optimized for dialogue use cases and outperform many of the available open source chat models on common industry benchmarks. Further, in developing these models, we took great care to optimize helpfulness and safety. **Model developers** Meta **Variations** Llama 3 comes in two sizes — 8B and 70B parameters — in pre-trained and instruction tuned variants. **Input** Models input text only. **Output** Models generate text and code only. **Model Architecture** Llama 3 is an auto-regressive language model that uses an optimized transformer architecture. The tuned versions use supervised fine-tuning (SFT) and reinforcement learning with human feedback (RLHF) to align with human preferences for helpfulness and safety. <table> <tr> <td> </td> <td><strong>Training Data</strong> </td> <td><strong>Params</strong> </td> <td><strong>Context length</strong> </td> <td><strong>GQA</strong> </td> <td><strong>Token count</strong> </td> <td><strong>Knowledge cutoff</strong> </td> </tr> <tr> <td rowspan="2" >Llama 3 </td> <td rowspan="2" >A new mix of publicly available online data. </td> <td>8B </td> <td>8k </td> <td>Yes </td> <td rowspan="2" >15T+ </td> <td>March, 2023 </td> </tr> <tr> <td>70B </td> <td>8k </td> <td>Yes </td> <td>December, 2023 </td> </tr> </table> **Llama 3 family of models**. Token counts refer to pretraining data only. Both the 8 and 70B versions use Grouped-Query Attention (GQA) for improved inference scalability. **Model Release Date** April 18, 2024. **Status** This is a static model trained on an offline dataset. Future versions of the tuned models will be released as we improve model safety with community feedback. **License** A custom commercial license is available at: [https://llama.meta.com/llama3/license](https://llama.meta.com/llama3/license) Where to send questions or comments about the model Instructions on how to provide feedback or comments on the model can be found in the model [README](https://github.com/meta-llama/llama3). For more technical information about generation parameters and recipes for how to use Llama 3 in applications, please go [here](https://github.com/meta-llama/llama-recipes). ## Intended Use **Intended Use Cases** Llama 3 is intended for commercial and research use in English. Instruction tuned models are intended for assistant-like chat, whereas pretrained models can be adapted for a variety of natural language generation tasks. **Out-of-scope** Use in any manner that violates applicable laws or regulations (including trade compliance laws). Use in any other way that is prohibited by the Acceptable Use Policy and Llama 3 Community License. Use in languages other than English**. **Note: Developers may fine-tune Llama 3 models for languages beyond English provided they comply with the Llama 3 Community License and the Acceptable Use Policy. ## How to use This repository contains two versions of Meta-Llama-3-8B-Instruct, for use with transformers and with the original `llama3` codebase. ### Use with transformers You can run conversational inference using the Transformers pipeline abstraction, or by leveraging the Auto classes with the `generate()` function. Let's see examples of both. #### Transformers pipeline ```python import transformers import torch model_id = "meta-llama/Meta-Llama-3-8B-Instruct" pipeline = transformers.pipeline( "text-generation", model=model_id, model_kwargs={"torch_dtype": torch.bfloat16}, device_map="auto", ) messages = [ {"role": "system", "content": "You are a pirate chatbot who always responds in pirate speak!"}, {"role": "user", "content": "Who are you?"}, ] terminators = [ pipeline.tokenizer.eos_token_id, pipeline.tokenizer.convert_tokens_to_ids("<|eot_id|>") ] outputs = pipeline( messages, max_new_tokens=256, eos_token_id=terminators, do_sample=True, temperature=0.6, top_p=0.9, ) print(outputs[0]["generated_text"][-1]) ``` #### Transformers AutoModelForCausalLM ```python from transformers import AutoTokenizer, AutoModelForCausalLM import torch model_id = "meta-llama/Meta-Llama-3-8B-Instruct" tokenizer = AutoTokenizer.from_pretrained(model_id) model = AutoModelForCausalLM.from_pretrained( model_id, torch_dtype=torch.bfloat16, device_map="auto", ) messages = [ {"role": "system", "content": "You are a pirate chatbot who always responds in pirate speak!"}, {"role": "user", "content": "Who are you?"}, ] input_ids = tokenizer.apply_chat_template( messages, add_generation_prompt=True, return_tensors="pt" ).to(model.device) terminators = [ tokenizer.eos_token_id, tokenizer.convert_tokens_to_ids("<|eot_id|>") ] outputs = model.generate( input_ids, max_new_tokens=256, eos_token_id=terminators, do_sample=True, temperature=0.6, top_p=0.9, ) response = outputs[0][input_ids.shape[-1]:] print(tokenizer.decode(response, skip_special_tokens=True)) ``` ### Use with `llama3` Please, follow the instructions in the [repository](https://github.com/meta-llama/llama3) To download Original checkpoints, see the example command below leveraging `huggingface-cli`: ``` huggingface-cli download meta-llama/Meta-Llama-3-8B-Instruct --include "original/*" --local-dir Meta-Llama-3-8B-Instruct ``` For Hugging Face support, we recommend using transformers or TGI, but a similar command works. ## Hardware and Software **Training Factors** We used custom training libraries, Meta's Research SuperCluster, and production clusters for pretraining. Fine-tuning, annotation, and evaluation were also performed on third-party cloud compute. **Carbon Footprint Pretraining utilized a cumulative** 7.7M GPU hours of computation on hardware of type H100-80GB (TDP of 700W). Estimated total emissions were 2290 tCO2eq, 100% of which were offset by Meta’s sustainability program. <table> <tr> <td> </td> <td><strong>Time (GPU hours)</strong> </td> <td><strong>Power Consumption (W)</strong> </td> <td><strong>Carbon Emitted(tCO2eq)</strong> </td> </tr> <tr> <td>Llama 3 8B </td> <td>1.3M </td> <td>700 </td> <td>390 </td> </tr> <tr> <td>Llama 3 70B </td> <td>6.4M </td> <td>700 </td> <td>1900 </td> </tr> <tr> <td>Total </td> <td>7.7M </td> <td> </td> <td>2290 </td> </tr> </table> **CO2 emissions during pre-training**. Time: total GPU time required for training each model. Power Consumption: peak power capacity per GPU device for the GPUs used adjusted for power usage efficiency. 100% of the emissions are directly offset by Meta's sustainability program, and because we are openly releasing these models, the pretraining costs do not need to be incurred by others. ## Training Data **Overview** Llama 3 was pretrained on over 15 trillion tokens of data from publicly available sources. The fine-tuning data includes publicly available instruction datasets, as well as over 10M human-annotated examples. Neither the pretraining nor the fine-tuning datasets include Meta user data. **Data Freshness** The pretraining data has a cutoff of March 2023 for the 8B and December 2023 for the 70B models respectively. ## Benchmarks In this section, we report the results for Llama 3 models on standard automatic benchmarks. For all the evaluations, we use our internal evaluations library. For details on the methodology see [here](https://github.com/meta-llama/llama3/blob/main/eval_methodology.md). ### Base pretrained models <table> <tr> <td><strong>Category</strong> </td> <td><strong>Benchmark</strong> </td> <td><strong>Llama 3 8B</strong> </td> <td><strong>Llama2 7B</strong> </td> <td><strong>Llama2 13B</strong> </td> <td><strong>Llama 3 70B</strong> </td> <td><strong>Llama2 70B</strong> </td> </tr> <tr> <td rowspan="6" >General </td> <td>MMLU (5-shot) </td> <td>66.6 </td> <td>45.7 </td> <td>53.8 </td> <td>79.5 </td> <td>69.7 </td> </tr> <tr> <td>AGIEval English (3-5 shot) </td> <td>45.9 </td> <td>28.8 </td> <td>38.7 </td> <td>63.0 </td> <td>54.8 </td> </tr> <tr> <td>CommonSenseQA (7-shot) </td> <td>72.6 </td> <td>57.6 </td> <td>67.6 </td> <td>83.8 </td> <td>78.7 </td> </tr> <tr> <td>Winogrande (5-shot) </td> <td>76.1 </td> <td>73.3 </td> <td>75.4 </td> <td>83.1 </td> <td>81.8 </td> </tr> <tr> <td>BIG-Bench Hard (3-shot, CoT) </td> <td>61.1 </td> <td>38.1 </td> <td>47.0 </td> <td>81.3 </td> <td>65.7 </td> </tr> <tr> <td>ARC-Challenge (25-shot) </td> <td>78.6 </td> <td>53.7 </td> <td>67.6 </td> <td>93.0 </td> <td>85.3 </td> </tr> <tr> <td>Knowledge reasoning </td> <td>TriviaQA-Wiki (5-shot) </td> <td>78.5 </td> <td>72.1 </td> <td>79.6 </td> <td>89.7 </td> <td>87.5 </td> </tr> <tr> <td rowspan="4" >Reading comprehension </td> <td>SQuAD (1-shot) </td> <td>76.4 </td> <td>72.2 </td> <td>72.1 </td> <td>85.6 </td> <td>82.6 </td> </tr> <tr> <td>QuAC (1-shot, F1) </td> <td>44.4 </td> <td>39.6 </td> <td>44.9 </td> <td>51.1 </td> <td>49.4 </td> </tr> <tr> <td>BoolQ (0-shot) </td> <td>75.7 </td> <td>65.5 </td> <td>66.9 </td> <td>79.0 </td> <td>73.1 </td> </tr> <tr> <td>DROP (3-shot, F1) </td> <td>58.4 </td> <td>37.9 </td> <td>49.8 </td> <td>79.7 </td> <td>70.2 </td> </tr> </table> ### Instruction tuned models <table> <tr> <td><strong>Benchmark</strong> </td> <td><strong>Llama 3 8B</strong> </td> <td><strong>Llama 2 7B</strong> </td> <td><strong>Llama 2 13B</strong> </td> <td><strong>Llama 3 70B</strong> </td> <td><strong>Llama 2 70B</strong> </td> </tr> <tr> <td>MMLU (5-shot) </td> <td>68.4 </td> <td>34.1 </td> <td>47.8 </td> <td>82.0 </td> <td>52.9 </td> </tr> <tr> <td>GPQA (0-shot) </td> <td>34.2 </td> <td>21.7 </td> <td>22.3 </td> <td>39.5 </td> <td>21.0 </td> </tr> <tr> <td>HumanEval (0-shot) </td> <td>62.2 </td> <td>7.9 </td> <td>14.0 </td> <td>81.7 </td> <td>25.6 </td> </tr> <tr> <td>GSM-8K (8-shot, CoT) </td> <td>79.6 </td> <td>25.7 </td> <td>77.4 </td> <td>93.0 </td> <td>57.5 </td> </tr> <tr> <td>MATH (4-shot, CoT) </td> <td>30.0 </td> <td>3.8 </td> <td>6.7 </td> <td>50.4 </td> <td>11.6 </td> </tr> </table> ### Responsibility & Safety We believe that an open approach to AI leads to better, safer products, faster innovation, and a bigger overall market. We are committed to Responsible AI development and took a series of steps to limit misuse and harm and support the open source community. Foundation models are widely capable technologies that are built to be used for a diverse range of applications. They are not designed to meet every developer preference on safety levels for all use cases, out-of-the-box, as those by their nature will differ across different applications. Rather, responsible LLM-application deployment is achieved by implementing a series of safety best practices throughout the development of such applications, from the model pre-training, fine-tuning and the deployment of systems composed of safeguards to tailor the safety needs specifically to the use case and audience. As part of the Llama 3 release, we updated our [Responsible Use Guide](https://llama.meta.com/responsible-use-guide/) to outline the steps and best practices for developers to implement model and system level safety for their application. We also provide a set of resources including [Meta Llama Guard 2](https://llama.meta.com/purple-llama/) and [Code Shield](https://llama.meta.com/purple-llama/) safeguards. These tools have proven to drastically reduce residual risks of LLM Systems, while maintaining a high level of helpfulness. We encourage developers to tune and deploy these safeguards according to their needs and we provide a [reference implementation](https://github.com/meta-llama/llama-recipes/tree/main/recipes/responsible_ai) to get you started. #### Llama 3-Instruct As outlined in the Responsible Use Guide, some trade-off between model helpfulness and model alignment is likely unavoidable. Developers should exercise discretion about how to weigh the benefits of alignment and helpfulness for their specific use case and audience. Developers should be mindful of residual risks when using Llama models and leverage additional safety tools as needed to reach the right safety bar for their use case. <span style="text-decoration:underline;">Safety</span> For our instruction tuned model, we conducted extensive red teaming exercises, performed adversarial evaluations and implemented safety mitigations techniques to lower residual risks. As with any Large Language Model, residual risks will likely remain and we recommend that developers assess these risks in the context of their use case. In parallel, we are working with the community to make AI safety benchmark standards transparent, rigorous and interpretable. <span style="text-decoration:underline;">Refusals</span> In addition to residual risks, we put a great emphasis on model refusals to benign prompts. Over-refusing not only can impact the user experience but could even be harmful in certain contexts as well. We’ve heard the feedback from the developer community and improved our fine tuning to ensure that Llama 3 is significantly less likely to falsely refuse to answer prompts than Llama 2. We built internal benchmarks and developed mitigations to limit false refusals making Llama 3 our most helpful model to date. #### Responsible release In addition to responsible use considerations outlined above, we followed a rigorous process that requires us to take extra measures against misuse and critical risks before we make our release decision. Misuse If you access or use Llama 3, you agree to the Acceptable Use Policy. The most recent copy of this policy can be found at [https://llama.meta.com/llama3/use-policy/](https://llama.meta.com/llama3/use-policy/). #### Critical risks <span style="text-decoration:underline;">CBRNE</span> (Chemical, Biological, Radiological, Nuclear, and high yield Explosives) We have conducted a two fold assessment of the safety of the model in this area: * Iterative testing during model training to assess the safety of responses related to CBRNE threats and other adversarial risks. * Involving external CBRNE experts to conduct an uplift test assessing the ability of the model to accurately provide expert knowledge and reduce barriers to potential CBRNE misuse, by reference to what can be achieved using web search (without the model). ### <span style="text-decoration:underline;">Cyber Security </span> We have evaluated Llama 3 with CyberSecEval, Meta’s cybersecurity safety eval suite, measuring Llama 3’s propensity to suggest insecure code when used as a coding assistant, and Llama 3’s propensity to comply with requests to help carry out cyber attacks, where attacks are defined by the industry standard MITRE ATT&CK cyber attack ontology. On our insecure coding and cyber attacker helpfulness tests, Llama 3 behaved in the same range or safer than models of [equivalent coding capability](https://huggingface.co/spaces/facebook/CyberSecEval). ### <span style="text-decoration:underline;">Child Safety</span> Child Safety risk assessments were conducted using a team of experts, to assess the model’s capability to produce outputs that could result in Child Safety risks and inform on any necessary and appropriate risk mitigations via fine tuning. We leveraged those expert red teaming sessions to expand the coverage of our evaluation benchmarks through Llama 3 model development. For Llama 3, we conducted new in-depth sessions using objective based methodologies to assess the model risks along multiple attack vectors. We also partnered with content specialists to perform red teaming exercises assessing potentially violating content while taking account of market specific nuances or experiences. ### Community Generative AI safety requires expertise and tooling, and we believe in the strength of the open community to accelerate its progress. We are active members of open consortiums, including the AI Alliance, Partnership in AI and MLCommons, actively contributing to safety standardization and transparency. We encourage the community to adopt taxonomies like the MLCommons Proof of Concept evaluation to facilitate collaboration and transparency on safety and content evaluations. Our Purple Llama tools are open sourced for the community to use and widely distributed across ecosystem partners including cloud service providers. We encourage community contributions to our [Github repository](https://github.com/meta-llama/PurpleLlama). Finally, we put in place a set of resources including an [output reporting mechanism](https://developers.facebook.com/llama_output_feedback) and [bug bounty program](https://www.facebook.com/whitehat) to continuously improve the Llama technology with the help of the community. ## Ethical Considerations and Limitations The core values of Llama 3 are openness, inclusivity and helpfulness. It is meant to serve everyone, and to work for a wide range of use cases. It is thus designed to be accessible to people across many different backgrounds, experiences and perspectives. Llama 3 addresses users and their needs as they are, without insertion unnecessary judgment or normativity, while reflecting the understanding that even content that may appear problematic in some cases can serve valuable purposes in others. It respects the dignity and autonomy of all users, especially in terms of the values of free thought and expression that power innovation and progress. But Llama 3 is a new technology, and like any new technology, there are risks associated with its use. Testing conducted to date has been in English, and has not covered, nor could it cover, all scenarios. For these reasons, as with all LLMs, Llama 3’s potential outputs cannot be predicted in advance, and the model may in some instances produce inaccurate, biased or other objectionable responses to user prompts. Therefore, before deploying any applications of Llama 3 models, developers should perform safety testing and tuning tailored to their specific applications of the model. As outlined in the Responsible Use Guide, we recommend incorporating [Purple Llama](https://github.com/facebookresearch/PurpleLlama) solutions into your workflows and specifically [Llama Guard](https://ai.meta.com/research/publications/llama-guard-llm-based-input-output-safeguard-for-human-ai-conversations/) which provides a base model to filter input and output prompts to layer system-level safety on top of model-level safety. Please see the Responsible Use Guide available at [http://llama.meta.com/responsible-use-guide](http://llama.meta.com/responsible-use-guide) ## Citation instructions @article{llama3modelcard, title={Llama 3 Model Card}, author={AI@Meta}, year={2024}, url = {https://github.com/meta-llama/llama3/blob/main/MODEL_CARD.md} } ## Contributors Aaditya Singh; Aaron Grattafiori; Abhimanyu Dubey; Abhinav Jauhri; Abhinav Pandey; Abhishek Kadian; Adam Kelsey; Adi Gangidi; Ahmad Al-Dahle; Ahuva Goldstand; Aiesha Letman; Ajay Menon; Akhil Mathur; Alan Schelten; Alex Vaughan; Amy Yang; Andrei Lupu; Andres Alvarado; Andrew Gallagher; Andrew Gu; Andrew Ho; Andrew Poulton; Andrew Ryan; Angela Fan; Ankit Ramchandani; Anthony Hartshorn; Archi Mitra; Archie Sravankumar; Artem Korenev; Arun Rao; Ashley Gabriel; Ashwin Bharambe; Assaf Eisenman; Aston Zhang; Aurelien Rodriguez; Austen Gregerson; Ava Spataru; Baptiste Roziere; Ben Maurer; Benjamin Leonhardi; Bernie Huang; Bhargavi Paranjape; Bing Liu; Binh Tang; Bobbie Chern; Brani Stojkovic; Brian Fuller; Catalina Mejia Arenas; Chao Zhou; Charlotte Caucheteux; Chaya Nayak; Ching-Hsiang Chu; Chloe Bi; Chris Cai; Chris Cox; Chris Marra; Chris McConnell; Christian Keller; Christoph Feichtenhofer; Christophe Touret; Chunyang Wu; Corinne Wong; Cristian Canton Ferrer; Damien Allonsius; Daniel Kreymer; Daniel Haziza; Daniel Li; Danielle Pintz; Danny Livshits; Danny Wyatt; David Adkins; David Esiobu; David Xu; Davide Testuggine; Delia David; Devi Parikh; Dhruv Choudhary; Dhruv Mahajan; Diana Liskovich; Diego Garcia-Olano; Diego Perino; Dieuwke Hupkes; Dingkang Wang; Dustin Holland; Egor Lakomkin; Elina Lobanova; Xiaoqing Ellen Tan; Emily Dinan; Eric Smith; Erik Brinkman; Esteban Arcaute; Filip Radenovic; Firat Ozgenel; Francesco Caggioni; Frank Seide; Frank Zhang; Gabriel Synnaeve; Gabriella Schwarz; Gabrielle Lee; Gada Badeer; Georgia Anderson; Graeme Nail; Gregoire Mialon; Guan Pang; Guillem Cucurell; Hailey Nguyen; Hannah Korevaar; Hannah Wang; Haroun Habeeb; Harrison Rudolph; Henry Aspegren; Hu Xu; Hugo Touvron; Iga Kozlowska; Igor Molybog; Igor Tufanov; Iliyan Zarov; Imanol Arrieta Ibarra; Irina-Elena Veliche; Isabel Kloumann; Ishan Misra; Ivan Evtimov; Jacob Xu; Jade Copet; Jake Weissman; Jan Geffert; Jana Vranes; Japhet Asher; Jason Park; Jay Mahadeokar; Jean-Baptiste Gaya; Jeet Shah; Jelmer van der Linde; Jennifer Chan; Jenny Hong; Jenya Lee; Jeremy Fu; Jeremy Teboul; Jianfeng Chi; Jianyu Huang; Jie Wang; Jiecao Yu; Joanna Bitton; Joe Spisak; Joelle Pineau; Jon Carvill; Jongsoo Park; Joseph Rocca; Joshua Johnstun; Junteng Jia; Kalyan Vasuden Alwala; Kam Hou U; Kate Plawiak; Kartikeya Upasani; Kaushik Veeraraghavan; Ke Li; Kenneth Heafield; Kevin Stone; Khalid El-Arini; Krithika Iyer; Kshitiz Malik; Kuenley Chiu; Kunal Bhalla; Kyle Huang; Lakshya Garg; Lauren Rantala-Yeary; Laurens van der Maaten; Lawrence Chen; Leandro Silva; Lee Bell; Lei Zhang; Liang Tan; Louis Martin; Lovish Madaan; Luca Wehrstedt; Lukas Blecher; Luke de Oliveira; Madeline Muzzi; Madian Khabsa; Manav Avlani; Mannat Singh; Manohar Paluri; Mark Zuckerberg; Marcin Kardas; Martynas Mankus; Mathew Oldham; Mathieu Rita; Matthew Lennie; Maya Pavlova; Meghan Keneally; Melanie Kambadur; Mihir Patel; Mikayel Samvelyan; Mike Clark; Mike Lewis; Min Si; Mitesh Kumar Singh; Mo Metanat; Mona Hassan; Naman Goyal; Narjes Torabi; Nicolas Usunier; Nikolay Bashlykov; Nikolay Bogoychev; Niladri Chatterji; Ning Dong; Oliver Aobo Yang; Olivier Duchenne; Onur Celebi; Parth Parekh; Patrick Alrassy; Paul Saab; Pavan Balaji; Pedro Rittner; Pengchuan Zhang; Pengwei Li; Petar Vasic; Peter Weng; Polina Zvyagina; Prajjwal Bhargava; Pratik Dubal; Praveen Krishnan; Punit Singh Koura; Qing He; Rachel Rodriguez; Ragavan Srinivasan; Rahul Mitra; Ramon Calderer; Raymond Li; Robert Stojnic; Roberta Raileanu; Robin Battey; Rocky Wang; Rohit Girdhar; Rohit Patel; Romain Sauvestre; Ronnie Polidoro; Roshan Sumbaly; Ross Taylor; Ruan Silva; Rui Hou; Rui Wang; Russ Howes; Ruty Rinott; Saghar Hosseini; Sai Jayesh Bondu; Samyak Datta; Sanjay Singh; Sara Chugh; Sargun Dhillon; Satadru Pan; Sean Bell; Sergey Edunov; Shaoliang Nie; Sharan Narang; Sharath Raparthy; Shaun Lindsay; Sheng Feng; Sheng Shen; Shenghao Lin; Shiva Shankar; Shruti Bhosale; Shun Zhang; Simon Vandenhende; Sinong Wang; Seohyun Sonia Kim; Soumya Batra; Sten Sootla; Steve Kehoe; Suchin Gururangan; Sumit Gupta; Sunny Virk; Sydney Borodinsky; Tamar Glaser; Tamar Herman; Tamara Best; Tara Fowler; Thomas Georgiou; Thomas Scialom; Tianhe Li; Todor Mihaylov; Tong Xiao; Ujjwal Karn; Vedanuj Goswami; Vibhor Gupta; Vignesh Ramanathan; Viktor Kerkez; Vinay Satish Kumar; Vincent Gonguet; Vish Vogeti; Vlad Poenaru; Vlad Tiberiu Mihailescu; Vladan Petrovic; Vladimir Ivanov; Wei Li; Weiwei Chu; Wenhan Xiong; Wenyin Fu; Wes Bouaziz; Whitney Meers; Will Constable; Xavier Martinet; Xiaojian Wu; Xinbo Gao; Xinfeng Xie; Xuchao Jia; Yaelle Goldschlag; Yann LeCun; Yashesh Gaur; Yasmine Babaei; Ye Qi; Yenda Li; Yi Wen; Yiwen Song; Youngjin Nam; Yuchen Hao; Yuchen Zhang; Yun Wang; Yuning Mao; Yuzi He; Zacharie Delpierre Coudert; Zachary DeVito; Zahra Hankir; Zhaoduo Wen; Zheng Yan; Zhengxing Chen; Zhenyu Yang; Zoe Papakipos

mixedbread-ai/mxbai-embed-large-v1

mixedbread-ai

sentence-transformers

feature-extraction

--- tags: - mteb - transformers.js - transformers model-index: - name: mxbai-angle-large-v1 results: - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en) config: en split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 75.044776119403 - type: ap value: 37.7362433623053 - type: f1 value: 68.92736573359774 - task: type: Classification dataset: type: mteb/amazon_polarity name: MTEB AmazonPolarityClassification config: default split: test revision: e2d317d38cd51312af73b3d32a06d1a08b442046 metrics: - type: accuracy value: 93.84025000000001 - type: ap value: 90.93190875404055 - type: f1 value: 93.8297833897293 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (en) config: en split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 49.184 - type: f1 value: 48.74163227751588 - task: type: Retrieval dataset: type: arguana name: MTEB ArguAna config: default split: test revision: None metrics: - type: map_at_1 value: 41.252 - type: map_at_10 value: 57.778 - type: map_at_100 value: 58.233000000000004 - type: map_at_1000 value: 58.23700000000001 - type: map_at_3 value: 53.449999999999996 - type: map_at_5 value: 56.376000000000005 - type: mrr_at_1 value: 41.679 - type: mrr_at_10 value: 57.92699999999999 - type: mrr_at_100 value: 58.389 - type: mrr_at_1000 value: 58.391999999999996 - type: mrr_at_3 value: 53.651 - type: mrr_at_5 value: 56.521 - type: ndcg_at_1 value: 41.252 - type: ndcg_at_10 value: 66.018 - type: ndcg_at_100 value: 67.774 - type: ndcg_at_1000 value: 67.84400000000001 - type: ndcg_at_3 value: 57.372 - type: ndcg_at_5 value: 62.646 - type: precision_at_1 value: 41.252 - type: precision_at_10 value: 9.189 - type: precision_at_100 value: 0.991 - type: precision_at_1000 value: 0.1 - type: precision_at_3 value: 22.902 - type: precision_at_5 value: 16.302 - type: recall_at_1 value: 41.252 - type: recall_at_10 value: 91.892 - type: recall_at_100 value: 99.14699999999999 - type: recall_at_1000 value: 99.644 - type: recall_at_3 value: 68.706 - type: recall_at_5 value: 81.50800000000001 - task: type: Clustering dataset: type: mteb/arxiv-clustering-p2p name: MTEB ArxivClusteringP2P config: default split: test revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d metrics: - type: v_measure value: 48.97294504317859 - task: type: Clustering dataset: type: mteb/arxiv-clustering-s2s name: MTEB ArxivClusteringS2S config: default split: test revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 metrics: - type: v_measure value: 42.98071077674629 - task: type: Reranking dataset: type: mteb/askubuntudupquestions-reranking name: MTEB AskUbuntuDupQuestions config: default split: test revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 metrics: - type: map value: 65.16477858490782 - type: mrr value: 78.23583080508287 - task: type: STS dataset: type: mteb/biosses-sts name: MTEB BIOSSES config: default split: test revision: d3fb88f8f02e40887cd149695127462bbcf29b4a metrics: - type: cos_sim_pearson value: 89.6277629421789 - type: cos_sim_spearman value: 88.4056288400568 - type: euclidean_pearson value: 87.94871847578163 - type: euclidean_spearman value: 88.4056288400568 - type: manhattan_pearson value: 87.73271254229648 - type: manhattan_spearman value: 87.91826833762677 - task: type: Classification dataset: type: mteb/banking77 name: MTEB Banking77Classification config: default split: test revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 metrics: - type: accuracy value: 87.81818181818181 - type: f1 value: 87.79879337316918 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-p2p name: MTEB BiorxivClusteringP2P config: default split: test revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 metrics: - type: v_measure value: 39.91773608582761 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-s2s name: MTEB BiorxivClusteringS2S config: default split: test revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 metrics: - type: v_measure value: 36.73059477462478 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackAndroidRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 32.745999999999995 - type: map_at_10 value: 43.632 - type: map_at_100 value: 45.206 - type: map_at_1000 value: 45.341 - type: map_at_3 value: 39.956 - type: map_at_5 value: 42.031 - type: mrr_at_1 value: 39.485 - type: mrr_at_10 value: 49.537 - type: mrr_at_100 value: 50.249 - type: mrr_at_1000 value: 50.294000000000004 - type: mrr_at_3 value: 46.757 - type: mrr_at_5 value: 48.481 - type: ndcg_at_1 value: 39.485 - type: ndcg_at_10 value: 50.058 - type: ndcg_at_100 value: 55.586 - type: ndcg_at_1000 value: 57.511 - type: ndcg_at_3 value: 44.786 - type: ndcg_at_5 value: 47.339999999999996 - type: precision_at_1 value: 39.485 - type: precision_at_10 value: 9.557 - type: precision_at_100 value: 1.552 - type: precision_at_1000 value: 0.202 - type: precision_at_3 value: 21.412 - type: precision_at_5 value: 15.479000000000001 - type: recall_at_1 value: 32.745999999999995 - type: recall_at_10 value: 62.056 - type: recall_at_100 value: 85.088 - type: recall_at_1000 value: 96.952 - type: recall_at_3 value: 46.959 - type: recall_at_5 value: 54.06999999999999 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackEnglishRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 31.898 - type: map_at_10 value: 42.142 - type: map_at_100 value: 43.349 - type: map_at_1000 value: 43.483 - type: map_at_3 value: 39.18 - type: map_at_5 value: 40.733000000000004 - type: mrr_at_1 value: 39.617999999999995 - type: mrr_at_10 value: 47.922 - type: mrr_at_100 value: 48.547000000000004 - type: mrr_at_1000 value: 48.597 - type: mrr_at_3 value: 45.86 - type: mrr_at_5 value: 46.949000000000005 - type: ndcg_at_1 value: 39.617999999999995 - type: ndcg_at_10 value: 47.739 - type: ndcg_at_100 value: 51.934999999999995 - type: ndcg_at_1000 value: 54.007000000000005 - type: ndcg_at_3 value: 43.748 - type: ndcg_at_5 value: 45.345 - type: precision_at_1 value: 39.617999999999995 - type: precision_at_10 value: 8.962 - type: precision_at_100 value: 1.436 - type: precision_at_1000 value: 0.192 - type: precision_at_3 value: 21.083 - type: precision_at_5 value: 14.752 - type: recall_at_1 value: 31.898 - type: recall_at_10 value: 57.587999999999994 - type: recall_at_100 value: 75.323 - type: recall_at_1000 value: 88.304 - type: recall_at_3 value: 45.275 - type: recall_at_5 value: 49.99 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGamingRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 40.458 - type: map_at_10 value: 52.942 - type: map_at_100 value: 53.974 - type: map_at_1000 value: 54.031 - type: map_at_3 value: 49.559999999999995 - type: map_at_5 value: 51.408 - type: mrr_at_1 value: 46.27 - type: mrr_at_10 value: 56.31699999999999 - type: mrr_at_100 value: 56.95099999999999 - type: mrr_at_1000 value: 56.98 - type: mrr_at_3 value: 53.835 - type: mrr_at_5 value: 55.252 - type: ndcg_at_1 value: 46.27 - type: ndcg_at_10 value: 58.964000000000006 - type: ndcg_at_100 value: 62.875 - type: ndcg_at_1000 value: 63.969 - type: ndcg_at_3 value: 53.297000000000004 - type: ndcg_at_5 value: 55.938 - type: precision_at_1 value: 46.27 - type: precision_at_10 value: 9.549000000000001 - type: precision_at_100 value: 1.2409999999999999 - type: precision_at_1000 value: 0.13799999999999998 - type: precision_at_3 value: 23.762 - type: precision_at_5 value: 16.262999999999998 - type: recall_at_1 value: 40.458 - type: recall_at_10 value: 73.446 - type: recall_at_100 value: 90.12400000000001 - type: recall_at_1000 value: 97.795 - type: recall_at_3 value: 58.123000000000005 - type: recall_at_5 value: 64.68 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGisRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.443 - type: map_at_10 value: 36.081 - type: map_at_100 value: 37.163000000000004 - type: map_at_1000 value: 37.232 - type: map_at_3 value: 33.308 - type: map_at_5 value: 34.724 - type: mrr_at_1 value: 29.492 - type: mrr_at_10 value: 38.138 - type: mrr_at_100 value: 39.065 - type: mrr_at_1000 value: 39.119 - type: mrr_at_3 value: 35.593 - type: mrr_at_5 value: 36.785000000000004 - type: ndcg_at_1 value: 29.492 - type: ndcg_at_10 value: 41.134 - type: ndcg_at_100 value: 46.300999999999995 - type: ndcg_at_1000 value: 48.106 - type: ndcg_at_3 value: 35.77 - type: ndcg_at_5 value: 38.032 - type: precision_at_1 value: 29.492 - type: precision_at_10 value: 6.249 - type: precision_at_100 value: 0.9299999999999999 - type: precision_at_1000 value: 0.11199999999999999 - type: precision_at_3 value: 15.065999999999999 - type: precision_at_5 value: 10.373000000000001 - type: recall_at_1 value: 27.443 - type: recall_at_10 value: 54.80199999999999 - type: recall_at_100 value: 78.21900000000001 - type: recall_at_1000 value: 91.751 - type: recall_at_3 value: 40.211000000000006 - type: recall_at_5 value: 45.599000000000004 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackMathematicaRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 18.731 - type: map_at_10 value: 26.717999999999996 - type: map_at_100 value: 27.897 - type: map_at_1000 value: 28.029 - type: map_at_3 value: 23.91 - type: map_at_5 value: 25.455 - type: mrr_at_1 value: 23.134 - type: mrr_at_10 value: 31.769 - type: mrr_at_100 value: 32.634 - type: mrr_at_1000 value: 32.707 - type: mrr_at_3 value: 28.938999999999997 - type: mrr_at_5 value: 30.531000000000002 - type: ndcg_at_1 value: 23.134 - type: ndcg_at_10 value: 32.249 - type: ndcg_at_100 value: 37.678 - type: ndcg_at_1000 value: 40.589999999999996 - type: ndcg_at_3 value: 26.985999999999997 - type: ndcg_at_5 value: 29.457 - type: precision_at_1 value: 23.134 - type: precision_at_10 value: 5.8709999999999996 - type: precision_at_100 value: 0.988 - type: precision_at_1000 value: 0.13799999999999998 - type: precision_at_3 value: 12.852 - type: precision_at_5 value: 9.428 - type: recall_at_1 value: 18.731 - type: recall_at_10 value: 44.419 - type: recall_at_100 value: 67.851 - type: recall_at_1000 value: 88.103 - type: recall_at_3 value: 29.919 - type: recall_at_5 value: 36.230000000000004 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackPhysicsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 30.324 - type: map_at_10 value: 41.265 - type: map_at_100 value: 42.559000000000005 - type: map_at_1000 value: 42.669000000000004 - type: map_at_3 value: 38.138 - type: map_at_5 value: 39.881 - type: mrr_at_1 value: 36.67 - type: mrr_at_10 value: 46.774 - type: mrr_at_100 value: 47.554 - type: mrr_at_1000 value: 47.593 - type: mrr_at_3 value: 44.338 - type: mrr_at_5 value: 45.723 - type: ndcg_at_1 value: 36.67 - type: ndcg_at_10 value: 47.367 - type: ndcg_at_100 value: 52.623 - type: ndcg_at_1000 value: 54.59 - type: ndcg_at_3 value: 42.323 - type: ndcg_at_5 value: 44.727 - type: precision_at_1 value: 36.67 - type: precision_at_10 value: 8.518 - type: precision_at_100 value: 1.2890000000000001 - type: precision_at_1000 value: 0.163 - type: precision_at_3 value: 19.955000000000002 - type: precision_at_5 value: 14.11 - type: recall_at_1 value: 30.324 - type: recall_at_10 value: 59.845000000000006 - type: recall_at_100 value: 81.77499999999999 - type: recall_at_1000 value: 94.463 - type: recall_at_3 value: 46.019 - type: recall_at_5 value: 52.163000000000004 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackProgrammersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 24.229 - type: map_at_10 value: 35.004000000000005 - type: map_at_100 value: 36.409000000000006 - type: map_at_1000 value: 36.521 - type: map_at_3 value: 31.793 - type: map_at_5 value: 33.432 - type: mrr_at_1 value: 30.365 - type: mrr_at_10 value: 40.502 - type: mrr_at_100 value: 41.372 - type: mrr_at_1000 value: 41.435 - type: mrr_at_3 value: 37.804 - type: mrr_at_5 value: 39.226 - type: ndcg_at_1 value: 30.365 - type: ndcg_at_10 value: 41.305 - type: ndcg_at_100 value: 47.028999999999996 - type: ndcg_at_1000 value: 49.375 - type: ndcg_at_3 value: 35.85 - type: ndcg_at_5 value: 38.12 - type: precision_at_1 value: 30.365 - type: precision_at_10 value: 7.808 - type: precision_at_100 value: 1.228 - type: precision_at_1000 value: 0.161 - type: precision_at_3 value: 17.352 - type: precision_at_5 value: 12.42 - type: recall_at_1 value: 24.229 - type: recall_at_10 value: 54.673 - type: recall_at_100 value: 78.766 - type: recall_at_1000 value: 94.625 - type: recall_at_3 value: 39.602 - type: recall_at_5 value: 45.558 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 26.695 - type: map_at_10 value: 36.0895 - type: map_at_100 value: 37.309416666666664 - type: map_at_1000 value: 37.42558333333334 - type: map_at_3 value: 33.19616666666666 - type: map_at_5 value: 34.78641666666667 - type: mrr_at_1 value: 31.486083333333337 - type: mrr_at_10 value: 40.34774999999999 - type: mrr_at_100 value: 41.17533333333333 - type: mrr_at_1000 value: 41.231583333333326 - type: mrr_at_3 value: 37.90075 - type: mrr_at_5 value: 39.266999999999996 - type: ndcg_at_1 value: 31.486083333333337 - type: ndcg_at_10 value: 41.60433333333334 - type: ndcg_at_100 value: 46.74525 - type: ndcg_at_1000 value: 48.96166666666667 - type: ndcg_at_3 value: 36.68825 - type: ndcg_at_5 value: 38.966499999999996 - type: precision_at_1 value: 31.486083333333337 - type: precision_at_10 value: 7.29675 - type: precision_at_100 value: 1.1621666666666666 - type: precision_at_1000 value: 0.1545 - type: precision_at_3 value: 16.8815 - type: precision_at_5 value: 11.974583333333333 - type: recall_at_1 value: 26.695 - type: recall_at_10 value: 53.651916666666665 - type: recall_at_100 value: 76.12083333333332 - type: recall_at_1000 value: 91.31191666666668 - type: recall_at_3 value: 40.03575 - type: recall_at_5 value: 45.876666666666665 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackStatsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 25.668000000000003 - type: map_at_10 value: 32.486 - type: map_at_100 value: 33.371 - type: map_at_1000 value: 33.458 - type: map_at_3 value: 30.261 - type: map_at_5 value: 31.418000000000003 - type: mrr_at_1 value: 28.988000000000003 - type: mrr_at_10 value: 35.414 - type: mrr_at_100 value: 36.149 - type: mrr_at_1000 value: 36.215 - type: mrr_at_3 value: 33.333 - type: mrr_at_5 value: 34.43 - type: ndcg_at_1 value: 28.988000000000003 - type: ndcg_at_10 value: 36.732 - type: ndcg_at_100 value: 41.331 - type: ndcg_at_1000 value: 43.575 - type: ndcg_at_3 value: 32.413 - type: ndcg_at_5 value: 34.316 - type: precision_at_1 value: 28.988000000000003 - type: precision_at_10 value: 5.7059999999999995 - type: precision_at_100 value: 0.882 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 13.65 - type: precision_at_5 value: 9.417 - type: recall_at_1 value: 25.668000000000003 - type: recall_at_10 value: 47.147 - type: recall_at_100 value: 68.504 - type: recall_at_1000 value: 85.272 - type: recall_at_3 value: 35.19 - type: recall_at_5 value: 39.925 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackTexRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 17.256 - type: map_at_10 value: 24.58 - type: map_at_100 value: 25.773000000000003 - type: map_at_1000 value: 25.899 - type: map_at_3 value: 22.236 - type: map_at_5 value: 23.507 - type: mrr_at_1 value: 20.957 - type: mrr_at_10 value: 28.416000000000004 - type: mrr_at_100 value: 29.447000000000003 - type: mrr_at_1000 value: 29.524 - type: mrr_at_3 value: 26.245 - type: mrr_at_5 value: 27.451999999999998 - type: ndcg_at_1 value: 20.957 - type: ndcg_at_10 value: 29.285 - type: ndcg_at_100 value: 35.003 - type: ndcg_at_1000 value: 37.881 - type: ndcg_at_3 value: 25.063000000000002 - type: ndcg_at_5 value: 26.983 - type: precision_at_1 value: 20.957 - type: precision_at_10 value: 5.344 - type: precision_at_100 value: 0.958 - type: precision_at_1000 value: 0.13799999999999998 - type: precision_at_3 value: 11.918 - type: precision_at_5 value: 8.596 - type: recall_at_1 value: 17.256 - type: recall_at_10 value: 39.644 - type: recall_at_100 value: 65.279 - type: recall_at_1000 value: 85.693 - type: recall_at_3 value: 27.825 - type: recall_at_5 value: 32.792 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackUnixRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 26.700000000000003 - type: map_at_10 value: 36.205999999999996 - type: map_at_100 value: 37.316 - type: map_at_1000 value: 37.425000000000004 - type: map_at_3 value: 33.166000000000004 - type: map_at_5 value: 35.032999999999994 - type: mrr_at_1 value: 31.436999999999998 - type: mrr_at_10 value: 40.61 - type: mrr_at_100 value: 41.415 - type: mrr_at_1000 value: 41.48 - type: mrr_at_3 value: 37.966 - type: mrr_at_5 value: 39.599000000000004 - type: ndcg_at_1 value: 31.436999999999998 - type: ndcg_at_10 value: 41.771 - type: ndcg_at_100 value: 46.784 - type: ndcg_at_1000 value: 49.183 - type: ndcg_at_3 value: 36.437000000000005 - type: ndcg_at_5 value: 39.291 - type: precision_at_1 value: 31.436999999999998 - type: precision_at_10 value: 6.987 - type: precision_at_100 value: 1.072 - type: precision_at_1000 value: 0.13899999999999998 - type: precision_at_3 value: 16.448999999999998 - type: precision_at_5 value: 11.866 - type: recall_at_1 value: 26.700000000000003 - type: recall_at_10 value: 54.301 - type: recall_at_100 value: 75.871 - type: recall_at_1000 value: 92.529 - type: recall_at_3 value: 40.201 - type: recall_at_5 value: 47.208 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWebmastersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 24.296 - type: map_at_10 value: 33.116 - type: map_at_100 value: 34.81 - type: map_at_1000 value: 35.032000000000004 - type: map_at_3 value: 30.105999999999998 - type: map_at_5 value: 31.839000000000002 - type: mrr_at_1 value: 29.051 - type: mrr_at_10 value: 37.803 - type: mrr_at_100 value: 38.856 - type: mrr_at_1000 value: 38.903999999999996 - type: mrr_at_3 value: 35.211 - type: mrr_at_5 value: 36.545 - type: ndcg_at_1 value: 29.051 - type: ndcg_at_10 value: 39.007 - type: ndcg_at_100 value: 45.321 - type: ndcg_at_1000 value: 47.665 - type: ndcg_at_3 value: 34.1 - type: ndcg_at_5 value: 36.437000000000005 - type: precision_at_1 value: 29.051 - type: precision_at_10 value: 7.668 - type: precision_at_100 value: 1.542 - type: precision_at_1000 value: 0.24 - type: precision_at_3 value: 16.14 - type: precision_at_5 value: 11.897 - type: recall_at_1 value: 24.296 - type: recall_at_10 value: 49.85 - type: recall_at_100 value: 78.457 - type: recall_at_1000 value: 92.618 - type: recall_at_3 value: 36.138999999999996 - type: recall_at_5 value: 42.223 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWordpressRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 20.591 - type: map_at_10 value: 28.902 - type: map_at_100 value: 29.886000000000003 - type: map_at_1000 value: 29.987000000000002 - type: map_at_3 value: 26.740000000000002 - type: map_at_5 value: 27.976 - type: mrr_at_1 value: 22.366 - type: mrr_at_10 value: 30.971 - type: mrr_at_100 value: 31.865 - type: mrr_at_1000 value: 31.930999999999997 - type: mrr_at_3 value: 28.927999999999997 - type: mrr_at_5 value: 30.231 - type: ndcg_at_1 value: 22.366 - type: ndcg_at_10 value: 33.641 - type: ndcg_at_100 value: 38.477 - type: ndcg_at_1000 value: 41.088 - type: ndcg_at_3 value: 29.486 - type: ndcg_at_5 value: 31.612000000000002 - type: precision_at_1 value: 22.366 - type: precision_at_10 value: 5.3420000000000005 - type: precision_at_100 value: 0.828 - type: precision_at_1000 value: 0.11800000000000001 - type: precision_at_3 value: 12.939 - type: precision_at_5 value: 9.094 - type: recall_at_1 value: 20.591 - type: recall_at_10 value: 46.052 - type: recall_at_100 value: 68.193 - type: recall_at_1000 value: 87.638 - type: recall_at_3 value: 34.966 - type: recall_at_5 value: 40.082 - task: type: Retrieval dataset: type: climate-fever name: MTEB ClimateFEVER config: default split: test revision: None metrics: - type: map_at_1 value: 15.091 - type: map_at_10 value: 26.38 - type: map_at_100 value: 28.421999999999997 - type: map_at_1000 value: 28.621999999999996 - type: map_at_3 value: 21.597 - type: map_at_5 value: 24.12 - type: mrr_at_1 value: 34.266999999999996 - type: mrr_at_10 value: 46.864 - type: mrr_at_100 value: 47.617 - type: mrr_at_1000 value: 47.644 - type: mrr_at_3 value: 43.312 - type: mrr_at_5 value: 45.501000000000005 - type: ndcg_at_1 value: 34.266999999999996 - type: ndcg_at_10 value: 36.095 - type: ndcg_at_100 value: 43.447 - type: ndcg_at_1000 value: 46.661 - type: ndcg_at_3 value: 29.337999999999997 - type: ndcg_at_5 value: 31.824 - type: precision_at_1 value: 34.266999999999996 - type: precision_at_10 value: 11.472 - type: precision_at_100 value: 1.944 - type: precision_at_1000 value: 0.255 - type: precision_at_3 value: 21.933 - type: precision_at_5 value: 17.224999999999998 - type: recall_at_1 value: 15.091 - type: recall_at_10 value: 43.022 - type: recall_at_100 value: 68.075 - type: recall_at_1000 value: 85.76 - type: recall_at_3 value: 26.564 - type: recall_at_5 value: 33.594 - task: type: Retrieval dataset: type: dbpedia-entity name: MTEB DBPedia config: default split: test revision: None metrics: - type: map_at_1 value: 9.252 - type: map_at_10 value: 20.923 - type: map_at_100 value: 30.741000000000003 - type: map_at_1000 value: 32.542 - type: map_at_3 value: 14.442 - type: map_at_5 value: 17.399 - type: mrr_at_1 value: 70.25 - type: mrr_at_10 value: 78.17 - type: mrr_at_100 value: 78.444 - type: mrr_at_1000 value: 78.45100000000001 - type: mrr_at_3 value: 76.958 - type: mrr_at_5 value: 77.571 - type: ndcg_at_1 value: 58.375 - type: ndcg_at_10 value: 44.509 - type: ndcg_at_100 value: 49.897999999999996 - type: ndcg_at_1000 value: 57.269999999999996 - type: ndcg_at_3 value: 48.64 - type: ndcg_at_5 value: 46.697 - type: precision_at_1 value: 70.25 - type: precision_at_10 value: 36.05 - type: precision_at_100 value: 11.848 - type: precision_at_1000 value: 2.213 - type: precision_at_3 value: 52.917 - type: precision_at_5 value: 45.7 - type: recall_at_1 value: 9.252 - type: recall_at_10 value: 27.006999999999998 - type: recall_at_100 value: 57.008 - type: recall_at_1000 value: 80.697 - type: recall_at_3 value: 15.798000000000002 - type: recall_at_5 value: 20.4 - task: type: Classification dataset: type: mteb/emotion name: MTEB EmotionClassification config: default split: test revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 metrics: - type: accuracy value: 50.88 - type: f1 value: 45.545495028653384 - task: type: Retrieval dataset: type: fever name: MTEB FEVER config: default split: test revision: None metrics: - type: map_at_1 value: 75.424 - type: map_at_10 value: 83.435 - type: map_at_100 value: 83.66900000000001 - type: map_at_1000 value: 83.685 - type: map_at_3 value: 82.39800000000001 - type: map_at_5 value: 83.07 - type: mrr_at_1 value: 81.113 - type: mrr_at_10 value: 87.77199999999999 - type: mrr_at_100 value: 87.862 - type: mrr_at_1000 value: 87.86500000000001 - type: mrr_at_3 value: 87.17099999999999 - type: mrr_at_5 value: 87.616 - type: ndcg_at_1 value: 81.113 - type: ndcg_at_10 value: 86.909 - type: ndcg_at_100 value: 87.746 - type: ndcg_at_1000 value: 88.017 - type: ndcg_at_3 value: 85.368 - type: ndcg_at_5 value: 86.28099999999999 - type: precision_at_1 value: 81.113 - type: precision_at_10 value: 10.363 - type: precision_at_100 value: 1.102 - type: precision_at_1000 value: 0.11399999999999999 - type: precision_at_3 value: 32.507999999999996 - type: precision_at_5 value: 20.138 - type: recall_at_1 value: 75.424 - type: recall_at_10 value: 93.258 - type: recall_at_100 value: 96.545 - type: recall_at_1000 value: 98.284 - type: recall_at_3 value: 89.083 - type: recall_at_5 value: 91.445 - task: type: Retrieval dataset: type: fiqa name: MTEB FiQA2018 config: default split: test revision: None metrics: - type: map_at_1 value: 22.532 - type: map_at_10 value: 37.141999999999996 - type: map_at_100 value: 39.162 - type: map_at_1000 value: 39.322 - type: map_at_3 value: 32.885 - type: map_at_5 value: 35.093999999999994 - type: mrr_at_1 value: 44.29 - type: mrr_at_10 value: 53.516 - type: mrr_at_100 value: 54.24 - type: mrr_at_1000 value: 54.273 - type: mrr_at_3 value: 51.286 - type: mrr_at_5 value: 52.413 - type: ndcg_at_1 value: 44.29 - type: ndcg_at_10 value: 45.268 - type: ndcg_at_100 value: 52.125 - type: ndcg_at_1000 value: 54.778000000000006 - type: ndcg_at_3 value: 41.829 - type: ndcg_at_5 value: 42.525 - type: precision_at_1 value: 44.29 - type: precision_at_10 value: 12.5 - type: precision_at_100 value: 1.9720000000000002 - type: precision_at_1000 value: 0.245 - type: precision_at_3 value: 28.035 - type: precision_at_5 value: 20.093 - type: recall_at_1 value: 22.532 - type: recall_at_10 value: 52.419000000000004 - type: recall_at_100 value: 77.43299999999999 - type: recall_at_1000 value: 93.379 - type: recall_at_3 value: 38.629000000000005 - type: recall_at_5 value: 43.858000000000004 - task: type: Retrieval dataset: type: hotpotqa name: MTEB HotpotQA config: default split: test revision: None metrics: - type: map_at_1 value: 39.359 - type: map_at_10 value: 63.966 - type: map_at_100 value: 64.87 - type: map_at_1000 value: 64.92599999999999 - type: map_at_3 value: 60.409 - type: map_at_5 value: 62.627 - type: mrr_at_1 value: 78.717 - type: mrr_at_10 value: 84.468 - type: mrr_at_100 value: 84.655 - type: mrr_at_1000 value: 84.661 - type: mrr_at_3 value: 83.554 - type: mrr_at_5 value: 84.133 - type: ndcg_at_1 value: 78.717 - type: ndcg_at_10 value: 72.03399999999999 - type: ndcg_at_100 value: 75.158 - type: ndcg_at_1000 value: 76.197 - type: ndcg_at_3 value: 67.049 - type: ndcg_at_5 value: 69.808 - type: precision_at_1 value: 78.717 - type: precision_at_10 value: 15.201 - type: precision_at_100 value: 1.764 - type: precision_at_1000 value: 0.19 - type: precision_at_3 value: 43.313 - type: precision_at_5 value: 28.165000000000003 - type: recall_at_1 value: 39.359 - type: recall_at_10 value: 76.003 - type: recall_at_100 value: 88.197 - type: recall_at_1000 value: 95.003 - type: recall_at_3 value: 64.97 - type: recall_at_5 value: 70.41199999999999 - task: type: Classification dataset: type: mteb/imdb name: MTEB ImdbClassification config: default split: test revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 metrics: - type: accuracy value: 92.83200000000001 - type: ap value: 89.33560571859861 - type: f1 value: 92.82322915005167 - task: type: Retrieval dataset: type: msmarco name: MTEB MSMARCO config: default split: dev revision: None metrics: - type: map_at_1 value: 21.983 - type: map_at_10 value: 34.259 - type: map_at_100 value: 35.432 - type: map_at_1000 value: 35.482 - type: map_at_3 value: 30.275999999999996 - type: map_at_5 value: 32.566 - type: mrr_at_1 value: 22.579 - type: mrr_at_10 value: 34.882999999999996 - type: mrr_at_100 value: 35.984 - type: mrr_at_1000 value: 36.028 - type: mrr_at_3 value: 30.964999999999996 - type: mrr_at_5 value: 33.245000000000005 - type: ndcg_at_1 value: 22.564 - type: ndcg_at_10 value: 41.258 - type: ndcg_at_100 value: 46.824 - type: ndcg_at_1000 value: 48.037 - type: ndcg_at_3 value: 33.17 - type: ndcg_at_5 value: 37.263000000000005 - type: precision_at_1 value: 22.564 - type: precision_at_10 value: 6.572 - type: precision_at_100 value: 0.935 - type: precision_at_1000 value: 0.104 - type: precision_at_3 value: 14.130999999999998 - type: precision_at_5 value: 10.544 - type: recall_at_1 value: 21.983 - type: recall_at_10 value: 62.775000000000006 - type: recall_at_100 value: 88.389 - type: recall_at_1000 value: 97.603 - type: recall_at_3 value: 40.878 - type: recall_at_5 value: 50.690000000000005 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (en) config: en split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 93.95120839033288 - type: f1 value: 93.73824125055208 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (en) config: en split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 76.78978568171455 - type: f1 value: 57.50180552858304 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (en) config: en split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 76.24411566913248 - type: f1 value: 74.37851403532832 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (en) config: en split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 79.94620040349699 - type: f1 value: 80.21293397970435 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-p2p name: MTEB MedrxivClusteringP2P config: default split: test revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 metrics: - type: v_measure value: 33.44403096245675 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-s2s name: MTEB MedrxivClusteringS2S config: default split: test revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 metrics: - type: v_measure value: 31.659594631336812 - task: type: Reranking dataset: type: mteb/mind_small name: MTEB MindSmallReranking config: default split: test revision: 3bdac13927fdc888b903db93b2ffdbd90b295a69 metrics: - type: map value: 32.53833075108798 - type: mrr value: 33.78840823218308 - task: type: Retrieval dataset: type: nfcorpus name: MTEB NFCorpus config: default split: test revision: None metrics: - type: map_at_1 value: 7.185999999999999 - type: map_at_10 value: 15.193999999999999 - type: map_at_100 value: 19.538 - type: map_at_1000 value: 21.178 - type: map_at_3 value: 11.208 - type: map_at_5 value: 12.745999999999999 - type: mrr_at_1 value: 48.916 - type: mrr_at_10 value: 58.141 - type: mrr_at_100 value: 58.656 - type: mrr_at_1000 value: 58.684999999999995 - type: mrr_at_3 value: 55.521 - type: mrr_at_5 value: 57.239 - type: ndcg_at_1 value: 47.059 - type: ndcg_at_10 value: 38.644 - type: ndcg_at_100 value: 36.272999999999996 - type: ndcg_at_1000 value: 44.996 - type: ndcg_at_3 value: 43.293 - type: ndcg_at_5 value: 40.819 - type: precision_at_1 value: 48.916 - type: precision_at_10 value: 28.607 - type: precision_at_100 value: 9.195 - type: precision_at_1000 value: 2.225 - type: precision_at_3 value: 40.454 - type: precision_at_5 value: 34.985 - type: recall_at_1 value: 7.185999999999999 - type: recall_at_10 value: 19.654 - type: recall_at_100 value: 37.224000000000004 - type: recall_at_1000 value: 68.663 - type: recall_at_3 value: 12.158 - type: recall_at_5 value: 14.674999999999999 - task: type: Retrieval dataset: type: nq name: MTEB NQ config: default split: test revision: None metrics: - type: map_at_1 value: 31.552000000000003 - type: map_at_10 value: 47.75 - type: map_at_100 value: 48.728 - type: map_at_1000 value: 48.754 - type: map_at_3 value: 43.156 - type: map_at_5 value: 45.883 - type: mrr_at_1 value: 35.66 - type: mrr_at_10 value: 50.269 - type: mrr_at_100 value: 50.974 - type: mrr_at_1000 value: 50.991 - type: mrr_at_3 value: 46.519 - type: mrr_at_5 value: 48.764 - type: ndcg_at_1 value: 35.632000000000005 - type: ndcg_at_10 value: 55.786 - type: ndcg_at_100 value: 59.748999999999995 - type: ndcg_at_1000 value: 60.339 - type: ndcg_at_3 value: 47.292 - type: ndcg_at_5 value: 51.766999999999996 - type: precision_at_1 value: 35.632000000000005 - type: precision_at_10 value: 9.267 - type: precision_at_100 value: 1.149 - type: precision_at_1000 value: 0.12 - type: precision_at_3 value: 21.601 - type: precision_at_5 value: 15.539 - type: recall_at_1 value: 31.552000000000003 - type: recall_at_10 value: 77.62400000000001 - type: recall_at_100 value: 94.527 - type: recall_at_1000 value: 98.919 - type: recall_at_3 value: 55.898 - type: recall_at_5 value: 66.121 - task: type: Retrieval dataset: type: quora name: MTEB QuoraRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 71.414 - type: map_at_10 value: 85.37400000000001 - type: map_at_100 value: 86.01100000000001 - type: map_at_1000 value: 86.027 - type: map_at_3 value: 82.562 - type: map_at_5 value: 84.284 - type: mrr_at_1 value: 82.24000000000001 - type: mrr_at_10 value: 88.225 - type: mrr_at_100 value: 88.324 - type: mrr_at_1000 value: 88.325 - type: mrr_at_3 value: 87.348 - type: mrr_at_5 value: 87.938 - type: ndcg_at_1 value: 82.24000000000001 - type: ndcg_at_10 value: 88.97699999999999 - type: ndcg_at_100 value: 90.16 - type: ndcg_at_1000 value: 90.236 - type: ndcg_at_3 value: 86.371 - type: ndcg_at_5 value: 87.746 - type: precision_at_1 value: 82.24000000000001 - type: precision_at_10 value: 13.481000000000002 - type: precision_at_100 value: 1.534 - type: precision_at_1000 value: 0.157 - type: precision_at_3 value: 37.86 - type: precision_at_5 value: 24.738 - type: recall_at_1 value: 71.414 - type: recall_at_10 value: 95.735 - type: recall_at_100 value: 99.696 - type: recall_at_1000 value: 99.979 - type: recall_at_3 value: 88.105 - type: recall_at_5 value: 92.17999999999999 - task: type: Clustering dataset: type: mteb/reddit-clustering name: MTEB RedditClustering config: default split: test revision: 24640382cdbf8abc73003fb0fa6d111a705499eb metrics: - type: v_measure value: 60.22146692057259 - task: type: Clustering dataset: type: mteb/reddit-clustering-p2p name: MTEB RedditClusteringP2P config: default split: test revision: 282350215ef01743dc01b456c7f5241fa8937f16 metrics: - type: v_measure value: 65.29273320614578 - task: type: Retrieval dataset: type: scidocs name: MTEB SCIDOCS config: default split: test revision: None metrics: - type: map_at_1 value: 5.023 - type: map_at_10 value: 14.161000000000001 - type: map_at_100 value: 16.68 - type: map_at_1000 value: 17.072000000000003 - type: map_at_3 value: 9.763 - type: map_at_5 value: 11.977 - type: mrr_at_1 value: 24.8 - type: mrr_at_10 value: 37.602999999999994 - type: mrr_at_100 value: 38.618 - type: mrr_at_1000 value: 38.659 - type: mrr_at_3 value: 34.117 - type: mrr_at_5 value: 36.082 - type: ndcg_at_1 value: 24.8 - type: ndcg_at_10 value: 23.316 - type: ndcg_at_100 value: 32.613 - type: ndcg_at_1000 value: 38.609 - type: ndcg_at_3 value: 21.697 - type: ndcg_at_5 value: 19.241 - type: precision_at_1 value: 24.8 - type: precision_at_10 value: 12.36 - type: precision_at_100 value: 2.593 - type: precision_at_1000 value: 0.402 - type: precision_at_3 value: 20.767 - type: precision_at_5 value: 17.34 - type: recall_at_1 value: 5.023 - type: recall_at_10 value: 25.069999999999997 - type: recall_at_100 value: 52.563 - type: recall_at_1000 value: 81.525 - type: recall_at_3 value: 12.613 - type: recall_at_5 value: 17.583 - task: type: STS dataset: type: mteb/sickr-sts name: MTEB SICK-R config: default split: test revision: a6ea5a8cab320b040a23452cc28066d9beae2cee metrics: - type: cos_sim_pearson value: 87.71506247604255 - type: cos_sim_spearman value: 82.91813463738802 - type: euclidean_pearson value: 85.5154616194479 - type: euclidean_spearman value: 82.91815254466314 - type: manhattan_pearson value: 85.5280917850374 - type: manhattan_spearman value: 82.92276537286398 - task: type: STS dataset: type: mteb/sts12-sts name: MTEB STS12 config: default split: test revision: a0d554a64d88156834ff5ae9920b964011b16384 metrics: - type: cos_sim_pearson value: 87.43772054228462 - type: cos_sim_spearman value: 78.75750601716682 - type: euclidean_pearson value: 85.76074482955764 - type: euclidean_spearman value: 78.75651057223058 - type: manhattan_pearson value: 85.73390291701668 - type: manhattan_spearman value: 78.72699385957797 - task: type: STS dataset: type: mteb/sts13-sts name: MTEB STS13 config: default split: test revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca metrics: - type: cos_sim_pearson value: 89.58144067172472 - type: cos_sim_spearman value: 90.3524512966946 - type: euclidean_pearson value: 89.71365391594237 - type: euclidean_spearman value: 90.35239632843408 - type: manhattan_pearson value: 89.66905421746478 - type: manhattan_spearman value: 90.31508211683513 - task: type: STS dataset: type: mteb/sts14-sts name: MTEB STS14 config: default split: test revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 metrics: - type: cos_sim_pearson value: 87.77692637102102 - type: cos_sim_spearman value: 85.45710562643485 - type: euclidean_pearson value: 87.42456979928723 - type: euclidean_spearman value: 85.45709386240908 - type: manhattan_pearson value: 87.40754529526272 - type: manhattan_spearman value: 85.44834854173303 - task: type: STS dataset: type: mteb/sts15-sts name: MTEB STS15 config: default split: test revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 metrics: - type: cos_sim_pearson value: 88.28491331695997 - type: cos_sim_spearman value: 89.62037029566964 - type: euclidean_pearson value: 89.02479391362826 - type: euclidean_spearman value: 89.62036733618466 - type: manhattan_pearson value: 89.00394756040342 - type: manhattan_spearman value: 89.60867744215236 - task: type: STS dataset: type: mteb/sts16-sts name: MTEB STS16 config: default split: test revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 metrics: - type: cos_sim_pearson value: 85.08911381280191 - type: cos_sim_spearman value: 86.5791780765767 - type: euclidean_pearson value: 86.16063473577861 - type: euclidean_spearman value: 86.57917745378766 - type: manhattan_pearson value: 86.13677924604175 - type: manhattan_spearman value: 86.56115615768685 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-en) config: en-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 89.58029496205235 - type: cos_sim_spearman value: 89.49551253826998 - type: euclidean_pearson value: 90.13714840963748 - type: euclidean_spearman value: 89.49551253826998 - type: manhattan_pearson value: 90.13039633601363 - type: manhattan_spearman value: 89.4513453745516 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (en) config: en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 69.01546399666435 - type: cos_sim_spearman value: 69.33824484595624 - type: euclidean_pearson value: 70.76511642998874 - type: euclidean_spearman value: 69.33824484595624 - type: manhattan_pearson value: 70.84320785047453 - type: manhattan_spearman value: 69.54233632223537 - task: type: STS dataset: type: mteb/stsbenchmark-sts name: MTEB STSBenchmark config: default split: test revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 metrics: - type: cos_sim_pearson value: 87.26389196390119 - type: cos_sim_spearman value: 89.09721478341385 - type: euclidean_pearson value: 88.97208685922517 - type: euclidean_spearman value: 89.09720927308881 - type: manhattan_pearson value: 88.97513670502573 - type: manhattan_spearman value: 89.07647853984004 - task: type: Reranking dataset: type: mteb/scidocs-reranking name: MTEB SciDocsRR config: default split: test revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab metrics: - type: map value: 87.53075025771936 - type: mrr value: 96.24327651288436 - task: type: Retrieval dataset: type: scifact name: MTEB SciFact config: default split: test revision: None metrics: - type: map_at_1 value: 60.428000000000004 - type: map_at_10 value: 70.088 - type: map_at_100 value: 70.589 - type: map_at_1000 value: 70.614 - type: map_at_3 value: 67.191 - type: map_at_5 value: 68.515 - type: mrr_at_1 value: 63.333 - type: mrr_at_10 value: 71.13000000000001 - type: mrr_at_100 value: 71.545 - type: mrr_at_1000 value: 71.569 - type: mrr_at_3 value: 68.944 - type: mrr_at_5 value: 70.078 - type: ndcg_at_1 value: 63.333 - type: ndcg_at_10 value: 74.72800000000001 - type: ndcg_at_100 value: 76.64999999999999 - type: ndcg_at_1000 value: 77.176 - type: ndcg_at_3 value: 69.659 - type: ndcg_at_5 value: 71.626 - type: precision_at_1 value: 63.333 - type: precision_at_10 value: 10 - type: precision_at_100 value: 1.09 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 27.111 - type: precision_at_5 value: 17.666999999999998 - type: recall_at_1 value: 60.428000000000004 - type: recall_at_10 value: 87.98899999999999 - type: recall_at_100 value: 96.167 - type: recall_at_1000 value: 100 - type: recall_at_3 value: 74.006 - type: recall_at_5 value: 79.05 - task: type: PairClassification dataset: type: mteb/sprintduplicatequestions-pairclassification name: MTEB SprintDuplicateQuestions config: default split: test revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 metrics: - type: cos_sim_accuracy value: 99.87326732673267 - type: cos_sim_ap value: 96.81770773701805 - type: cos_sim_f1 value: 93.6318407960199 - type: cos_sim_precision value: 93.16831683168317 - type: cos_sim_recall value: 94.1 - type: dot_accuracy value: 99.87326732673267 - type: dot_ap value: 96.8174218946665 - type: dot_f1 value: 93.6318407960199 - type: dot_precision value: 93.16831683168317 - type: dot_recall value: 94.1 - type: euclidean_accuracy value: 99.87326732673267 - type: euclidean_ap value: 96.81770773701807 - type: euclidean_f1 value: 93.6318407960199 - type: euclidean_precision value: 93.16831683168317 - type: euclidean_recall value: 94.1 - type: manhattan_accuracy value: 99.87227722772278 - type: manhattan_ap value: 96.83164126821747 - type: manhattan_f1 value: 93.54677338669335 - type: manhattan_precision value: 93.5935935935936 - type: manhattan_recall value: 93.5 - type: max_accuracy value: 99.87326732673267 - type: max_ap value: 96.83164126821747 - type: max_f1 value: 93.6318407960199 - task: type: Clustering dataset: type: mteb/stackexchange-clustering name: MTEB StackExchangeClustering config: default split: test revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 metrics: - type: v_measure value: 65.6212042420246 - task: type: Clustering dataset: type: mteb/stackexchange-clustering-p2p name: MTEB StackExchangeClusteringP2P config: default split: test revision: 815ca46b2622cec33ccafc3735d572c266efdb44 metrics: - type: v_measure value: 35.779230635982564 - task: type: Reranking dataset: type: mteb/stackoverflowdupquestions-reranking name: MTEB StackOverflowDupQuestions config: default split: test revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 metrics: - type: map value: 55.217701909036286 - type: mrr value: 56.17658995416349 - task: type: Summarization dataset: type: mteb/summeval name: MTEB SummEval config: default split: test revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c metrics: - type: cos_sim_pearson value: 30.954206018888453 - type: cos_sim_spearman value: 32.71062599450096 - type: dot_pearson value: 30.95420929056943 - type: dot_spearman value: 32.71062599450096 - task: type: Retrieval dataset: type: trec-covid name: MTEB TRECCOVID config: default split: test revision: None metrics: - type: map_at_1 value: 0.22699999999999998 - type: map_at_10 value: 1.924 - type: map_at_100 value: 10.525 - type: map_at_1000 value: 24.973 - type: map_at_3 value: 0.638 - type: map_at_5 value: 1.0659999999999998 - type: mrr_at_1 value: 84 - type: mrr_at_10 value: 91.067 - type: mrr_at_100 value: 91.067 - type: mrr_at_1000 value: 91.067 - type: mrr_at_3 value: 90.667 - type: mrr_at_5 value: 91.067 - type: ndcg_at_1 value: 81 - type: ndcg_at_10 value: 75.566 - type: ndcg_at_100 value: 56.387 - type: ndcg_at_1000 value: 49.834 - type: ndcg_at_3 value: 80.899 - type: ndcg_at_5 value: 80.75099999999999 - type: precision_at_1 value: 84 - type: precision_at_10 value: 79 - type: precision_at_100 value: 57.56 - type: precision_at_1000 value: 21.8 - type: precision_at_3 value: 84.667 - type: precision_at_5 value: 85.2 - type: recall_at_1 value: 0.22699999999999998 - type: recall_at_10 value: 2.136 - type: recall_at_100 value: 13.861 - type: recall_at_1000 value: 46.299 - type: recall_at_3 value: 0.6649999999999999 - type: recall_at_5 value: 1.145 - task: type: Retrieval dataset: type: webis-touche2020 name: MTEB Touche2020 config: default split: test revision: None metrics: - type: map_at_1 value: 2.752 - type: map_at_10 value: 9.951 - type: map_at_100 value: 16.794999999999998 - type: map_at_1000 value: 18.251 - type: map_at_3 value: 5.288 - type: map_at_5 value: 6.954000000000001 - type: mrr_at_1 value: 38.775999999999996 - type: mrr_at_10 value: 50.458000000000006 - type: mrr_at_100 value: 51.324999999999996 - type: mrr_at_1000 value: 51.339999999999996 - type: mrr_at_3 value: 46.939 - type: mrr_at_5 value: 47.857 - type: ndcg_at_1 value: 36.735 - type: ndcg_at_10 value: 25.198999999999998 - type: ndcg_at_100 value: 37.938 - type: ndcg_at_1000 value: 49.145 - type: ndcg_at_3 value: 29.348000000000003 - type: ndcg_at_5 value: 25.804 - type: precision_at_1 value: 38.775999999999996 - type: precision_at_10 value: 22.041 - type: precision_at_100 value: 7.939 - type: precision_at_1000 value: 1.555 - type: precision_at_3 value: 29.932 - type: precision_at_5 value: 24.490000000000002 - type: recall_at_1 value: 2.752 - type: recall_at_10 value: 16.197 - type: recall_at_100 value: 49.166 - type: recall_at_1000 value: 84.18900000000001 - type: recall_at_3 value: 6.438000000000001 - type: recall_at_5 value: 9.093 - task: type: Classification dataset: type: mteb/toxic_conversations_50k name: MTEB ToxicConversationsClassification config: default split: test revision: d7c0de2777da35d6aae2200a62c6e0e5af397c4c metrics: - type: accuracy value: 71.47980000000001 - type: ap value: 14.605194452178754 - type: f1 value: 55.07362924988948 - task: type: Classification dataset: type: mteb/tweet_sentiment_extraction name: MTEB TweetSentimentExtractionClassification config: default split: test revision: d604517c81ca91fe16a244d1248fc021f9ecee7a metrics: - type: accuracy value: 59.708545557441994 - type: f1 value: 60.04751270975683 - task: type: Clustering dataset: type: mteb/twentynewsgroups-clustering name: MTEB TwentyNewsgroupsClustering config: default split: test revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 metrics: - type: v_measure value: 53.21105960597211 - task: type: PairClassification dataset: type: mteb/twittersemeval2015-pairclassification name: MTEB TwitterSemEval2015 config: default split: test revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 metrics: - type: cos_sim_accuracy value: 87.58419264469214 - type: cos_sim_ap value: 78.55300004517404 - type: cos_sim_f1 value: 71.49673530889001 - type: cos_sim_precision value: 68.20795400095831 - type: cos_sim_recall value: 75.11873350923483 - type: dot_accuracy value: 87.58419264469214 - type: dot_ap value: 78.55297659559511 - type: dot_f1 value: 71.49673530889001 - type: dot_precision value: 68.20795400095831 - type: dot_recall value: 75.11873350923483 - type: euclidean_accuracy value: 87.58419264469214 - type: euclidean_ap value: 78.55300477331477 - type: euclidean_f1 value: 71.49673530889001 - type: euclidean_precision value: 68.20795400095831 - type: euclidean_recall value: 75.11873350923483 - type: manhattan_accuracy value: 87.5663110210407 - type: manhattan_ap value: 78.49982050876562 - type: manhattan_f1 value: 71.35488740722104 - type: manhattan_precision value: 68.18946862226497 - type: manhattan_recall value: 74.82849604221636 - type: max_accuracy value: 87.58419264469214 - type: max_ap value: 78.55300477331477 - type: max_f1 value: 71.49673530889001 - task: type: PairClassification dataset: type: mteb/twitterurlcorpus-pairclassification name: MTEB TwitterURLCorpus config: default split: test revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf metrics: - type: cos_sim_accuracy value: 89.09069740365584 - type: cos_sim_ap value: 86.22749303724757 - type: cos_sim_f1 value: 78.36863452005407 - type: cos_sim_precision value: 76.49560117302053 - type: cos_sim_recall value: 80.33569448721897 - type: dot_accuracy value: 89.09069740365584 - type: dot_ap value: 86.22750233655673 - type: dot_f1 value: 78.36863452005407 - type: dot_precision value: 76.49560117302053 - type: dot_recall value: 80.33569448721897 - type: euclidean_accuracy value: 89.09069740365584 - type: euclidean_ap value: 86.22749355597347 - type: euclidean_f1 value: 78.36863452005407 - type: euclidean_precision value: 76.49560117302053 - type: euclidean_recall value: 80.33569448721897 - type: manhattan_accuracy value: 89.08293553770326 - type: manhattan_ap value: 86.21913616084771 - type: manhattan_f1 value: 78.3907031479847 - type: manhattan_precision value: 75.0352013517319 - type: manhattan_recall value: 82.06036341238065 - type: max_accuracy value: 89.09069740365584 - type: max_ap value: 86.22750233655673 - type: max_f1 value: 78.3907031479847 license: apache-2.0 language: - en library_name: sentence-transformers pipeline_tag: feature-extraction --- <br><br> <p align="center"> <svg xmlns="http://www.w3.org/2000/svg" xml:space="preserve" viewBox="0 0 2020 1130" width="150" height="150" aria-hidden="true"><path fill="#e95a0f" d="M398.167 621.992c-1.387-20.362-4.092-40.739-3.851-61.081.355-30.085 6.873-59.139 21.253-85.976 10.487-19.573 24.09-36.822 40.662-51.515 16.394-14.535 34.338-27.046 54.336-36.182 15.224-6.955 31.006-12.609 47.829-14.168 11.809-1.094 23.753-2.514 35.524-1.836 23.033 1.327 45.131 7.255 66.255 16.75 16.24 7.3 31.497 16.165 45.651 26.969 12.997 9.921 24.412 21.37 34.158 34.509 11.733 15.817 20.849 33.037 25.987 52.018 3.468 12.81 6.438 25.928 7.779 39.097 1.722 16.908 1.642 34.003 2.235 51.021.427 12.253.224 24.547 1.117 36.762 1.677 22.93 4.062 45.764 11.8 67.7 5.376 15.239 12.499 29.55 20.846 43.681l-18.282 20.328c-1.536 1.71-2.795 3.665-4.254 5.448l-19.323 23.533c-13.859-5.449-27.446-11.803-41.657-16.086-13.622-4.106-27.793-6.765-41.905-8.775-15.256-2.173-30.701-3.475-46.105-4.049-23.571-.879-47.178-1.056-70.769-1.029-10.858.013-21.723 1.116-32.57 1.926-5.362.4-10.69 1.255-16.464 1.477-2.758-7.675-5.284-14.865-7.367-22.181-3.108-10.92-4.325-22.554-13.16-31.095-2.598-2.512-5.069-5.341-6.883-8.443-6.366-10.884-12.48-21.917-18.571-32.959-4.178-7.573-8.411-14.375-17.016-18.559-10.34-5.028-19.538-12.387-29.311-18.611-3.173-2.021-6.414-4.312-9.952-5.297-5.857-1.63-11.98-2.301-17.991-3.376z"></path><path fill="#ed6d7b" d="M1478.998 758.842c-12.025.042-24.05.085-36.537-.373-.14-8.536.231-16.569.453-24.607.033-1.179-.315-2.986-1.081-3.4-.805-.434-2.376.338-3.518.81-.856.354-1.562 1.069-3.589 2.521-.239-3.308-.664-5.586-.519-7.827.488-7.544 2.212-15.166 1.554-22.589-1.016-11.451 1.397-14.592-12.332-14.419-3.793.048-3.617-2.803-3.332-5.331.499-4.422 1.45-8.803 1.77-13.233.311-4.316.068-8.672.068-12.861-2.554-.464-4.326-.86-6.12-1.098-4.415-.586-6.051-2.251-5.065-7.31 1.224-6.279.848-12.862 1.276-19.306.19-2.86-.971-4.473-3.794-4.753-4.113-.407-8.242-1.057-12.352-.975-4.663.093-5.192-2.272-4.751-6.012.733-6.229 1.252-12.483 1.875-18.726l1.102-10.495c-5.905-.309-11.146-.805-16.385-.778-3.32.017-5.174-1.4-5.566-4.4-1.172-8.968-2.479-17.944-3.001-26.96-.26-4.484-1.936-5.705-6.005-5.774-9.284-.158-18.563-.594-27.843-.953-7.241-.28-10.137-2.764-11.3-9.899-.746-4.576-2.715-7.801-7.777-8.207-7.739-.621-15.511-.992-23.207-1.961-7.327-.923-14.587-2.415-21.853-3.777-5.021-.941-10.003-2.086-15.003-3.14 4.515-22.952 13.122-44.382 26.284-63.587 18.054-26.344 41.439-47.239 69.102-63.294 15.847-9.197 32.541-16.277 50.376-20.599 16.655-4.036 33.617-5.715 50.622-4.385 33.334 2.606 63.836 13.955 92.415 31.15 15.864 9.545 30.241 20.86 42.269 34.758 8.113 9.374 15.201 19.78 21.718 30.359 10.772 17.484 16.846 36.922 20.611 56.991 1.783 9.503 2.815 19.214 3.318 28.876.758 14.578.755 29.196.65 44.311l-51.545 20.013c-7.779 3.059-15.847 5.376-21.753 12.365-4.73 5.598-10.658 10.316-16.547 14.774-9.9 7.496-18.437 15.988-25.083 26.631-3.333 5.337-7.901 10.381-12.999 14.038-11.355 8.144-17.397 18.973-19.615 32.423l-6.988 41.011z"></path><path fill="#ec663e" d="M318.11 923.047c-.702 17.693-.832 35.433-2.255 53.068-1.699 21.052-6.293 41.512-14.793 61.072-9.001 20.711-21.692 38.693-38.496 53.583-16.077 14.245-34.602 24.163-55.333 30.438-21.691 6.565-43.814 8.127-66.013 6.532-22.771-1.636-43.88-9.318-62.74-22.705-20.223-14.355-35.542-32.917-48.075-54.096-9.588-16.203-16.104-33.55-19.201-52.015-2.339-13.944-2.307-28.011-.403-42.182 2.627-19.545 9.021-37.699 17.963-55.067 11.617-22.564 27.317-41.817 48.382-56.118 15.819-10.74 33.452-17.679 52.444-20.455 8.77-1.282 17.696-1.646 26.568-2.055 11.755-.542 23.534-.562 35.289-1.11 8.545-.399 17.067-1.291 26.193-1.675 1.349 1.77 2.24 3.199 2.835 4.742 4.727 12.261 10.575 23.865 18.636 34.358 7.747 10.084 14.83 20.684 22.699 30.666 3.919 4.972 8.37 9.96 13.609 13.352 7.711 4.994 16.238 8.792 24.617 12.668 5.852 2.707 12.037 4.691 18.074 6.998z"></path><path fill="#ea580e" d="M1285.167 162.995c3.796-29.75 13.825-56.841 32.74-80.577 16.339-20.505 36.013-36.502 59.696-47.614 14.666-6.881 29.971-11.669 46.208-12.749 10.068-.669 20.239-1.582 30.255-.863 16.6 1.191 32.646 5.412 47.9 12.273 19.39 8.722 36.44 20.771 50.582 36.655 15.281 17.162 25.313 37.179 31.49 59.286 5.405 19.343 6.31 39.161 4.705 58.825-2.37 29.045-11.836 55.923-30.451 78.885-10.511 12.965-22.483 24.486-37.181 33.649-5.272-5.613-10.008-11.148-14.539-16.846-5.661-7.118-10.958-14.533-16.78-21.513-4.569-5.478-9.548-10.639-14.624-15.658-3.589-3.549-7.411-6.963-11.551-9.827-5.038-3.485-10.565-6.254-15.798-9.468-8.459-5.195-17.011-9.669-26.988-11.898-12.173-2.72-24.838-4.579-35.622-11.834-1.437-.967-3.433-1.192-5.213-1.542-12.871-2.529-25.454-5.639-36.968-12.471-5.21-3.091-11.564-4.195-17.011-6.965-4.808-2.445-8.775-6.605-13.646-8.851-8.859-4.085-18.114-7.311-27.204-10.896z"></path><path fill="#f8ab00" d="M524.963 311.12c-9.461-5.684-19.513-10.592-28.243-17.236-12.877-9.801-24.031-21.578-32.711-35.412-11.272-17.965-19.605-37.147-21.902-58.403-1.291-11.951-2.434-24.073-1.87-36.034.823-17.452 4.909-34.363 11.581-50.703 8.82-21.603 22.25-39.792 39.568-55.065 18.022-15.894 39.162-26.07 62.351-32.332 19.22-5.19 38.842-6.177 58.37-4.674 23.803 1.831 45.56 10.663 65.062 24.496 17.193 12.195 31.688 27.086 42.894 45.622-11.403 8.296-22.633 16.117-34.092 23.586-17.094 11.142-34.262 22.106-48.036 37.528-8.796 9.848-17.201 20.246-27.131 28.837-16.859 14.585-27.745 33.801-41.054 51.019-11.865 15.349-20.663 33.117-30.354 50.08-5.303 9.283-9.654 19.11-14.434 28.692z"></path><path fill="#ea5227" d="M1060.11 1122.049c-7.377 1.649-14.683 4.093-22.147 4.763-11.519 1.033-23.166 1.441-34.723 1.054-19.343-.647-38.002-4.7-55.839-12.65-15.078-6.72-28.606-15.471-40.571-26.836-24.013-22.81-42.053-49.217-49.518-81.936-1.446-6.337-1.958-12.958-2.235-19.477-.591-13.926-.219-27.909-1.237-41.795-.916-12.5-3.16-24.904-4.408-37.805 1.555-1.381 3.134-2.074 3.778-3.27 4.729-8.79 12.141-15.159 19.083-22.03 5.879-5.818 10.688-12.76 16.796-18.293 6.993-6.335 11.86-13.596 14.364-22.612l8.542-29.993c8.015 1.785 15.984 3.821 24.057 5.286 8.145 1.478 16.371 2.59 24.602 3.493 8.453.927 16.956 1.408 25.891 2.609 1.119 16.09 1.569 31.667 2.521 47.214.676 11.045 1.396 22.154 3.234 33.043 2.418 14.329 5.708 28.527 9.075 42.674 3.499 14.705 4.028 29.929 10.415 44.188 10.157 22.674 18.29 46.25 28.281 69.004 7.175 16.341 12.491 32.973 15.078 50.615.645 4.4 3.256 8.511 4.963 12.755z"></path><path fill="#ea5330" d="M1060.512 1122.031c-2.109-4.226-4.72-8.337-5.365-12.737-2.587-17.642-7.904-34.274-15.078-50.615-9.991-22.755-18.124-46.33-28.281-69.004-6.387-14.259-6.916-29.482-10.415-44.188-3.366-14.147-6.656-28.346-9.075-42.674-1.838-10.889-2.558-21.999-3.234-33.043-.951-15.547-1.401-31.124-2.068-47.146 8.568-.18 17.146.487 25.704.286l41.868-1.4c.907 3.746 1.245 7.04 1.881 10.276l8.651 42.704c.903 4.108 2.334 8.422 4.696 11.829 7.165 10.338 14.809 20.351 22.456 30.345 4.218 5.512 8.291 11.304 13.361 15.955 8.641 7.927 18.065 14.995 27.071 22.532 12.011 10.052 24.452 19.302 40.151 22.854-1.656 11.102-2.391 22.44-5.172 33.253-4.792 18.637-12.38 36.209-23.412 52.216-13.053 18.94-29.086 34.662-49.627 45.055-10.757 5.443-22.443 9.048-34.111 13.501z"></path><path fill="#f8aa05" d="M1989.106 883.951c5.198 8.794 11.46 17.148 15.337 26.491 5.325 12.833 9.744 26.207 12.873 39.737 2.95 12.757 3.224 25.908 1.987 39.219-1.391 14.973-4.643 29.268-10.349 43.034-5.775 13.932-13.477 26.707-23.149 38.405-14.141 17.104-31.215 30.458-50.807 40.488-14.361 7.352-29.574 12.797-45.741 14.594-10.297 1.144-20.732 2.361-31.031 1.894-24.275-1.1-47.248-7.445-68.132-20.263-6.096-3.741-11.925-7.917-17.731-12.342 5.319-5.579 10.361-10.852 15.694-15.811l37.072-34.009c.975-.892 2.113-1.606 3.08-2.505 6.936-6.448 14.765-12.2 20.553-19.556 8.88-11.285 20.064-19.639 31.144-28.292 4.306-3.363 9.06-6.353 12.673-10.358 5.868-6.504 10.832-13.814 16.422-20.582 6.826-8.264 13.727-16.481 20.943-24.401 4.065-4.461 8.995-8.121 13.249-12.424 14.802-14.975 28.77-30.825 45.913-43.317z"></path><path fill="#ed6876" d="M1256.099 523.419c5.065.642 10.047 1.787 15.068 2.728 7.267 1.362 14.526 2.854 21.853 3.777 7.696.97 15.468 1.34 23.207 1.961 5.062.406 7.031 3.631 7.777 8.207 1.163 7.135 4.059 9.62 11.3 9.899l27.843.953c4.069.069 5.745 1.291 6.005 5.774.522 9.016 1.829 17.992 3.001 26.96.392 3 2.246 4.417 5.566 4.4 5.239-.026 10.48.469 16.385.778l-1.102 10.495-1.875 18.726c-.44 3.74.088 6.105 4.751 6.012 4.11-.082 8.239.568 12.352.975 2.823.28 3.984 1.892 3.794 4.753-.428 6.444-.052 13.028-1.276 19.306-.986 5.059.651 6.724 5.065 7.31 1.793.238 3.566.634 6.12 1.098 0 4.189.243 8.545-.068 12.861-.319 4.43-1.27 8.811-1.77 13.233-.285 2.528-.461 5.379 3.332 5.331 13.729-.173 11.316 2.968 12.332 14.419.658 7.423-1.066 15.045-1.554 22.589-.145 2.241.28 4.519.519 7.827 2.026-1.452 2.733-2.167 3.589-2.521 1.142-.472 2.713-1.244 3.518-.81.767.414 1.114 2.221 1.081 3.4l-.917 24.539c-11.215.82-22.45.899-33.636 1.674l-43.952 3.436c-1.086-3.01-2.319-5.571-2.296-8.121.084-9.297-4.468-16.583-9.091-24.116-3.872-6.308-8.764-13.052-9.479-19.987-1.071-10.392-5.716-15.936-14.889-18.979-1.097-.364-2.16-.844-3.214-1.327-7.478-3.428-15.548-5.918-19.059-14.735-.904-2.27-3.657-3.775-5.461-5.723-2.437-2.632-4.615-5.525-7.207-7.987-2.648-2.515-5.352-5.346-8.589-6.777-4.799-2.121-10.074-3.185-15.175-4.596l-15.785-4.155c.274-12.896 1.722-25.901.54-38.662-1.647-17.783-3.457-35.526-2.554-53.352.528-10.426 2.539-20.777 3.948-31.574z"></path><path fill="#f6a200" d="M525.146 311.436c4.597-9.898 8.947-19.725 14.251-29.008 9.691-16.963 18.49-34.73 30.354-50.08 13.309-17.218 24.195-36.434 41.054-51.019 9.93-8.591 18.335-18.989 27.131-28.837 13.774-15.422 30.943-26.386 48.036-37.528 11.459-7.469 22.688-15.29 34.243-23.286 11.705 16.744 19.716 35.424 22.534 55.717 2.231 16.066 2.236 32.441 2.753 49.143-4.756 1.62-9.284 2.234-13.259 4.056-6.43 2.948-12.193 7.513-18.774 9.942-19.863 7.331-33.806 22.349-47.926 36.784-7.86 8.035-13.511 18.275-19.886 27.705-4.434 6.558-9.345 13.037-12.358 20.254-4.249 10.177-6.94 21.004-10.296 31.553-12.33.053-24.741 1.027-36.971-.049-20.259-1.783-40.227-5.567-58.755-14.69-.568-.28-1.295-.235-2.132-.658z"></path><path fill="#f7a80d" d="M1989.057 883.598c-17.093 12.845-31.061 28.695-45.863 43.67-4.254 4.304-9.184 7.963-13.249 12.424-7.216 7.92-14.117 16.137-20.943 24.401-5.59 6.768-10.554 14.078-16.422 20.582-3.614 4.005-8.367 6.995-12.673 10.358-11.08 8.653-22.264 17.007-31.144 28.292-5.788 7.356-13.617 13.108-20.553 19.556-.967.899-2.105 1.614-3.08 2.505l-37.072 34.009c-5.333 4.96-10.375 10.232-15.859 15.505-21.401-17.218-37.461-38.439-48.623-63.592 3.503-1.781 7.117-2.604 9.823-4.637 8.696-6.536 20.392-8.406 27.297-17.714.933-1.258 2.646-1.973 4.065-2.828 17.878-10.784 36.338-20.728 53.441-32.624 10.304-7.167 18.637-17.23 27.583-26.261 3.819-3.855 7.436-8.091 10.3-12.681 12.283-19.68 24.43-39.446 40.382-56.471 12.224-13.047 17.258-29.524 22.539-45.927 15.85 4.193 29.819 12.129 42.632 22.08 10.583 8.219 19.782 17.883 27.42 29.351z"></path><path fill="#ef7a72" d="M1479.461 758.907c1.872-13.734 4.268-27.394 6.525-41.076 2.218-13.45 8.26-24.279 19.615-32.423 5.099-3.657 9.667-8.701 12.999-14.038 6.646-10.643 15.183-19.135 25.083-26.631 5.888-4.459 11.817-9.176 16.547-14.774 5.906-6.99 13.974-9.306 21.753-12.365l51.48-19.549c.753 11.848.658 23.787 1.641 35.637 1.771 21.353 4.075 42.672 11.748 62.955.17.449.107.985-.019 2.158-6.945 4.134-13.865 7.337-20.437 11.143-3.935 2.279-7.752 5.096-10.869 8.384-6.011 6.343-11.063 13.624-17.286 19.727-9.096 8.92-12.791 20.684-18.181 31.587-.202.409-.072.984-.096 1.481-8.488-1.72-16.937-3.682-25.476-5.094-9.689-1.602-19.426-3.084-29.201-3.949-15.095-1.335-30.241-2.1-45.828-3.172z"></path><path fill="#e94e3b" d="M957.995 766.838c-20.337-5.467-38.791-14.947-55.703-27.254-8.2-5.967-15.451-13.238-22.958-20.37 2.969-3.504 5.564-6.772 8.598-9.563 7.085-6.518 11.283-14.914 15.8-23.153 4.933-8.996 10.345-17.743 14.966-26.892 2.642-5.231 5.547-11.01 5.691-16.611.12-4.651.194-8.932 2.577-12.742 8.52-13.621 15.483-28.026 18.775-43.704 2.11-10.049 7.888-18.774 7.81-29.825-.064-9.089 4.291-18.215 6.73-27.313 3.212-11.983 7.369-23.797 9.492-35.968 3.202-18.358 5.133-36.945 7.346-55.466l4.879-45.8c6.693.288 13.386.575 20.54 1.365.13 3.458-.41 6.407-.496 9.37l-1.136 42.595c-.597 11.552-2.067 23.058-3.084 34.59l-3.845 44.478c-.939 10.202-1.779 20.432-3.283 30.557-.96 6.464-4.46 12.646-1.136 19.383.348.706-.426 1.894-.448 2.864-.224 9.918-5.99 19.428-2.196 29.646.103.279-.033.657-.092.983l-8.446 46.205c-1.231 6.469-2.936 12.846-4.364 19.279-1.5 6.757-2.602 13.621-4.456 20.277-3.601 12.93-10.657 25.3-5.627 39.47.368 1.036.234 2.352.017 3.476l-5.949 30.123z"></path><path fill="#ea5043" d="M958.343 767.017c1.645-10.218 3.659-20.253 5.602-30.302.217-1.124.351-2.44-.017-3.476-5.03-14.17 2.026-26.539 5.627-39.47 1.854-6.656 2.956-13.52 4.456-20.277 1.428-6.433 3.133-12.81 4.364-19.279l8.446-46.205c.059-.326.196-.705.092-.983-3.794-10.218 1.972-19.728 2.196-29.646.022-.97.796-2.158.448-2.864-3.324-6.737.176-12.919 1.136-19.383 1.504-10.125 2.344-20.355 3.283-30.557l3.845-44.478c1.017-11.532 2.488-23.038 3.084-34.59.733-14.18.722-28.397 1.136-42.595.086-2.963.626-5.912.956-9.301 5.356-.48 10.714-.527 16.536-.081 2.224 15.098 1.855 29.734 1.625 44.408-.157 10.064 1.439 20.142 1.768 30.23.334 10.235-.035 20.49.116 30.733.084 5.713.789 11.418.861 17.13.054 4.289-.469 8.585-.702 12.879-.072 1.323-.138 2.659-.031 3.975l2.534 34.405-1.707 36.293-1.908 48.69c-.182 8.103.993 16.237.811 24.34-.271 12.076-1.275 24.133-1.787 36.207-.102 2.414-.101 5.283 1.06 7.219 4.327 7.22 4.463 15.215 4.736 23.103.365 10.553.088 21.128.086 31.693-11.44 2.602-22.84.688-34.106-.916-11.486-1.635-22.806-4.434-34.546-6.903z"></path><path fill="#eb5d19" d="M398.091 622.45c6.086.617 12.21 1.288 18.067 2.918 3.539.985 6.779 3.277 9.952 5.297 9.773 6.224 18.971 13.583 29.311 18.611 8.606 4.184 12.839 10.986 17.016 18.559l18.571 32.959c1.814 3.102 4.285 5.931 6.883 8.443 8.835 8.542 10.052 20.175 13.16 31.095 2.082 7.317 4.609 14.507 6.946 22.127-29.472 3.021-58.969 5.582-87.584 15.222-1.185-2.302-1.795-4.362-2.769-6.233-4.398-8.449-6.703-18.174-14.942-24.299-2.511-1.866-5.103-3.814-7.047-6.218-8.358-10.332-17.028-20.276-28.772-26.973 4.423-11.478 9.299-22.806 13.151-34.473 4.406-13.348 6.724-27.18 6.998-41.313.098-5.093.643-10.176 1.06-15.722z"></path><path fill="#e94c32" d="M981.557 392.109c-1.172 15.337-2.617 30.625-4.438 45.869-2.213 18.521-4.144 37.108-7.346 55.466-2.123 12.171-6.28 23.985-9.492 35.968-2.439 9.098-6.794 18.224-6.73 27.313.078 11.051-5.7 19.776-7.81 29.825-3.292 15.677-10.255 30.082-18.775 43.704-2.383 3.81-2.458 8.091-2.577 12.742-.144 5.6-3.049 11.38-5.691 16.611-4.621 9.149-10.033 17.896-14.966 26.892-4.517 8.239-8.715 16.635-15.8 23.153-3.034 2.791-5.629 6.06-8.735 9.255-12.197-10.595-21.071-23.644-29.301-37.24-7.608-12.569-13.282-25.962-17.637-40.37 13.303-6.889 25.873-13.878 35.311-25.315.717-.869 1.934-1.312 2.71-2.147 5.025-5.405 10.515-10.481 14.854-16.397 6.141-8.374 10.861-17.813 17.206-26.008 8.22-10.618 13.657-22.643 20.024-34.466 4.448-.626 6.729-3.21 8.114-6.89 1.455-3.866 2.644-7.895 4.609-11.492 4.397-8.05 9.641-15.659 13.708-23.86 3.354-6.761 5.511-14.116 8.203-21.206 5.727-15.082 7.277-31.248 12.521-46.578 3.704-10.828 3.138-23.116 4.478-34.753l7.56-.073z"></path><path fill="#f7a617" d="M1918.661 831.99c-4.937 16.58-9.971 33.057-22.196 46.104-15.952 17.025-28.099 36.791-40.382 56.471-2.864 4.59-6.481 8.825-10.3 12.681-8.947 9.031-17.279 19.094-27.583 26.261-17.103 11.896-35.564 21.84-53.441 32.624-1.419.856-3.132 1.571-4.065 2.828-6.904 9.308-18.6 11.178-27.297 17.714-2.705 2.033-6.319 2.856-9.874 4.281-3.413-9.821-6.916-19.583-9.36-29.602-1.533-6.284-1.474-12.957-1.665-19.913 1.913-.78 3.374-1.057 4.81-1.431 15.822-4.121 31.491-8.029 43.818-20.323 9.452-9.426 20.371-17.372 30.534-26.097 6.146-5.277 13.024-10.052 17.954-16.326 14.812-18.848 28.876-38.285 43.112-57.581 2.624-3.557 5.506-7.264 6.83-11.367 2.681-8.311 4.375-16.94 6.476-25.438 17.89.279 35.333 3.179 52.629 9.113z"></path><path fill="#ea553a" d="M1172.91 977.582c-15.775-3.127-28.215-12.377-40.227-22.43-9.005-7.537-18.43-14.605-27.071-22.532-5.07-4.651-9.143-10.443-13.361-15.955-7.647-9.994-15.291-20.007-22.456-30.345-2.361-3.407-3.792-7.72-4.696-11.829-3.119-14.183-5.848-28.453-8.651-42.704-.636-3.236-.974-6.53-1.452-10.209 15.234-2.19 30.471-3.969 46.408-5.622 2.692 5.705 4.882 11.222 6.63 16.876 2.9 9.381 7.776 17.194 15.035 24.049 7.056 6.662 13.305 14.311 19.146 22.099 9.509 12.677 23.01 19.061 36.907 25.054-1.048 7.441-2.425 14.854-3.066 22.33-.956 11.162-1.393 22.369-2.052 33.557l-1.096 17.661z"></path><path fill="#ea5453" d="M1163.123 704.036c-4.005 5.116-7.685 10.531-12.075 15.293-12.842 13.933-27.653 25.447-44.902 34.538-3.166-5.708-5.656-11.287-8.189-17.251-3.321-12.857-6.259-25.431-9.963-37.775-4.6-15.329-10.6-30.188-11.349-46.562-.314-6.871-1.275-14.287-7.114-19.644-1.047-.961-1.292-3.053-1.465-4.67l-4.092-39.927c-.554-5.245-.383-10.829-2.21-15.623-3.622-9.503-4.546-19.253-4.688-29.163-.088-6.111 1.068-12.256.782-18.344-.67-14.281-1.76-28.546-2.9-42.8-.657-8.222-1.951-16.395-2.564-24.62-.458-6.137-.285-12.322-.104-18.21.959 5.831 1.076 11.525 2.429 16.909 2.007 7.986 5.225 15.664 7.324 23.632 3.222 12.23 1.547 25.219 6.728 37.355 4.311 10.099 6.389 21.136 9.732 31.669 2.228 7.02 6.167 13.722 7.121 20.863 1.119 8.376 6.1 13.974 10.376 20.716l2.026 10.576c1.711 9.216 3.149 18.283 8.494 26.599 6.393 9.946 11.348 20.815 16.943 31.276 4.021 7.519 6.199 16.075 12.925 22.065l24.462 22.26c.556.503 1.507.571 2.274.841z"></path><path fill="#ea5b15" d="M1285.092 163.432c9.165 3.148 18.419 6.374 27.279 10.459 4.871 2.246 8.838 6.406 13.646 8.851 5.446 2.77 11.801 3.874 17.011 6.965 11.514 6.831 24.097 9.942 36.968 12.471 1.78.35 3.777.576 5.213 1.542 10.784 7.255 23.448 9.114 35.622 11.834 9.977 2.23 18.529 6.703 26.988 11.898 5.233 3.214 10.76 5.983 15.798 9.468 4.14 2.864 7.962 6.279 11.551 9.827 5.076 5.02 10.056 10.181 14.624 15.658 5.822 6.98 11.119 14.395 16.78 21.513 4.531 5.698 9.267 11.233 14.222 16.987-10.005 5.806-20.07 12.004-30.719 16.943-7.694 3.569-16.163 5.464-24.688 7.669-2.878-7.088-5.352-13.741-7.833-20.392-.802-2.15-1.244-4.55-2.498-6.396-4.548-6.7-9.712-12.999-14.011-19.847-6.672-10.627-15.34-18.93-26.063-25.376-9.357-5.625-18.367-11.824-27.644-17.587-6.436-3.997-12.902-8.006-19.659-11.405-5.123-2.577-11.107-3.536-16.046-6.37-17.187-9.863-35.13-17.887-54.031-23.767-4.403-1.37-8.953-2.267-13.436-3.382l.926-27.565z"></path><path fill="#ea504b" d="M1098 737l7.789 16.893c-15.04 9.272-31.679 15.004-49.184 17.995-9.464 1.617-19.122 2.097-29.151 3.019-.457-10.636-.18-21.211-.544-31.764-.273-7.888-.409-15.883-4.736-23.103-1.16-1.936-1.162-4.805-1.06-7.219l1.787-36.207c.182-8.103-.993-16.237-.811-24.34.365-16.236 1.253-32.461 1.908-48.69.484-12 .942-24.001 1.98-36.069 5.57 10.19 10.632 20.42 15.528 30.728 1.122 2.362 2.587 5.09 2.339 7.488-1.536 14.819 5.881 26.839 12.962 38.33 10.008 16.241 16.417 33.54 20.331 51.964 2.285 10.756 4.729 21.394 11.958 30.165L1098 737z"></path><path fill="#f6a320" d="M1865.78 822.529c-1.849 8.846-3.544 17.475-6.224 25.786-1.323 4.102-4.206 7.81-6.83 11.367l-43.112 57.581c-4.93 6.273-11.808 11.049-17.954 16.326-10.162 8.725-21.082 16.671-30.534 26.097-12.327 12.294-27.997 16.202-43.818 20.323-1.436.374-2.897.651-4.744.986-1.107-17.032-1.816-34.076-2.079-51.556 1.265-.535 2.183-.428 2.888-.766 10.596-5.072 20.8-11.059 32.586-13.273 1.69-.317 3.307-1.558 4.732-2.662l26.908-21.114c4.992-4.003 11.214-7.393 14.381-12.585 11.286-18.5 22.363-37.263 27.027-58.87l36.046 1.811c3.487.165 6.983.14 10.727.549z"></path><path fill="#ec6333" d="M318.448 922.814c-6.374-2.074-12.56-4.058-18.412-6.765-8.379-3.876-16.906-7.675-24.617-12.668-5.239-3.392-9.69-8.381-13.609-13.352-7.87-9.983-14.953-20.582-22.699-30.666-8.061-10.493-13.909-22.097-18.636-34.358-.595-1.543-1.486-2.972-2.382-4.783 6.84-1.598 13.797-3.023 20.807-4.106 18.852-2.912 36.433-9.493 53.737-17.819.697.888.889 1.555 1.292 2.051l17.921 21.896c4.14 4.939 8.06 10.191 12.862 14.412 5.67 4.984 12.185 9.007 18.334 13.447-8.937 16.282-16.422 33.178-20.696 51.31-1.638 6.951-2.402 14.107-3.903 21.403z"></path><path fill="#f49700" d="M623.467 326.903c2.893-10.618 5.584-21.446 9.833-31.623 3.013-7.217 7.924-13.696 12.358-20.254 6.375-9.43 12.026-19.67 19.886-27.705 14.12-14.434 28.063-29.453 47.926-36.784 6.581-2.429 12.344-6.994 18.774-9.942 3.975-1.822 8.503-2.436 13.186-3.592 1.947 18.557 3.248 37.15 8.307 55.686-15.453 7.931-28.853 18.092-40.46 29.996-10.417 10.683-19.109 23.111-28.013 35.175-3.238 4.388-4.888 9.948-7.262 14.973-17.803-3.987-35.767-6.498-54.535-5.931z"></path><path fill="#ea544c" d="M1097.956 736.615c-2.925-3.218-5.893-6.822-8.862-10.425-7.229-8.771-9.672-19.409-11.958-30.165-3.914-18.424-10.323-35.722-20.331-51.964-7.081-11.491-14.498-23.511-12.962-38.33.249-2.398-1.217-5.126-2.339-7.488l-15.232-31.019-3.103-34.338c-.107-1.316-.041-2.653.031-3.975.233-4.294.756-8.59.702-12.879-.072-5.713-.776-11.417-.861-17.13l-.116-30.733c-.329-10.088-1.926-20.166-1.768-30.23.23-14.674.599-29.31-1.162-44.341 9.369-.803 18.741-1.179 28.558-1.074 1.446 15.814 2.446 31.146 3.446 46.478.108 6.163-.064 12.348.393 18.485.613 8.225 1.907 16.397 2.564 24.62l2.9 42.8c.286 6.088-.869 12.234-.782 18.344.142 9.91 1.066 19.661 4.688 29.163 1.827 4.794 1.657 10.377 2.21 15.623l4.092 39.927c.172 1.617.417 3.71 1.465 4.67 5.839 5.357 6.8 12.773 7.114 19.644.749 16.374 6.749 31.233 11.349 46.562 3.704 12.344 6.642 24.918 9.963 37.775z"></path><path fill="#ec5c61" d="M1204.835 568.008c1.254 25.351-1.675 50.16-10.168 74.61-8.598-4.883-18.177-8.709-24.354-15.59-7.44-8.289-13.929-17.442-21.675-25.711-8.498-9.072-16.731-18.928-21.084-31.113-.54-1.513-1.691-2.807-2.594-4.564-4.605-9.247-7.706-18.544-7.96-29.09-.835-7.149-1.214-13.944-2.609-20.523-2.215-10.454-5.626-20.496-7.101-31.302-2.513-18.419-7.207-36.512-5.347-55.352.24-2.43-.17-4.949-.477-7.402l-4.468-34.792c2.723-.379 5.446-.757 8.585-.667 1.749 8.781 2.952 17.116 4.448 25.399 1.813 10.037 3.64 20.084 5.934 30.017 1.036 4.482 3.953 8.573 4.73 13.064 1.794 10.377 4.73 20.253 9.272 29.771 2.914 6.105 4.761 12.711 7.496 18.912 2.865 6.496 6.264 12.755 9.35 19.156 3.764 7.805 7.667 15.013 16.1 19.441 7.527 3.952 13.713 10.376 20.983 14.924 6.636 4.152 13.932 7.25 20.937 10.813z"></path><path fill="#ed676f" d="M1140.75 379.231c18.38-4.858 36.222-11.21 53.979-18.971 3.222 3.368 5.693 6.744 8.719 9.512 2.333 2.134 5.451 5.07 8.067 4.923 7.623-.429 12.363 2.688 17.309 8.215 5.531 6.18 12.744 10.854 19.224 16.184-5.121 7.193-10.461 14.241-15.323 21.606-13.691 20.739-22.99 43.255-26.782 67.926-.543 3.536-1.281 7.043-2.366 10.925-14.258-6.419-26.411-14.959-32.731-29.803-1.087-2.553-2.596-4.93-3.969-7.355-1.694-2.993-3.569-5.89-5.143-8.943-1.578-3.062-2.922-6.249-4.295-9.413-1.57-3.621-3.505-7.163-4.47-10.946-1.257-4.93-.636-10.572-2.725-15.013-5.831-12.397-7.467-25.628-9.497-38.847z"></path><path fill="#ed656e" d="M1254.103 647.439c5.325.947 10.603 2.272 15.847 3.722 5.101 1.41 10.376 2.475 15.175 4.596 3.237 1.431 5.942 4.262 8.589 6.777 2.592 2.462 4.77 5.355 7.207 7.987 1.804 1.948 4.557 3.453 5.461 5.723 3.51 8.817 11.581 11.307 19.059 14.735 1.053.483 2.116.963 3.214 1.327 9.172 3.043 13.818 8.587 14.889 18.979.715 6.935 5.607 13.679 9.479 19.987 4.623 7.533 9.175 14.819 9.091 24.116-.023 2.55 1.21 5.111 1.874 8.055-19.861 2.555-39.795 4.296-59.597 9.09l-11.596-23.203c-1.107-2.169-2.526-4.353-4.307-5.975-7.349-6.694-14.863-13.209-22.373-19.723l-17.313-14.669c-2.776-2.245-5.935-4.017-8.92-6.003l11.609-38.185c1.508-5.453 1.739-11.258 2.613-17.336z"></path><path fill="#ec6168" d="M1140.315 379.223c2.464 13.227 4.101 26.459 9.931 38.856 2.089 4.441 1.468 10.083 2.725 15.013.965 3.783 2.9 7.325 4.47 10.946 1.372 3.164 2.716 6.351 4.295 9.413 1.574 3.053 3.449 5.95 5.143 8.943 1.372 2.425 2.882 4.803 3.969 7.355 6.319 14.844 18.473 23.384 32.641 30.212.067 5.121-.501 10.201-.435 15.271l.985 38.117c.151 4.586.616 9.162.868 14.201-7.075-3.104-14.371-6.202-21.007-10.354-7.269-4.548-13.456-10.972-20.983-14.924-8.434-4.428-12.337-11.637-16.1-19.441-3.087-6.401-6.485-12.66-9.35-19.156-2.735-6.201-4.583-12.807-7.496-18.912-4.542-9.518-7.477-19.394-9.272-29.771-.777-4.491-3.694-8.581-4.73-13.064-2.294-9.933-4.121-19.98-5.934-30.017-1.496-8.283-2.699-16.618-4.036-25.335 10.349-2.461 20.704-4.511 31.054-6.582.957-.191 1.887-.515 3.264-.769z"></path><path fill="#e94c28" d="M922 537c-6.003 11.784-11.44 23.81-19.66 34.428-6.345 8.196-11.065 17.635-17.206 26.008-4.339 5.916-9.828 10.992-14.854 16.397-.776.835-1.993 1.279-2.71 2.147-9.439 11.437-22.008 18.427-35.357 24.929-4.219-10.885-6.942-22.155-7.205-33.905l-.514-49.542c7.441-2.893 14.452-5.197 21.334-7.841 1.749-.672 3.101-2.401 4.604-3.681 6.749-5.745 12.845-12.627 20.407-16.944 7.719-4.406 14.391-9.101 18.741-16.889.626-1.122 1.689-2.077 2.729-2.877 7.197-5.533 12.583-12.51 16.906-20.439.68-1.247 2.495-1.876 4.105-2.651 2.835 1.408 5.267 2.892 7.884 3.892 3.904 1.491 4.392 3.922 2.833 7.439-1.47 3.318-2.668 6.756-4.069 10.106-1.247 2.981-.435 5.242 2.413 6.544 2.805 1.282 3.125 3.14 1.813 5.601l-6.907 12.799L922 537z"></path><path fill="#eb5659" d="M1124.995 566c.868 1.396 2.018 2.691 2.559 4.203 4.353 12.185 12.586 22.041 21.084 31.113 7.746 8.269 14.235 17.422 21.675 25.711 6.176 6.881 15.756 10.707 24.174 15.932-6.073 22.316-16.675 42.446-31.058 60.937-1.074-.131-2.025-.199-2.581-.702l-24.462-22.26c-6.726-5.99-8.904-14.546-12.925-22.065-5.594-10.461-10.55-21.33-16.943-31.276-5.345-8.315-6.783-17.383-8.494-26.599-.63-3.394-1.348-6.772-1.738-10.848-.371-6.313-1.029-11.934-1.745-18.052l6.34 4.04 1.288-.675-2.143-15.385 9.454 1.208v-8.545L1124.995 566z"></path><path fill="#f5a02d" d="M1818.568 820.096c-4.224 21.679-15.302 40.442-26.587 58.942-3.167 5.192-9.389 8.582-14.381 12.585l-26.908 21.114c-1.425 1.104-3.042 2.345-4.732 2.662-11.786 2.214-21.99 8.201-32.586 13.273-.705.338-1.624.231-2.824.334a824.35 824.35 0 0 1-8.262-42.708c4.646-2.14 9.353-3.139 13.269-5.47 5.582-3.323 11.318-6.942 15.671-11.652 7.949-8.6 14.423-18.572 22.456-27.081 8.539-9.046 13.867-19.641 18.325-30.922l46.559 8.922z"></path><path fill="#eb5a57" d="M1124.96 565.639c-5.086-4.017-10.208-8.395-15.478-12.901v8.545l-9.454-1.208 2.143 15.385-1.288.675-6.34-4.04c.716 6.118 1.375 11.74 1.745 17.633-4.564-6.051-9.544-11.649-10.663-20.025-.954-7.141-4.892-13.843-7.121-20.863-3.344-10.533-5.421-21.57-9.732-31.669-5.181-12.135-3.506-25.125-6.728-37.355-2.099-7.968-5.317-15.646-7.324-23.632-1.353-5.384-1.47-11.078-2.429-16.909l-3.294-46.689a278.63 278.63 0 0 1 27.57-2.084c2.114 12.378 3.647 24.309 5.479 36.195 1.25 8.111 2.832 16.175 4.422 24.23 1.402 7.103 2.991 14.169 4.55 21.241 1.478 6.706.273 14.002 4.6 20.088 5.401 7.597 7.176 16.518 9.467 25.337 1.953 7.515 5.804 14.253 11.917 19.406.254 10.095 3.355 19.392 7.96 28.639z"></path><path fill="#ea541c" d="M911.651 810.999c-2.511 10.165-5.419 20.146-8.2 30.162-2.503 9.015-7.37 16.277-14.364 22.612-6.108 5.533-10.917 12.475-16.796 18.293-6.942 6.871-14.354 13.24-19.083 22.03-.644 1.196-2.222 1.889-3.705 2.857-2.39-7.921-4.101-15.991-6.566-23.823-5.451-17.323-12.404-33.976-23.414-48.835l21.627-21.095c3.182-3.29 5.532-7.382 8.295-11.083l10.663-14.163c9.528 4.78 18.925 9.848 28.625 14.247 7.324 3.321 15.036 5.785 22.917 8.799z"></path><path fill="#eb5d19" d="M1284.092 191.421c4.557.69 9.107 1.587 13.51 2.957 18.901 5.881 36.844 13.904 54.031 23.767 4.938 2.834 10.923 3.792 16.046 6.37 6.757 3.399 13.224 7.408 19.659 11.405l27.644 17.587c10.723 6.446 19.392 14.748 26.063 25.376 4.299 6.848 9.463 13.147 14.011 19.847 1.254 1.847 1.696 4.246 2.498 6.396l7.441 20.332c-11.685 1.754-23.379 3.133-35.533 4.037-.737-2.093-.995-3.716-1.294-5.33-3.157-17.057-14.048-30.161-23.034-44.146-3.027-4.71-7.786-8.529-12.334-11.993-9.346-7.116-19.004-13.834-28.688-20.491-6.653-4.573-13.311-9.251-20.431-13.002-8.048-4.24-16.479-7.85-24.989-11.091-11.722-4.465-23.673-8.328-35.527-12.449l.927-19.572z"></path><path fill="#eb5e24" d="M1283.09 211.415c11.928 3.699 23.88 7.562 35.602 12.027 8.509 3.241 16.941 6.852 24.989 11.091 7.12 3.751 13.778 8.429 20.431 13.002 9.684 6.657 19.342 13.375 28.688 20.491 4.548 3.463 9.307 7.283 12.334 11.993 8.986 13.985 19.877 27.089 23.034 44.146.299 1.615.557 3.237.836 5.263-13.373-.216-26.749-.839-40.564-1.923-2.935-9.681-4.597-18.92-12.286-26.152-15.577-14.651-30.4-30.102-45.564-45.193-.686-.683-1.626-1.156-2.516-1.584l-47.187-22.615 2.203-20.546z"></path><path fill="#e9511f" d="M913 486.001c-1.29.915-3.105 1.543-3.785 2.791-4.323 7.929-9.709 14.906-16.906 20.439-1.04.8-2.103 1.755-2.729 2.877-4.35 7.788-11.022 12.482-18.741 16.889-7.562 4.317-13.658 11.199-20.407 16.944-1.503 1.28-2.856 3.009-4.604 3.681-6.881 2.643-13.893 4.948-21.262 7.377-.128-11.151.202-22.302.378-33.454.03-1.892-.6-3.795-.456-6.12 13.727-1.755 23.588-9.527 33.278-17.663 2.784-2.337 6.074-4.161 8.529-6.784l29.057-31.86c1.545-1.71 3.418-3.401 4.221-5.459 5.665-14.509 11.49-28.977 16.436-43.736 2.817-8.407 4.074-17.338 6.033-26.032 5.039.714 10.078 1.427 15.536 2.629-.909 8.969-2.31 17.438-3.546 25.931-2.41 16.551-5.84 32.839-11.991 48.461L913 486.001z"></path><path fill="#ea5741" d="M1179.451 903.828c-14.224-5.787-27.726-12.171-37.235-24.849-5.841-7.787-12.09-15.436-19.146-22.099-7.259-6.854-12.136-14.667-15.035-24.049-1.748-5.654-3.938-11.171-6.254-17.033 15.099-4.009 30.213-8.629 44.958-15.533l28.367 36.36c6.09 8.015 13.124 14.75 22.72 18.375-7.404 14.472-13.599 29.412-17.48 45.244-.271 1.106-.382 2.25-.895 3.583z"></path><path fill="#ea522a" d="M913.32 486.141c2.693-7.837 5.694-15.539 8.722-23.231 6.151-15.622 9.581-31.91 11.991-48.461l3.963-25.861c7.582.317 15.168 1.031 22.748 1.797 4.171.421 8.333.928 12.877 1.596-.963 11.836-.398 24.125-4.102 34.953-5.244 15.33-6.794 31.496-12.521 46.578-2.692 7.09-4.849 14.445-8.203 21.206-4.068 8.201-9.311 15.81-13.708 23.86-1.965 3.597-3.154 7.627-4.609 11.492-1.385 3.68-3.666 6.265-8.114 6.89-1.994-1.511-3.624-3.059-5.077-4.44l6.907-12.799c1.313-2.461.993-4.318-1.813-5.601-2.849-1.302-3.66-3.563-2.413-6.544 1.401-3.35 2.599-6.788 4.069-10.106 1.558-3.517 1.071-5.948-2.833-7.439-2.617-1-5.049-2.484-7.884-3.892z"></path><path fill="#eb5e24" d="M376.574 714.118c12.053 6.538 20.723 16.481 29.081 26.814 1.945 2.404 4.537 4.352 7.047 6.218 8.24 6.125 10.544 15.85 14.942 24.299.974 1.871 1.584 3.931 2.376 6.29-7.145 3.719-14.633 6.501-21.386 10.517-9.606 5.713-18.673 12.334-28.425 18.399-3.407-3.73-6.231-7.409-9.335-10.834l-30.989-33.862c11.858-11.593 22.368-24.28 31.055-38.431 1.86-3.031 3.553-6.164 5.632-9.409z"></path><path fill="#e95514" d="M859.962 787.636c-3.409 5.037-6.981 9.745-10.516 14.481-2.763 3.701-5.113 7.792-8.295 11.083-6.885 7.118-14.186 13.834-21.65 20.755-13.222-17.677-29.417-31.711-48.178-42.878-.969-.576-2.068-.934-3.27-1.709 6.28-8.159 12.733-15.993 19.16-23.849 1.459-1.783 2.718-3.738 4.254-5.448l18.336-19.969c4.909 5.34 9.619 10.738 14.081 16.333 9.72 12.19 21.813 21.566 34.847 29.867.411.262.725.674 1.231 1.334z"></path><path fill="#eb5f2d" d="M339.582 762.088l31.293 33.733c3.104 3.425 5.928 7.104 9.024 10.979-12.885 11.619-24.548 24.139-33.899 38.704-.872 1.359-1.56 2.837-2.644 4.428-6.459-4.271-12.974-8.294-18.644-13.278-4.802-4.221-8.722-9.473-12.862-14.412l-17.921-21.896c-.403-.496-.595-1.163-.926-2.105 16.738-10.504 32.58-21.87 46.578-36.154z"></path><path fill="#f28d00" d="M678.388 332.912c1.989-5.104 3.638-10.664 6.876-15.051 8.903-12.064 17.596-24.492 28.013-35.175 11.607-11.904 25.007-22.064 40.507-29.592 4.873 11.636 9.419 23.412 13.67 35.592-5.759 4.084-11.517 7.403-16.594 11.553-4.413 3.607-8.124 8.092-12.023 12.301-5.346 5.772-10.82 11.454-15.782 17.547-3.929 4.824-7.17 10.208-10.716 15.344l-33.95-12.518z"></path><path fill="#f08369" d="M1580.181 771.427c-.191-.803-.322-1.377-.119-1.786 5.389-10.903 9.084-22.666 18.181-31.587 6.223-6.103 11.276-13.385 17.286-19.727 3.117-3.289 6.933-6.105 10.869-8.384 6.572-3.806 13.492-7.009 20.461-10.752 1.773 3.23 3.236 6.803 4.951 10.251l12.234 24.993c-1.367 1.966-2.596 3.293-3.935 4.499-7.845 7.07-16.315 13.564-23.407 21.32-6.971 7.623-12.552 16.517-18.743 24.854l-37.777-13.68z"></path><path fill="#f18b5e" d="M1618.142 785.4c6.007-8.63 11.588-17.524 18.559-25.147 7.092-7.755 15.562-14.249 23.407-21.32 1.338-1.206 2.568-2.534 3.997-4.162l28.996 33.733c1.896 2.205 4.424 3.867 6.66 6.394-6.471 7.492-12.967 14.346-19.403 21.255l-18.407 19.953c-12.958-12.409-27.485-22.567-43.809-30.706z"></path><path fill="#f49c3a" d="M1771.617 811.1c-4.066 11.354-9.394 21.949-17.933 30.995-8.032 8.509-14.507 18.481-22.456 27.081-4.353 4.71-10.089 8.329-15.671 11.652-3.915 2.331-8.623 3.331-13.318 5.069-4.298-9.927-8.255-19.998-12.1-30.743 4.741-4.381 9.924-7.582 13.882-11.904 7.345-8.021 14.094-16.603 20.864-25.131 4.897-6.168 9.428-12.626 14.123-18.955l32.61 11.936z"></path><path fill="#f08000" d="M712.601 345.675c3.283-5.381 6.524-10.765 10.453-15.589 4.962-6.093 10.435-11.774 15.782-17.547 3.899-4.21 7.61-8.695 12.023-12.301 5.078-4.15 10.836-7.469 16.636-11.19a934.12 934.12 0 0 1 23.286 35.848c-4.873 6.234-9.676 11.895-14.63 17.421l-25.195 27.801c-11.713-9.615-24.433-17.645-38.355-24.443z"></path><path fill="#ed6e04" d="M751.11 370.42c8.249-9.565 16.693-18.791 25.041-28.103 4.954-5.526 9.757-11.187 14.765-17.106 7.129 6.226 13.892 13.041 21.189 19.225 5.389 4.567 11.475 8.312 17.53 12.92-5.51 7.863-10.622 15.919-17.254 22.427-8.881 8.716-18.938 16.233-28.49 24.264-5.703-6.587-11.146-13.427-17.193-19.682-4.758-4.921-10.261-9.121-15.587-13.944z"></path><path fill="#ea541c" d="M921.823 385.544c-1.739 9.04-2.995 17.971-5.813 26.378-4.946 14.759-10.771 29.227-16.436 43.736-.804 2.058-2.676 3.749-4.221 5.459l-29.057 31.86c-2.455 2.623-5.745 4.447-8.529 6.784-9.69 8.135-19.551 15.908-33.208 17.237-1.773-9.728-3.147-19.457-4.091-29.6l36.13-16.763c.581-.267 1.046-.812 1.525-1.269 8.033-7.688 16.258-15.19 24.011-23.152 4.35-4.467 9.202-9.144 11.588-14.69 6.638-15.425 15.047-30.299 17.274-47.358 3.536.344 7.072.688 10.829 1.377z"></path><path fill="#f3944d" d="M1738.688 798.998c-4.375 6.495-8.906 12.953-13.803 19.121-6.771 8.528-13.519 17.11-20.864 25.131-3.958 4.322-9.141 7.523-13.925 11.54-8.036-13.464-16.465-26.844-27.999-38.387 5.988-6.951 12.094-13.629 18.261-20.25l19.547-20.95 38.783 23.794z"></path><path fill="#ec6168" d="M1239.583 703.142c3.282 1.805 6.441 3.576 9.217 5.821 5.88 4.755 11.599 9.713 17.313 14.669l22.373 19.723c1.781 1.622 3.2 3.806 4.307 5.975 3.843 7.532 7.477 15.171 11.194 23.136-10.764 4.67-21.532 8.973-32.69 12.982l-22.733-27.366c-2.003-2.416-4.096-4.758-6.194-7.093-3.539-3.94-6.927-8.044-10.74-11.701-2.57-2.465-5.762-4.283-8.675-6.39l16.627-29.755z"></path><path fill="#ec663e" d="M1351.006 332.839l-28.499 10.33c-.294.107-.533.367-1.194.264-11.067-19.018-27.026-32.559-44.225-44.855-4.267-3.051-8.753-5.796-13.138-8.682l9.505-24.505c10.055 4.069 19.821 8.227 29.211 13.108 3.998 2.078 7.299 5.565 10.753 8.598 3.077 2.701 5.743 5.891 8.926 8.447 4.116 3.304 9.787 5.345 12.62 9.432 6.083 8.777 10.778 18.517 16.041 27.863z"></path><path fill="#eb5e5b" d="M1222.647 733.051c3.223 1.954 6.415 3.771 8.985 6.237 3.813 3.658 7.201 7.761 10.74 11.701l6.194 7.093 22.384 27.409c-13.056 6.836-25.309 14.613-36.736 24.161l-39.323-44.7 24.494-27.846c1.072-1.224 1.974-2.598 3.264-4.056z"></path><path fill="#ea580e" d="M876.001 376.171c5.874 1.347 11.748 2.694 17.812 4.789-.81 5.265-2.687 9.791-2.639 14.296.124 11.469-4.458 20.383-12.73 27.863-2.075 1.877-3.659 4.286-5.668 6.248l-22.808 21.967c-.442.422-1.212.488-1.813.757l-23.113 10.389-9.875 4.514c-2.305-6.09-4.609-12.181-6.614-18.676 7.64-4.837 15.567-8.54 22.18-13.873 9.697-7.821 18.931-16.361 27.443-25.455 5.613-5.998 12.679-11.331 14.201-20.475.699-4.2 2.384-8.235 3.623-12.345z"></path><path fill="#e95514" d="M815.103 467.384c3.356-1.894 6.641-3.415 9.94-4.903l23.113-10.389c.6-.269 1.371-.335 1.813-.757l22.808-21.967c2.008-1.962 3.593-4.371 5.668-6.248 8.272-7.48 12.854-16.394 12.73-27.863-.049-4.505 1.828-9.031 2.847-13.956 5.427.559 10.836 1.526 16.609 2.68-1.863 17.245-10.272 32.119-16.91 47.544-2.387 5.546-7.239 10.223-11.588 14.69-7.753 7.962-15.978 15.464-24.011 23.152-.478.458-.944 1.002-1.525 1.269l-36.069 16.355c-2.076-6.402-3.783-12.81-5.425-19.607z"></path><path fill="#eb620b" d="M783.944 404.402c9.499-8.388 19.556-15.905 28.437-24.621 6.631-6.508 11.744-14.564 17.575-22.273 9.271 4.016 18.501 8.375 27.893 13.43-4.134 7.07-8.017 13.778-12.833 19.731-5.785 7.15-12.109 13.917-18.666 20.376-7.99 7.869-16.466 15.244-24.731 22.832l-17.674-29.475z"></path><path fill="#ea544c" d="M1197.986 854.686c-9.756-3.309-16.79-10.044-22.88-18.059l-28.001-36.417c8.601-5.939 17.348-11.563 26.758-17.075 1.615 1.026 2.639 1.876 3.505 2.865l26.664 30.44c3.723 4.139 7.995 7.785 12.017 11.656l-18.064 26.591z"></path><path fill="#ec6333" d="M1351.41 332.903c-5.667-9.409-10.361-19.149-16.445-27.926-2.833-4.087-8.504-6.128-12.62-9.432-3.184-2.555-5.849-5.745-8.926-8.447-3.454-3.033-6.756-6.52-10.753-8.598-9.391-4.88-19.157-9.039-29.138-13.499 1.18-5.441 2.727-10.873 4.81-16.607 11.918 4.674 24.209 8.261 34.464 14.962 14.239 9.304 29.011 18.453 39.595 32.464 2.386 3.159 5.121 6.077 7.884 8.923 6.564 6.764 10.148 14.927 11.723 24.093l-20.594 4.067z"></path><path fill="#eb5e5b" d="M1117 536.549c-6.113-4.702-9.965-11.44-11.917-18.955-2.292-8.819-4.066-17.74-9.467-25.337-4.327-6.085-3.122-13.382-4.6-20.088l-4.55-21.241c-1.59-8.054-3.172-16.118-4.422-24.23l-5.037-36.129c6.382-1.43 12.777-2.462 19.582-3.443 1.906 11.646 3.426 23.24 4.878 34.842.307 2.453.717 4.973.477 7.402-1.86 18.84 2.834 36.934 5.347 55.352 1.474 10.806 4.885 20.848 7.101 31.302 1.394 6.579 1.774 13.374 2.609 20.523z"></path><path fill="#ec644b" d="M1263.638 290.071c4.697 2.713 9.183 5.458 13.45 8.509 17.199 12.295 33.158 25.836 43.873 44.907-8.026 4.725-16.095 9.106-24.83 13.372-11.633-15.937-25.648-28.515-41.888-38.689-1.609-1.008-3.555-1.48-5.344-2.2 2.329-3.852 4.766-7.645 6.959-11.573l7.78-14.326z"></path><path fill="#eb5f2d" d="M1372.453 328.903c-2.025-9.233-5.608-17.396-12.172-24.16-2.762-2.846-5.498-5.764-7.884-8.923-10.584-14.01-25.356-23.16-39.595-32.464-10.256-6.701-22.546-10.289-34.284-15.312.325-5.246 1.005-10.444 2.027-15.863l47.529 22.394c.89.428 1.83.901 2.516 1.584l45.564 45.193c7.69 7.233 9.352 16.472 11.849 26.084-5.032.773-10.066 1.154-15.55 1.466z"></path><path fill="#e95a0f" d="M801.776 434.171c8.108-7.882 16.584-15.257 24.573-23.126 6.558-6.459 12.881-13.226 18.666-20.376 4.817-5.953 8.7-12.661 13.011-19.409 5.739 1.338 11.463 3.051 17.581 4.838-.845 4.183-2.53 8.219-3.229 12.418-1.522 9.144-8.588 14.477-14.201 20.475-8.512 9.094-17.745 17.635-27.443 25.455-6.613 5.333-14.54 9.036-22.223 13.51-2.422-4.469-4.499-8.98-6.735-13.786z"></path><path fill="#eb5e5b" d="M1248.533 316.002c2.155.688 4.101 1.159 5.71 2.168 16.24 10.174 30.255 22.752 41.532 38.727-7.166 5.736-14.641 11.319-22.562 16.731-1.16-1.277-1.684-2.585-2.615-3.46l-38.694-36.2 14.203-15.029c.803-.86 1.38-1.93 2.427-2.936z"></path><path fill="#eb5a57" d="M1216.359 827.958c-4.331-3.733-8.603-7.379-12.326-11.518l-26.664-30.44c-.866-.989-1.89-1.839-3.152-2.902 6.483-6.054 13.276-11.959 20.371-18.005l39.315 44.704c-5.648 6.216-11.441 12.12-17.544 18.161z"></path><path fill="#ec6168" d="M1231.598 334.101l38.999 36.066c.931.876 1.456 2.183 2.303 3.608-4.283 4.279-8.7 8.24-13.769 12.091-4.2-3.051-7.512-6.349-11.338-8.867-12.36-8.136-22.893-18.27-32.841-29.093l16.646-13.805z"></path><path fill="#ed656e" d="M1214.597 347.955c10.303 10.775 20.836 20.908 33.196 29.044 3.825 2.518 7.137 5.816 10.992 8.903-3.171 4.397-6.65 8.648-10.432 13.046-6.785-5.184-13.998-9.858-19.529-16.038-4.946-5.527-9.687-8.644-17.309-8.215-2.616.147-5.734-2.788-8.067-4.923-3.026-2.769-5.497-6.144-8.35-9.568 6.286-4.273 12.715-8.237 19.499-12.25z"></path></svg> </p> <p align="center"> <b>The crispy sentence embedding family from <a href="https://mixedbread.ai"><b>Mixedbread</b></a>.</b> </p> # mxbai-embed-large-v1 Here, we provide several ways to produce sentence embeddings. Please note that you have to provide the prompt `Represent this sentence for searching relevant passages:` for query if you want to use it for retrieval. Besides that you don't need any prompt. Our model also supports [Matryoshka Representation Learning and binary quantization](https://www.mixedbread.ai/blog/binary-mrl). ## Quickstart Here, we provide several ways to produce sentence embeddings. Please note that you have to provide the prompt `Represent this sentence for searching relevant passages:` for query if you want to use it for retrieval. Besides that you don't need any prompt. ### sentence-transformers ``` python -m pip install -U sentence-transformers ``` ```python from sentence_transformers import SentenceTransformer from sentence_transformers.util import cos_sim from sentence_transformers.quantization import quantize_embeddings # 1. Specify preffered dimensions dimensions = 512 # 2. load model model = SentenceTransformer("mixedbread-ai/mxbai-embed-large-v1", truncate_dim=dimensions) # For retrieval you need to pass this prompt. query = 'Represent this sentence for searching relevant passages: A man is eating a piece of bread' docs = [ query, "A man is eating food.", "A man is eating pasta.", "The girl is carrying a baby.", "A man is riding a horse.", ] # 2. Encode embeddings = model.encode(docs) # Optional: Quantize the embeddings binary_embeddings = quantize_embeddings(embeddings, precision="ubinary") similarities = cos_sim(embeddings[0], embeddings[1:]) print('similarities:', similarities) ``` ### Transformers ```python from typing import Dict import torch import numpy as np from transformers import AutoModel, AutoTokenizer from sentence_transformers.util import cos_sim # For retrieval you need to pass this prompt. Please find our more in our blog post. def transform_query(query: str) -> str: """ For retrieval, add the prompt for query (not for documents). """ return f'Represent this sentence for searching relevant passages: {query}' # The model works really well with cls pooling (default) but also with mean pooling. def pooling(outputs: torch.Tensor, inputs: Dict, strategy: str = 'cls') -> np.ndarray: if strategy == 'cls': outputs = outputs[:, 0] elif strategy == 'mean': outputs = torch.sum( outputs * inputs["attention_mask"][:, :, None], dim=1) / torch.sum(inputs["attention_mask"], dim=1, keepdim=True) else: raise NotImplementedError return outputs.detach().cpu().numpy() # 1. load model model_id = 'mixedbread-ai/mxbai-embed-large-v1' tokenizer = AutoTokenizer.from_pretrained(model_id) model = AutoModel.from_pretrained(model_id).cuda() docs = [ transform_query('A man is eating a piece of bread'), "A man is eating food.", "A man is eating pasta.", "The girl is carrying a baby.", "A man is riding a horse.", ] # 2. encode inputs = tokenizer(docs, padding=True, return_tensors='pt') for k, v in inputs.items(): inputs[k] = v.cuda() outputs = model(**inputs).last_hidden_state embeddings = pooling(outputs, inputs, 'cls') similarities = cos_sim(embeddings[0], embeddings[1:]) print('similarities:', similarities) ``` ### Transformers.js If you haven't already, you can install the [Transformers.js](https://huggingface.co/docs/transformers.js) JavaScript library from [NPM](https://www.npmjs.com/package/@xenova/transformers) using: ```bash npm i @xenova/transformers ``` You can then use the model to compute embeddings like this: ```js import { pipeline, cos_sim } from '@xenova/transformers'; // Create a feature extraction pipeline const extractor = await pipeline('feature-extraction', 'mixedbread-ai/mxbai-embed-large-v1', { quantized: false, // Comment out this line to use the quantized version }); // Generate sentence embeddings const docs = [ 'Represent this sentence for searching relevant passages: A man is eating a piece of bread', 'A man is eating food.', 'A man is eating pasta.', 'The girl is carrying a baby.', 'A man is riding a horse.', ] const output = await extractor(docs, { pooling: 'cls' }); // Compute similarity scores const [source_embeddings, ...document_embeddings ] = output.tolist(); const similarities = document_embeddings.map(x => cos_sim(source_embeddings, x)); console.log(similarities); // [0.7919578577247139, 0.6369278664248345, 0.16512018371357193, 0.3620778366720027] ``` ### Using API You can use the model via our API as follows: ```python from mixedbread_ai.client import MixedbreadAI, EncodingFormat from sklearn.metrics.pairwise import cosine_similarity import os mxbai = MixedbreadAI(api_key="{MIXEDBREAD_API_KEY}") english_sentences = [ 'What is the capital of Australia?', 'Canberra is the capital of Australia.' ] res = mxbai.embeddings( input=english_sentences, model="mixedbread-ai/mxbai-embed-large-v1", normalized=True, encoding_format=[EncodingFormat.FLOAT, EncodingFormat.UBINARY, EncodingFormat.INT_8], dimensions=512 ) encoded_embeddings = res.data[0].embedding print(res.dimensions, encoded_embeddings.ubinary, encoded_embeddings.float_, encoded_embeddings.int_8) ``` The API comes with native int8 and binary quantization support! Check out the [docs](https://mixedbread.ai/docs) for more information. ## Evaluation As of March 2024, our model archives SOTA performance for Bert-large sized models on the [MTEB](https://huggingface.co/spaces/mteb/leaderboard). It ourperforms commercial models like OpenAIs text-embedding-3-large and matches the performance of model 20x it's size like the [echo-mistral-7b](https://huggingface.co/jspringer/echo-mistral-7b-instruct-lasttoken). Our model was trained with no overlap of the MTEB data, which indicates that our model generalizes well across several domains, tasks and text length. We know there are some limitations with this model, which will be fixed in v2. | Model | Avg (56 datasets) | Classification (12 datasets) | Clustering (11 datasets) | PairClassification (3 datasets) | Reranking (4 datasets) | Retrieval (15 datasets) | STS (10 datasets) | Summarization (1 dataset) | | --------------------------------------------------------------------------------------------- | ----------------- | ---------------------------- | ------------------------ | ------------------------------- | ---------------------- | ----------------------- | ----------------- | ------------------------- | | **mxbai-embed-large-v1** | **64.68** | 75.64 | 46.71 | 87.2 | 60.11 | 54.39 | 85.00 | 32.71 | | [bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | 64.23 | 75.97 | 46.08 | 87.12 | 60.03 | 54.29 | 83.11 | 31.61 | | [mxbai-embed-2d-large-v1](https://huggingface.co/mixedbread-ai/mxbai-embed-2d-large-v1) | 63.25 | 74.14 | 46.07 | 85.89 | 58.94 | 51.42 | 84.9 | 31.55 | | [nomic-embed-text-v1](https://huggingface.co/nomic-ai/nomic-embed-text-v1) | 62.39 | 74.12 | 43.91 | 85.15 | 55.69 | 52.81 | 82.06 | 30.08 | | [jina-embeddings-v2-base-en](https://huggingface.co/jinaai/jina-embeddings-v2-base-en) | 60.38 | 73.45 | 41.73 | 85.38 | 56.98 | 47.87 | 80.7 | 31.6 | | *Proprietary Models* | | | | | | | | | | [OpenAI text-embedding-3-large](https://openai.com/blog/new-embedding-models-and-api-updates) | 64.58 | 75.45 | 49.01 | 85.72 | 59.16 | 55.44 | 81.73 | 29.92 | | [Cohere embed-english-v3.0](https://txt.cohere.com/introducing-embed-v3/) | 64.47 | 76.49 | 47.43 | 85.84 | 58.01 | 55.00 | 82.62 | 30.18 | | [OpenAI text-embedding-ada-002](https://openai.com/blog/new-and-improved-embedding-model) | 60.99 | 70.93 | 45.90 | 84.89 | 56.32 | 49.25 | 80.97 | 30.80 | Please find more information in our [blog post](https://mixedbread.ai/blog/mxbai-embed-large-v1). ## Matryoshka and Binary Quantization Embeddings in their commonly used form (float arrays) have a high memory footprint when used at scale. Two approaches to solve this problem are Matryoshka Representation Learning (MRL) and (Binary) Quantization. While MRL reduces the number of dimensions of an embedding, binary quantization transforms the value of each dimension from a float32 into a lower precision (int8 or even binary). <b> The model supports both approaches! </b> You can also take it one step further, and combine both MRL and quantization. This combination of binary quantization and MRL allows you to reduce the memory usage of your embeddings significantly. This leads to much lower costs when using a vector database in particular. You can read more about the technology and its advantages in our [blog post](https://www.mixedbread.ai/blog/binary-mrl). ## Community Please join our [Discord Community](https://discord.gg/jDfMHzAVfU) and share your feedback and thoughts! We are here to help and also always happy to chat. ## License Apache 2.0 ## Citation ```bibtex @online{emb2024mxbai, title={Open Source Strikes Bread - New Fluffy Embeddings Model}, author={Sean Lee and Aamir Shakir and Darius Koenig and Julius Lipp}, year={2024}, url={https://www.mixedbread.ai/blog/mxbai-embed-large-v1}, } @article{li2023angle, title={AnglE-optimized Text Embeddings}, author={Li, Xianming and Li, Jing}, journal={arXiv preprint arXiv:2309.12871}, year={2023} } ```

MattyB95/AST-VoxCelebSpoof-Synthetic-Voice-Detection

MattyB95

transformers

audio-classification

--- license: mit base_model: MIT/ast-finetuned-audioset-10-10-0.4593 tags: - generated_from_trainer metrics: - accuracy - f1 - precision - recall model-index: - name: AST-VoxCelebSpoof-Synthetic-Voice-Detection results: [] datasets: - MattyB95/VoxCelebSpoof language: - en --- <!-- This model card has been generated automatically according to the information the Trainer had access to. You should probably proofread and complete it, then remove this comment. --> # AST-VoxCelebSpoof-Synthetic-Voice-Detection This model is a fine-tuned version of [MIT/ast-finetuned-audioset-10-10-0.4593](https://huggingface.co/MIT/ast-finetuned-audioset-10-10-0.4593) on the None dataset. It achieves the following results on the evaluation set: - Loss: 89136693248.0 - Accuracy: 0.9999 - F1: 0.9999 - Precision: 1.0 - Recall: 0.9998 ## Model description More information needed ## Intended uses & limitations More information needed ## Training and evaluation data More information needed ## Training procedure ### Training hyperparameters The following hyperparameters were used during training: - learning_rate: 5e-05 - train_batch_size: 8 - eval_batch_size: 8 - seed: 42 - optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 - lr_scheduler_type: linear - num_epochs: 3.0 ### Training results | Training Loss | Epoch | Step | Validation Loss | Accuracy | F1 | Precision | Recall | |:-----------------:|:-----:|:-----:|:---------------:|:--------:|:------:|:---------:|:------:| | 2218896740319.232 | 1.0 | 29527 | 611463921664.0 | 0.9998 | 0.9998 | 0.9999 | 0.9997 | | 522149441830.912 | 2.0 | 59054 | 284563668992.0 | 0.9997 | 0.9997 | 0.9999 | 0.9996 | | 0.0 | 3.0 | 88581 | 89136693248.0 | 0.9999 | 0.9999 | 1.0 | 0.9998 | ### Framework versions - Transformers 4.36.2 - Pytorch 2.1.2 - Datasets 2.16.1 - Tokenizers 0.15.0

Alibaba-NLP/gte-large-en-v1.5

Alibaba-NLP

transformers

sentence-similarity

--- datasets: - allenai/c4 library_name: transformers tags: - sentence-transformers - gte - mteb - transformers.js - sentence-similarity license: apache-2.0 language: - en model-index: - name: gte-large-en-v1.5 results: - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en) config: en split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 73.01492537313432 - type: ap value: 35.05341696659522 - type: f1 value: 66.71270310883853 - task: type: Classification dataset: type: mteb/amazon_polarity name: MTEB AmazonPolarityClassification config: default split: test revision: e2d317d38cd51312af73b3d32a06d1a08b442046 metrics: - type: accuracy value: 93.97189999999999 - type: ap value: 90.5952493948908 - type: f1 value: 93.95848137716877 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (en) config: en split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 54.196 - type: f1 value: 53.80122334012787 - task: type: Retrieval dataset: type: mteb/arguana name: MTEB ArguAna config: default split: test revision: c22ab2a51041ffd869aaddef7af8d8215647e41a metrics: - type: map_at_1 value: 47.297 - type: map_at_10 value: 64.303 - type: map_at_100 value: 64.541 - type: map_at_1000 value: 64.541 - type: map_at_3 value: 60.728 - type: map_at_5 value: 63.114000000000004 - type: mrr_at_1 value: 48.435 - type: mrr_at_10 value: 64.657 - type: mrr_at_100 value: 64.901 - type: mrr_at_1000 value: 64.901 - type: mrr_at_3 value: 61.06 - type: mrr_at_5 value: 63.514 - type: ndcg_at_1 value: 47.297 - type: ndcg_at_10 value: 72.107 - type: ndcg_at_100 value: 72.963 - type: ndcg_at_1000 value: 72.963 - type: ndcg_at_3 value: 65.063 - type: ndcg_at_5 value: 69.352 - type: precision_at_1 value: 47.297 - type: precision_at_10 value: 9.623 - type: precision_at_100 value: 0.996 - type: precision_at_1000 value: 0.1 - type: precision_at_3 value: 25.865 - type: precision_at_5 value: 17.596 - type: recall_at_1 value: 47.297 - type: recall_at_10 value: 96.23 - type: recall_at_100 value: 99.644 - type: recall_at_1000 value: 99.644 - type: recall_at_3 value: 77.596 - type: recall_at_5 value: 87.98 - task: type: Clustering dataset: type: mteb/arxiv-clustering-p2p name: MTEB ArxivClusteringP2P config: default split: test revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d metrics: - type: v_measure value: 48.467787861077475 - task: type: Clustering dataset: type: mteb/arxiv-clustering-s2s name: MTEB ArxivClusteringS2S config: default split: test revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 metrics: - type: v_measure value: 43.39198391914257 - task: type: Reranking dataset: type: mteb/askubuntudupquestions-reranking name: MTEB AskUbuntuDupQuestions config: default split: test revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 metrics: - type: map value: 63.12794820591384 - type: mrr value: 75.9331442641692 - task: type: STS dataset: type: mteb/biosses-sts name: MTEB BIOSSES config: default split: test revision: d3fb88f8f02e40887cd149695127462bbcf29b4a metrics: - type: cos_sim_pearson value: 87.85062993863319 - type: cos_sim_spearman value: 85.39049989733459 - type: euclidean_pearson value: 86.00222680278333 - type: euclidean_spearman value: 85.45556162077396 - type: manhattan_pearson value: 85.88769871785621 - type: manhattan_spearman value: 85.11760211290839 - task: type: Classification dataset: type: mteb/banking77 name: MTEB Banking77Classification config: default split: test revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 metrics: - type: accuracy value: 87.32792207792208 - type: f1 value: 87.29132945999555 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-p2p name: MTEB BiorxivClusteringP2P config: default split: test revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 metrics: - type: v_measure value: 40.5779328301945 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-s2s name: MTEB BiorxivClusteringS2S config: default split: test revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 metrics: - type: v_measure value: 37.94425623865118 - task: type: Retrieval dataset: type: mteb/cqadupstack-android name: MTEB CQADupstackAndroidRetrieval config: default split: test revision: f46a197baaae43b4f621051089b82a364682dfeb metrics: - type: map_at_1 value: 32.978 - type: map_at_10 value: 44.45 - type: map_at_100 value: 46.19 - type: map_at_1000 value: 46.303 - type: map_at_3 value: 40.849000000000004 - type: map_at_5 value: 42.55 - type: mrr_at_1 value: 40.629 - type: mrr_at_10 value: 50.848000000000006 - type: mrr_at_100 value: 51.669 - type: mrr_at_1000 value: 51.705 - type: mrr_at_3 value: 47.997 - type: mrr_at_5 value: 49.506 - type: ndcg_at_1 value: 40.629 - type: ndcg_at_10 value: 51.102000000000004 - type: ndcg_at_100 value: 57.159000000000006 - type: ndcg_at_1000 value: 58.669000000000004 - type: ndcg_at_3 value: 45.738 - type: ndcg_at_5 value: 47.632999999999996 - type: precision_at_1 value: 40.629 - type: precision_at_10 value: 9.700000000000001 - type: precision_at_100 value: 1.5970000000000002 - type: precision_at_1000 value: 0.202 - type: precision_at_3 value: 21.698 - type: precision_at_5 value: 15.393 - type: recall_at_1 value: 32.978 - type: recall_at_10 value: 63.711 - type: recall_at_100 value: 88.39399999999999 - type: recall_at_1000 value: 97.513 - type: recall_at_3 value: 48.025 - type: recall_at_5 value: 53.52 - task: type: Retrieval dataset: type: mteb/cqadupstack-english name: MTEB CQADupstackEnglishRetrieval config: default split: test revision: ad9991cb51e31e31e430383c75ffb2885547b5f0 metrics: - type: map_at_1 value: 30.767 - type: map_at_10 value: 42.195 - type: map_at_100 value: 43.541999999999994 - type: map_at_1000 value: 43.673 - type: map_at_3 value: 38.561 - type: map_at_5 value: 40.532000000000004 - type: mrr_at_1 value: 38.79 - type: mrr_at_10 value: 48.021 - type: mrr_at_100 value: 48.735 - type: mrr_at_1000 value: 48.776 - type: mrr_at_3 value: 45.594 - type: mrr_at_5 value: 46.986 - type: ndcg_at_1 value: 38.79 - type: ndcg_at_10 value: 48.468 - type: ndcg_at_100 value: 53.037 - type: ndcg_at_1000 value: 55.001999999999995 - type: ndcg_at_3 value: 43.409 - type: ndcg_at_5 value: 45.654 - type: precision_at_1 value: 38.79 - type: precision_at_10 value: 9.452 - type: precision_at_100 value: 1.518 - type: precision_at_1000 value: 0.201 - type: precision_at_3 value: 21.21 - type: precision_at_5 value: 15.171999999999999 - type: recall_at_1 value: 30.767 - type: recall_at_10 value: 60.118 - type: recall_at_100 value: 79.271 - type: recall_at_1000 value: 91.43299999999999 - type: recall_at_3 value: 45.36 - type: recall_at_5 value: 51.705 - task: type: Retrieval dataset: type: mteb/cqadupstack-gaming name: MTEB CQADupstackGamingRetrieval config: default split: test revision: 4885aa143210c98657558c04aaf3dc47cfb54340 metrics: - type: map_at_1 value: 40.007 - type: map_at_10 value: 53.529 - type: map_at_100 value: 54.602 - type: map_at_1000 value: 54.647 - type: map_at_3 value: 49.951 - type: map_at_5 value: 52.066 - type: mrr_at_1 value: 45.705 - type: mrr_at_10 value: 56.745000000000005 - type: mrr_at_100 value: 57.43899999999999 - type: mrr_at_1000 value: 57.462999999999994 - type: mrr_at_3 value: 54.25299999999999 - type: mrr_at_5 value: 55.842000000000006 - type: ndcg_at_1 value: 45.705 - type: ndcg_at_10 value: 59.809 - type: ndcg_at_100 value: 63.837999999999994 - type: ndcg_at_1000 value: 64.729 - type: ndcg_at_3 value: 53.994 - type: ndcg_at_5 value: 57.028 - type: precision_at_1 value: 45.705 - type: precision_at_10 value: 9.762 - type: precision_at_100 value: 1.275 - type: precision_at_1000 value: 0.13899999999999998 - type: precision_at_3 value: 24.368000000000002 - type: precision_at_5 value: 16.84 - type: recall_at_1 value: 40.007 - type: recall_at_10 value: 75.017 - type: recall_at_100 value: 91.99000000000001 - type: recall_at_1000 value: 98.265 - type: recall_at_3 value: 59.704 - type: recall_at_5 value: 67.109 - task: type: Retrieval dataset: type: mteb/cqadupstack-gis name: MTEB CQADupstackGisRetrieval config: default split: test revision: 5003b3064772da1887988e05400cf3806fe491f2 metrics: - type: map_at_1 value: 26.639000000000003 - type: map_at_10 value: 35.926 - type: map_at_100 value: 37.126999999999995 - type: map_at_1000 value: 37.202 - type: map_at_3 value: 32.989000000000004 - type: map_at_5 value: 34.465 - type: mrr_at_1 value: 28.475 - type: mrr_at_10 value: 37.7 - type: mrr_at_100 value: 38.753 - type: mrr_at_1000 value: 38.807 - type: mrr_at_3 value: 35.066 - type: mrr_at_5 value: 36.512 - type: ndcg_at_1 value: 28.475 - type: ndcg_at_10 value: 41.245 - type: ndcg_at_100 value: 46.814 - type: ndcg_at_1000 value: 48.571 - type: ndcg_at_3 value: 35.528999999999996 - type: ndcg_at_5 value: 38.066 - type: precision_at_1 value: 28.475 - type: precision_at_10 value: 6.497 - type: precision_at_100 value: 0.9650000000000001 - type: precision_at_1000 value: 0.11499999999999999 - type: precision_at_3 value: 15.065999999999999 - type: precision_at_5 value: 10.599 - type: recall_at_1 value: 26.639000000000003 - type: recall_at_10 value: 55.759 - type: recall_at_100 value: 80.913 - type: recall_at_1000 value: 93.929 - type: recall_at_3 value: 40.454 - type: recall_at_5 value: 46.439 - task: type: Retrieval dataset: type: mteb/cqadupstack-mathematica name: MTEB CQADupstackMathematicaRetrieval config: default split: test revision: 90fceea13679c63fe563ded68f3b6f06e50061de metrics: - type: map_at_1 value: 15.767999999999999 - type: map_at_10 value: 24.811 - type: map_at_100 value: 26.064999999999998 - type: map_at_1000 value: 26.186999999999998 - type: map_at_3 value: 21.736 - type: map_at_5 value: 23.283 - type: mrr_at_1 value: 19.527 - type: mrr_at_10 value: 29.179 - type: mrr_at_100 value: 30.153999999999996 - type: mrr_at_1000 value: 30.215999999999998 - type: mrr_at_3 value: 26.223000000000003 - type: mrr_at_5 value: 27.733999999999998 - type: ndcg_at_1 value: 19.527 - type: ndcg_at_10 value: 30.786 - type: ndcg_at_100 value: 36.644 - type: ndcg_at_1000 value: 39.440999999999995 - type: ndcg_at_3 value: 24.958 - type: ndcg_at_5 value: 27.392 - type: precision_at_1 value: 19.527 - type: precision_at_10 value: 5.995 - type: precision_at_100 value: 1.03 - type: precision_at_1000 value: 0.14100000000000001 - type: precision_at_3 value: 12.520999999999999 - type: precision_at_5 value: 9.129 - type: recall_at_1 value: 15.767999999999999 - type: recall_at_10 value: 44.824000000000005 - type: recall_at_100 value: 70.186 - type: recall_at_1000 value: 89.934 - type: recall_at_3 value: 28.607 - type: recall_at_5 value: 34.836 - task: type: Retrieval dataset: type: mteb/cqadupstack-physics name: MTEB CQADupstackPhysicsRetrieval config: default split: test revision: 79531abbd1fb92d06c6d6315a0cbbbf5bb247ea4 metrics: - type: map_at_1 value: 31.952 - type: map_at_10 value: 44.438 - type: map_at_100 value: 45.778 - type: map_at_1000 value: 45.883 - type: map_at_3 value: 41.044000000000004 - type: map_at_5 value: 42.986000000000004 - type: mrr_at_1 value: 39.172000000000004 - type: mrr_at_10 value: 49.76 - type: mrr_at_100 value: 50.583999999999996 - type: mrr_at_1000 value: 50.621 - type: mrr_at_3 value: 47.353 - type: mrr_at_5 value: 48.739 - type: ndcg_at_1 value: 39.172000000000004 - type: ndcg_at_10 value: 50.760000000000005 - type: ndcg_at_100 value: 56.084 - type: ndcg_at_1000 value: 57.865 - type: ndcg_at_3 value: 45.663 - type: ndcg_at_5 value: 48.178 - type: precision_at_1 value: 39.172000000000004 - type: precision_at_10 value: 9.22 - type: precision_at_100 value: 1.387 - type: precision_at_1000 value: 0.17099999999999999 - type: precision_at_3 value: 21.976000000000003 - type: precision_at_5 value: 15.457 - type: recall_at_1 value: 31.952 - type: recall_at_10 value: 63.900999999999996 - type: recall_at_100 value: 85.676 - type: recall_at_1000 value: 97.03699999999999 - type: recall_at_3 value: 49.781 - type: recall_at_5 value: 56.330000000000005 - task: type: Retrieval dataset: type: mteb/cqadupstack-programmers name: MTEB CQADupstackProgrammersRetrieval config: default split: test revision: 6184bc1440d2dbc7612be22b50686b8826d22b32 metrics: - type: map_at_1 value: 25.332 - type: map_at_10 value: 36.874 - type: map_at_100 value: 38.340999999999994 - type: map_at_1000 value: 38.452 - type: map_at_3 value: 33.068 - type: map_at_5 value: 35.324 - type: mrr_at_1 value: 30.822 - type: mrr_at_10 value: 41.641 - type: mrr_at_100 value: 42.519 - type: mrr_at_1000 value: 42.573 - type: mrr_at_3 value: 38.413000000000004 - type: mrr_at_5 value: 40.542 - type: ndcg_at_1 value: 30.822 - type: ndcg_at_10 value: 43.414 - type: ndcg_at_100 value: 49.196 - type: ndcg_at_1000 value: 51.237 - type: ndcg_at_3 value: 37.230000000000004 - type: ndcg_at_5 value: 40.405 - type: precision_at_1 value: 30.822 - type: precision_at_10 value: 8.379 - type: precision_at_100 value: 1.315 - type: precision_at_1000 value: 0.168 - type: precision_at_3 value: 18.417 - type: precision_at_5 value: 13.744 - type: recall_at_1 value: 25.332 - type: recall_at_10 value: 57.774 - type: recall_at_100 value: 82.071 - type: recall_at_1000 value: 95.60600000000001 - type: recall_at_3 value: 40.722 - type: recall_at_5 value: 48.754999999999995 - task: type: Retrieval dataset: type: mteb/cqadupstack name: MTEB CQADupstackRetrieval config: default split: test revision: 4ffe81d471b1924886b33c7567bfb200e9eec5c4 metrics: - type: map_at_1 value: 25.91033333333334 - type: map_at_10 value: 36.23225000000001 - type: map_at_100 value: 37.55766666666667 - type: map_at_1000 value: 37.672583333333336 - type: map_at_3 value: 32.95666666666667 - type: map_at_5 value: 34.73375 - type: mrr_at_1 value: 30.634 - type: mrr_at_10 value: 40.19449999999999 - type: mrr_at_100 value: 41.099250000000005 - type: mrr_at_1000 value: 41.15091666666667 - type: mrr_at_3 value: 37.4615 - type: mrr_at_5 value: 39.00216666666667 - type: ndcg_at_1 value: 30.634 - type: ndcg_at_10 value: 42.162166666666664 - type: ndcg_at_100 value: 47.60708333333333 - type: ndcg_at_1000 value: 49.68616666666666 - type: ndcg_at_3 value: 36.60316666666666 - type: ndcg_at_5 value: 39.15616666666668 - type: precision_at_1 value: 30.634 - type: precision_at_10 value: 7.6193333333333335 - type: precision_at_100 value: 1.2198333333333333 - type: precision_at_1000 value: 0.15975000000000003 - type: precision_at_3 value: 17.087 - type: precision_at_5 value: 12.298333333333334 - type: recall_at_1 value: 25.91033333333334 - type: recall_at_10 value: 55.67300000000001 - type: recall_at_100 value: 79.20608333333334 - type: recall_at_1000 value: 93.34866666666667 - type: recall_at_3 value: 40.34858333333333 - type: recall_at_5 value: 46.834083333333325 - task: type: Retrieval dataset: type: mteb/cqadupstack-stats name: MTEB CQADupstackStatsRetrieval config: default split: test revision: 65ac3a16b8e91f9cee4c9828cc7c335575432a2a metrics: - type: map_at_1 value: 25.006 - type: map_at_10 value: 32.177 - type: map_at_100 value: 33.324999999999996 - type: map_at_1000 value: 33.419 - type: map_at_3 value: 29.952 - type: map_at_5 value: 31.095 - type: mrr_at_1 value: 28.066999999999997 - type: mrr_at_10 value: 34.995 - type: mrr_at_100 value: 35.978 - type: mrr_at_1000 value: 36.042 - type: mrr_at_3 value: 33.103 - type: mrr_at_5 value: 34.001 - type: ndcg_at_1 value: 28.066999999999997 - type: ndcg_at_10 value: 36.481 - type: ndcg_at_100 value: 42.022999999999996 - type: ndcg_at_1000 value: 44.377 - type: ndcg_at_3 value: 32.394 - type: ndcg_at_5 value: 34.108 - type: precision_at_1 value: 28.066999999999997 - type: precision_at_10 value: 5.736 - type: precision_at_100 value: 0.9259999999999999 - type: precision_at_1000 value: 0.12 - type: precision_at_3 value: 13.804 - type: precision_at_5 value: 9.508999999999999 - type: recall_at_1 value: 25.006 - type: recall_at_10 value: 46.972 - type: recall_at_100 value: 72.138 - type: recall_at_1000 value: 89.479 - type: recall_at_3 value: 35.793 - type: recall_at_5 value: 39.947 - task: type: Retrieval dataset: type: mteb/cqadupstack-tex name: MTEB CQADupstackTexRetrieval config: default split: test revision: 46989137a86843e03a6195de44b09deda022eec7 metrics: - type: map_at_1 value: 16.07 - type: map_at_10 value: 24.447 - type: map_at_100 value: 25.685999999999996 - type: map_at_1000 value: 25.813999999999997 - type: map_at_3 value: 21.634 - type: map_at_5 value: 23.133 - type: mrr_at_1 value: 19.580000000000002 - type: mrr_at_10 value: 28.127999999999997 - type: mrr_at_100 value: 29.119 - type: mrr_at_1000 value: 29.192 - type: mrr_at_3 value: 25.509999999999998 - type: mrr_at_5 value: 26.878 - type: ndcg_at_1 value: 19.580000000000002 - type: ndcg_at_10 value: 29.804000000000002 - type: ndcg_at_100 value: 35.555 - type: ndcg_at_1000 value: 38.421 - type: ndcg_at_3 value: 24.654999999999998 - type: ndcg_at_5 value: 26.881 - type: precision_at_1 value: 19.580000000000002 - type: precision_at_10 value: 5.736 - type: precision_at_100 value: 1.005 - type: precision_at_1000 value: 0.145 - type: precision_at_3 value: 12.033000000000001 - type: precision_at_5 value: 8.871 - type: recall_at_1 value: 16.07 - type: recall_at_10 value: 42.364000000000004 - type: recall_at_100 value: 68.01899999999999 - type: recall_at_1000 value: 88.122 - type: recall_at_3 value: 27.846 - type: recall_at_5 value: 33.638 - task: type: Retrieval dataset: type: mteb/cqadupstack-unix name: MTEB CQADupstackUnixRetrieval config: default split: test revision: 6c6430d3a6d36f8d2a829195bc5dc94d7e063e53 metrics: - type: map_at_1 value: 26.365 - type: map_at_10 value: 36.591 - type: map_at_100 value: 37.730000000000004 - type: map_at_1000 value: 37.84 - type: map_at_3 value: 33.403 - type: map_at_5 value: 35.272999999999996 - type: mrr_at_1 value: 30.503999999999998 - type: mrr_at_10 value: 39.940999999999995 - type: mrr_at_100 value: 40.818 - type: mrr_at_1000 value: 40.876000000000005 - type: mrr_at_3 value: 37.065 - type: mrr_at_5 value: 38.814 - type: ndcg_at_1 value: 30.503999999999998 - type: ndcg_at_10 value: 42.185 - type: ndcg_at_100 value: 47.416000000000004 - type: ndcg_at_1000 value: 49.705 - type: ndcg_at_3 value: 36.568 - type: ndcg_at_5 value: 39.416000000000004 - type: precision_at_1 value: 30.503999999999998 - type: precision_at_10 value: 7.276000000000001 - type: precision_at_100 value: 1.118 - type: precision_at_1000 value: 0.14300000000000002 - type: precision_at_3 value: 16.729 - type: precision_at_5 value: 12.107999999999999 - type: recall_at_1 value: 26.365 - type: recall_at_10 value: 55.616 - type: recall_at_100 value: 78.129 - type: recall_at_1000 value: 93.95599999999999 - type: recall_at_3 value: 40.686 - type: recall_at_5 value: 47.668 - task: type: Retrieval dataset: type: mteb/cqadupstack-webmasters name: MTEB CQADupstackWebmastersRetrieval config: default split: test revision: 160c094312a0e1facb97e55eeddb698c0abe3571 metrics: - type: map_at_1 value: 22.750999999999998 - type: map_at_10 value: 33.446 - type: map_at_100 value: 35.235 - type: map_at_1000 value: 35.478 - type: map_at_3 value: 29.358 - type: map_at_5 value: 31.525 - type: mrr_at_1 value: 27.668 - type: mrr_at_10 value: 37.694 - type: mrr_at_100 value: 38.732 - type: mrr_at_1000 value: 38.779 - type: mrr_at_3 value: 34.223 - type: mrr_at_5 value: 36.08 - type: ndcg_at_1 value: 27.668 - type: ndcg_at_10 value: 40.557 - type: ndcg_at_100 value: 46.605999999999995 - type: ndcg_at_1000 value: 48.917 - type: ndcg_at_3 value: 33.677 - type: ndcg_at_5 value: 36.85 - type: precision_at_1 value: 27.668 - type: precision_at_10 value: 8.3 - type: precision_at_100 value: 1.6260000000000001 - type: precision_at_1000 value: 0.253 - type: precision_at_3 value: 16.008 - type: precision_at_5 value: 12.292 - type: recall_at_1 value: 22.750999999999998 - type: recall_at_10 value: 55.643 - type: recall_at_100 value: 82.151 - type: recall_at_1000 value: 95.963 - type: recall_at_3 value: 36.623 - type: recall_at_5 value: 44.708 - task: type: Retrieval dataset: type: mteb/cqadupstack-wordpress name: MTEB CQADupstackWordpressRetrieval config: default split: test revision: 4ffe81d471b1924886b33c7567bfb200e9eec5c4 metrics: - type: map_at_1 value: 17.288999999999998 - type: map_at_10 value: 25.903 - type: map_at_100 value: 27.071 - type: map_at_1000 value: 27.173000000000002 - type: map_at_3 value: 22.935 - type: map_at_5 value: 24.573 - type: mrr_at_1 value: 18.669 - type: mrr_at_10 value: 27.682000000000002 - type: mrr_at_100 value: 28.691 - type: mrr_at_1000 value: 28.761 - type: mrr_at_3 value: 24.738 - type: mrr_at_5 value: 26.392 - type: ndcg_at_1 value: 18.669 - type: ndcg_at_10 value: 31.335 - type: ndcg_at_100 value: 36.913000000000004 - type: ndcg_at_1000 value: 39.300000000000004 - type: ndcg_at_3 value: 25.423000000000002 - type: ndcg_at_5 value: 28.262999999999998 - type: precision_at_1 value: 18.669 - type: precision_at_10 value: 5.379 - type: precision_at_100 value: 0.876 - type: precision_at_1000 value: 0.11900000000000001 - type: precision_at_3 value: 11.214 - type: precision_at_5 value: 8.466 - type: recall_at_1 value: 17.288999999999998 - type: recall_at_10 value: 46.377 - type: recall_at_100 value: 71.53500000000001 - type: recall_at_1000 value: 88.947 - type: recall_at_3 value: 30.581999999999997 - type: recall_at_5 value: 37.354 - task: type: Retrieval dataset: type: mteb/climate-fever name: MTEB ClimateFEVER config: default split: test revision: 47f2ac6acb640fc46020b02a5b59fdda04d39380 metrics: - type: map_at_1 value: 21.795 - type: map_at_10 value: 37.614999999999995 - type: map_at_100 value: 40.037 - type: map_at_1000 value: 40.184999999999995 - type: map_at_3 value: 32.221 - type: map_at_5 value: 35.154999999999994 - type: mrr_at_1 value: 50.358000000000004 - type: mrr_at_10 value: 62.129 - type: mrr_at_100 value: 62.613 - type: mrr_at_1000 value: 62.62 - type: mrr_at_3 value: 59.272999999999996 - type: mrr_at_5 value: 61.138999999999996 - type: ndcg_at_1 value: 50.358000000000004 - type: ndcg_at_10 value: 48.362 - type: ndcg_at_100 value: 55.932 - type: ndcg_at_1000 value: 58.062999999999995 - type: ndcg_at_3 value: 42.111 - type: ndcg_at_5 value: 44.063 - type: precision_at_1 value: 50.358000000000004 - type: precision_at_10 value: 14.677999999999999 - type: precision_at_100 value: 2.2950000000000004 - type: precision_at_1000 value: 0.271 - type: precision_at_3 value: 31.77 - type: precision_at_5 value: 23.375 - type: recall_at_1 value: 21.795 - type: recall_at_10 value: 53.846000000000004 - type: recall_at_100 value: 78.952 - type: recall_at_1000 value: 90.41900000000001 - type: recall_at_3 value: 37.257 - type: recall_at_5 value: 44.661 - task: type: Retrieval dataset: type: mteb/dbpedia name: MTEB DBPedia config: default split: test revision: c0f706b76e590d620bd6618b3ca8efdd34e2d659 metrics: - type: map_at_1 value: 9.728 - type: map_at_10 value: 22.691 - type: map_at_100 value: 31.734 - type: map_at_1000 value: 33.464 - type: map_at_3 value: 16.273 - type: map_at_5 value: 19.016 - type: mrr_at_1 value: 73.25 - type: mrr_at_10 value: 80.782 - type: mrr_at_100 value: 81.01899999999999 - type: mrr_at_1000 value: 81.021 - type: mrr_at_3 value: 79.583 - type: mrr_at_5 value: 80.146 - type: ndcg_at_1 value: 59.62499999999999 - type: ndcg_at_10 value: 46.304 - type: ndcg_at_100 value: 51.23 - type: ndcg_at_1000 value: 58.048 - type: ndcg_at_3 value: 51.541000000000004 - type: ndcg_at_5 value: 48.635 - type: precision_at_1 value: 73.25 - type: precision_at_10 value: 36.375 - type: precision_at_100 value: 11.53 - type: precision_at_1000 value: 2.23 - type: precision_at_3 value: 55.583000000000006 - type: precision_at_5 value: 47.15 - type: recall_at_1 value: 9.728 - type: recall_at_10 value: 28.793999999999997 - type: recall_at_100 value: 57.885 - type: recall_at_1000 value: 78.759 - type: recall_at_3 value: 17.79 - type: recall_at_5 value: 21.733 - task: type: Classification dataset: type: mteb/emotion name: MTEB EmotionClassification config: default split: test revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 metrics: - type: accuracy value: 46.775 - type: f1 value: 41.89794273264891 - task: type: Retrieval dataset: type: mteb/fever name: MTEB FEVER config: default split: test revision: bea83ef9e8fb933d90a2f1d5515737465d613e12 metrics: - type: map_at_1 value: 85.378 - type: map_at_10 value: 91.51 - type: map_at_100 value: 91.666 - type: map_at_1000 value: 91.676 - type: map_at_3 value: 90.757 - type: map_at_5 value: 91.277 - type: mrr_at_1 value: 91.839 - type: mrr_at_10 value: 95.49 - type: mrr_at_100 value: 95.493 - type: mrr_at_1000 value: 95.493 - type: mrr_at_3 value: 95.345 - type: mrr_at_5 value: 95.47200000000001 - type: ndcg_at_1 value: 91.839 - type: ndcg_at_10 value: 93.806 - type: ndcg_at_100 value: 94.255 - type: ndcg_at_1000 value: 94.399 - type: ndcg_at_3 value: 93.027 - type: ndcg_at_5 value: 93.51 - type: precision_at_1 value: 91.839 - type: precision_at_10 value: 10.93 - type: precision_at_100 value: 1.1400000000000001 - type: precision_at_1000 value: 0.117 - type: precision_at_3 value: 34.873 - type: precision_at_5 value: 21.44 - type: recall_at_1 value: 85.378 - type: recall_at_10 value: 96.814 - type: recall_at_100 value: 98.386 - type: recall_at_1000 value: 99.21600000000001 - type: recall_at_3 value: 94.643 - type: recall_at_5 value: 95.976 - task: type: Retrieval dataset: type: mteb/fiqa name: MTEB FiQA2018 config: default split: test revision: 27a168819829fe9bcd655c2df245fb19452e8e06 metrics: - type: map_at_1 value: 32.190000000000005 - type: map_at_10 value: 53.605000000000004 - type: map_at_100 value: 55.550999999999995 - type: map_at_1000 value: 55.665 - type: map_at_3 value: 46.62 - type: map_at_5 value: 50.517999999999994 - type: mrr_at_1 value: 60.34 - type: mrr_at_10 value: 70.775 - type: mrr_at_100 value: 71.238 - type: mrr_at_1000 value: 71.244 - type: mrr_at_3 value: 68.72399999999999 - type: mrr_at_5 value: 69.959 - type: ndcg_at_1 value: 60.34 - type: ndcg_at_10 value: 63.226000000000006 - type: ndcg_at_100 value: 68.60300000000001 - type: ndcg_at_1000 value: 69.901 - type: ndcg_at_3 value: 58.048 - type: ndcg_at_5 value: 59.789 - type: precision_at_1 value: 60.34 - type: precision_at_10 value: 17.130000000000003 - type: precision_at_100 value: 2.29 - type: precision_at_1000 value: 0.256 - type: precision_at_3 value: 38.323 - type: precision_at_5 value: 27.87 - type: recall_at_1 value: 32.190000000000005 - type: recall_at_10 value: 73.041 - type: recall_at_100 value: 91.31 - type: recall_at_1000 value: 98.104 - type: recall_at_3 value: 53.70399999999999 - type: recall_at_5 value: 62.358999999999995 - task: type: Retrieval dataset: type: mteb/hotpotqa name: MTEB HotpotQA config: default split: test revision: ab518f4d6fcca38d87c25209f94beba119d02014 metrics: - type: map_at_1 value: 43.511 - type: map_at_10 value: 58.15 - type: map_at_100 value: 58.95399999999999 - type: map_at_1000 value: 59.018 - type: map_at_3 value: 55.31700000000001 - type: map_at_5 value: 57.04900000000001 - type: mrr_at_1 value: 87.022 - type: mrr_at_10 value: 91.32000000000001 - type: mrr_at_100 value: 91.401 - type: mrr_at_1000 value: 91.403 - type: mrr_at_3 value: 90.77 - type: mrr_at_5 value: 91.156 - type: ndcg_at_1 value: 87.022 - type: ndcg_at_10 value: 68.183 - type: ndcg_at_100 value: 70.781 - type: ndcg_at_1000 value: 72.009 - type: ndcg_at_3 value: 64.334 - type: ndcg_at_5 value: 66.449 - type: precision_at_1 value: 87.022 - type: precision_at_10 value: 13.406 - type: precision_at_100 value: 1.542 - type: precision_at_1000 value: 0.17099999999999999 - type: precision_at_3 value: 39.023 - type: precision_at_5 value: 25.080000000000002 - type: recall_at_1 value: 43.511 - type: recall_at_10 value: 67.02900000000001 - type: recall_at_100 value: 77.11 - type: recall_at_1000 value: 85.294 - type: recall_at_3 value: 58.535000000000004 - type: recall_at_5 value: 62.70099999999999 - task: type: Classification dataset: type: mteb/imdb name: MTEB ImdbClassification config: default split: test revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 metrics: - type: accuracy value: 92.0996 - type: ap value: 87.86206089096373 - type: f1 value: 92.07554547510763 - task: type: Retrieval dataset: type: mteb/msmarco name: MTEB MSMARCO config: default split: dev revision: c5a29a104738b98a9e76336939199e264163d4a0 metrics: - type: map_at_1 value: 23.179 - type: map_at_10 value: 35.86 - type: map_at_100 value: 37.025999999999996 - type: map_at_1000 value: 37.068 - type: map_at_3 value: 31.921 - type: map_at_5 value: 34.172000000000004 - type: mrr_at_1 value: 23.926 - type: mrr_at_10 value: 36.525999999999996 - type: mrr_at_100 value: 37.627 - type: mrr_at_1000 value: 37.665 - type: mrr_at_3 value: 32.653 - type: mrr_at_5 value: 34.897 - type: ndcg_at_1 value: 23.910999999999998 - type: ndcg_at_10 value: 42.927 - type: ndcg_at_100 value: 48.464 - type: ndcg_at_1000 value: 49.533 - type: ndcg_at_3 value: 34.910000000000004 - type: ndcg_at_5 value: 38.937 - type: precision_at_1 value: 23.910999999999998 - type: precision_at_10 value: 6.758 - type: precision_at_100 value: 0.9520000000000001 - type: precision_at_1000 value: 0.104 - type: precision_at_3 value: 14.838000000000001 - type: precision_at_5 value: 10.934000000000001 - type: recall_at_1 value: 23.179 - type: recall_at_10 value: 64.622 - type: recall_at_100 value: 90.135 - type: recall_at_1000 value: 98.301 - type: recall_at_3 value: 42.836999999999996 - type: recall_at_5 value: 52.512 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (en) config: en split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 96.59598723210215 - type: f1 value: 96.41913500001952 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (en) config: en split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 82.89557683538533 - type: f1 value: 63.379319722356264 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (en) config: en split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 78.93745796906524 - type: f1 value: 75.71616541785902 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (en) config: en split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 81.41223940820443 - type: f1 value: 81.2877893719078 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-p2p name: MTEB MedrxivClusteringP2P config: default split: test revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 metrics: - type: v_measure value: 35.03682528325662 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-s2s name: MTEB MedrxivClusteringS2S config: default split: test revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 metrics: - type: v_measure value: 32.942529406124 - task: type: Reranking dataset: type: mteb/mind_small name: MTEB MindSmallReranking config: default split: test revision: 3bdac13927fdc888b903db93b2ffdbd90b295a69 metrics: - type: map value: 31.459949660460317 - type: mrr value: 32.70509582031616 - task: type: Retrieval dataset: type: mteb/nfcorpus name: MTEB NFCorpus config: default split: test revision: ec0fa4fe99da2ff19ca1214b7966684033a58814 metrics: - type: map_at_1 value: 6.497 - type: map_at_10 value: 13.843 - type: map_at_100 value: 17.713 - type: map_at_1000 value: 19.241 - type: map_at_3 value: 10.096 - type: map_at_5 value: 11.85 - type: mrr_at_1 value: 48.916 - type: mrr_at_10 value: 57.764 - type: mrr_at_100 value: 58.251 - type: mrr_at_1000 value: 58.282999999999994 - type: mrr_at_3 value: 55.623999999999995 - type: mrr_at_5 value: 57.018 - type: ndcg_at_1 value: 46.594 - type: ndcg_at_10 value: 36.945 - type: ndcg_at_100 value: 34.06 - type: ndcg_at_1000 value: 43.05 - type: ndcg_at_3 value: 41.738 - type: ndcg_at_5 value: 39.330999999999996 - type: precision_at_1 value: 48.916 - type: precision_at_10 value: 27.43 - type: precision_at_100 value: 8.616 - type: precision_at_1000 value: 2.155 - type: precision_at_3 value: 39.112 - type: precision_at_5 value: 33.808 - type: recall_at_1 value: 6.497 - type: recall_at_10 value: 18.163 - type: recall_at_100 value: 34.566 - type: recall_at_1000 value: 67.15 - type: recall_at_3 value: 11.100999999999999 - type: recall_at_5 value: 14.205000000000002 - task: type: Retrieval dataset: type: mteb/nq name: MTEB NQ config: default split: test revision: b774495ed302d8c44a3a7ea25c90dbce03968f31 metrics: - type: map_at_1 value: 31.916 - type: map_at_10 value: 48.123 - type: map_at_100 value: 49.103 - type: map_at_1000 value: 49.131 - type: map_at_3 value: 43.711 - type: map_at_5 value: 46.323 - type: mrr_at_1 value: 36.181999999999995 - type: mrr_at_10 value: 50.617999999999995 - type: mrr_at_100 value: 51.329 - type: mrr_at_1000 value: 51.348000000000006 - type: mrr_at_3 value: 47.010999999999996 - type: mrr_at_5 value: 49.175000000000004 - type: ndcg_at_1 value: 36.181999999999995 - type: ndcg_at_10 value: 56.077999999999996 - type: ndcg_at_100 value: 60.037 - type: ndcg_at_1000 value: 60.63499999999999 - type: ndcg_at_3 value: 47.859 - type: ndcg_at_5 value: 52.178999999999995 - type: precision_at_1 value: 36.181999999999995 - type: precision_at_10 value: 9.284 - type: precision_at_100 value: 1.149 - type: precision_at_1000 value: 0.121 - type: precision_at_3 value: 22.006999999999998 - type: precision_at_5 value: 15.695 - type: recall_at_1 value: 31.916 - type: recall_at_10 value: 77.771 - type: recall_at_100 value: 94.602 - type: recall_at_1000 value: 98.967 - type: recall_at_3 value: 56.528 - type: recall_at_5 value: 66.527 - task: type: Retrieval dataset: type: mteb/quora name: MTEB QuoraRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 71.486 - type: map_at_10 value: 85.978 - type: map_at_100 value: 86.587 - type: map_at_1000 value: 86.598 - type: map_at_3 value: 83.04899999999999 - type: map_at_5 value: 84.857 - type: mrr_at_1 value: 82.32000000000001 - type: mrr_at_10 value: 88.64 - type: mrr_at_100 value: 88.702 - type: mrr_at_1000 value: 88.702 - type: mrr_at_3 value: 87.735 - type: mrr_at_5 value: 88.36 - type: ndcg_at_1 value: 82.34 - type: ndcg_at_10 value: 89.67 - type: ndcg_at_100 value: 90.642 - type: ndcg_at_1000 value: 90.688 - type: ndcg_at_3 value: 86.932 - type: ndcg_at_5 value: 88.408 - type: precision_at_1 value: 82.34 - type: precision_at_10 value: 13.675999999999998 - type: precision_at_100 value: 1.544 - type: precision_at_1000 value: 0.157 - type: precision_at_3 value: 38.24 - type: precision_at_5 value: 25.068 - type: recall_at_1 value: 71.486 - type: recall_at_10 value: 96.844 - type: recall_at_100 value: 99.843 - type: recall_at_1000 value: 99.996 - type: recall_at_3 value: 88.92099999999999 - type: recall_at_5 value: 93.215 - task: type: Clustering dataset: type: mteb/reddit-clustering name: MTEB RedditClustering config: default split: test revision: 24640382cdbf8abc73003fb0fa6d111a705499eb metrics: - type: v_measure value: 59.75758437908334 - task: type: Clustering dataset: type: mteb/reddit-clustering-p2p name: MTEB RedditClusteringP2P config: default split: test revision: 282350215ef01743dc01b456c7f5241fa8937f16 metrics: - type: v_measure value: 68.03497914092789 - task: type: Retrieval dataset: type: mteb/scidocs name: MTEB SCIDOCS config: default split: test revision: None metrics: - type: map_at_1 value: 5.808 - type: map_at_10 value: 16.059 - type: map_at_100 value: 19.048000000000002 - type: map_at_1000 value: 19.43 - type: map_at_3 value: 10.953 - type: map_at_5 value: 13.363 - type: mrr_at_1 value: 28.7 - type: mrr_at_10 value: 42.436 - type: mrr_at_100 value: 43.599 - type: mrr_at_1000 value: 43.62 - type: mrr_at_3 value: 38.45 - type: mrr_at_5 value: 40.89 - type: ndcg_at_1 value: 28.7 - type: ndcg_at_10 value: 26.346000000000004 - type: ndcg_at_100 value: 36.758 - type: ndcg_at_1000 value: 42.113 - type: ndcg_at_3 value: 24.254 - type: ndcg_at_5 value: 21.506 - type: precision_at_1 value: 28.7 - type: precision_at_10 value: 13.969999999999999 - type: precision_at_100 value: 2.881 - type: precision_at_1000 value: 0.414 - type: precision_at_3 value: 22.933 - type: precision_at_5 value: 19.220000000000002 - type: recall_at_1 value: 5.808 - type: recall_at_10 value: 28.310000000000002 - type: recall_at_100 value: 58.475 - type: recall_at_1000 value: 84.072 - type: recall_at_3 value: 13.957 - type: recall_at_5 value: 19.515 - task: type: STS dataset: type: mteb/sickr-sts name: MTEB SICK-R config: default split: test revision: a6ea5a8cab320b040a23452cc28066d9beae2cee metrics: - type: cos_sim_pearson value: 82.39274129958557 - type: cos_sim_spearman value: 79.78021235170053 - type: euclidean_pearson value: 79.35335401300166 - type: euclidean_spearman value: 79.7271870968275 - type: manhattan_pearson value: 79.35256263340601 - type: manhattan_spearman value: 79.76036386976321 - task: type: STS dataset: type: mteb/sts12-sts name: MTEB STS12 config: default split: test revision: a0d554a64d88156834ff5ae9920b964011b16384 metrics: - type: cos_sim_pearson value: 83.99130429246708 - type: cos_sim_spearman value: 73.88322811171203 - type: euclidean_pearson value: 80.7569419170376 - type: euclidean_spearman value: 73.82542155409597 - type: manhattan_pearson value: 80.79468183847625 - type: manhattan_spearman value: 73.87027144047784 - task: type: STS dataset: type: mteb/sts13-sts name: MTEB STS13 config: default split: test revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca metrics: - type: cos_sim_pearson value: 84.88548789489907 - type: cos_sim_spearman value: 85.07535893847255 - type: euclidean_pearson value: 84.6637222061494 - type: euclidean_spearman value: 85.14200626702456 - type: manhattan_pearson value: 84.75327892344734 - type: manhattan_spearman value: 85.24406181838596 - task: type: STS dataset: type: mteb/sts14-sts name: MTEB STS14 config: default split: test revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 metrics: - type: cos_sim_pearson value: 82.88140039325008 - type: cos_sim_spearman value: 79.61211268112362 - type: euclidean_pearson value: 81.29639728816458 - type: euclidean_spearman value: 79.51284578041442 - type: manhattan_pearson value: 81.3381797137111 - type: manhattan_spearman value: 79.55683684039808 - task: type: STS dataset: type: mteb/sts15-sts name: MTEB STS15 config: default split: test revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 metrics: - type: cos_sim_pearson value: 85.16716737270485 - type: cos_sim_spearman value: 86.14823841857738 - type: euclidean_pearson value: 85.36325733440725 - type: euclidean_spearman value: 86.04919691402029 - type: manhattan_pearson value: 85.3147511385052 - type: manhattan_spearman value: 86.00676205857764 - task: type: STS dataset: type: mteb/sts16-sts name: MTEB STS16 config: default split: test revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 metrics: - type: cos_sim_pearson value: 80.34266645861588 - type: cos_sim_spearman value: 81.59914035005882 - type: euclidean_pearson value: 81.15053076245988 - type: euclidean_spearman value: 81.52776915798489 - type: manhattan_pearson value: 81.1819647418673 - type: manhattan_spearman value: 81.57479527353556 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-en) config: en-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 89.38263326821439 - type: cos_sim_spearman value: 89.10946308202642 - type: euclidean_pearson value: 88.87831312540068 - type: euclidean_spearman value: 89.03615865973664 - type: manhattan_pearson value: 88.79835539970384 - type: manhattan_spearman value: 88.9766156339753 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (en) config: en split: test revision: eea2b4fe26a775864c896887d910b76a8098ad3f metrics: - type: cos_sim_pearson value: 70.1574915581685 - type: cos_sim_spearman value: 70.59144980004054 - type: euclidean_pearson value: 71.43246306918755 - type: euclidean_spearman value: 70.5544189562984 - type: manhattan_pearson value: 71.4071414609503 - type: manhattan_spearman value: 70.31799126163712 - task: type: STS dataset: type: mteb/stsbenchmark-sts name: MTEB STSBenchmark config: default split: test revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 metrics: - type: cos_sim_pearson value: 83.36215796635351 - type: cos_sim_spearman value: 83.07276756467208 - type: euclidean_pearson value: 83.06690453635584 - type: euclidean_spearman value: 82.9635366303289 - type: manhattan_pearson value: 83.04994049700815 - type: manhattan_spearman value: 82.98120125356036 - task: type: Reranking dataset: type: mteb/scidocs-reranking name: MTEB SciDocsRR config: default split: test revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab metrics: - type: map value: 86.92530011616722 - type: mrr value: 96.21826793395421 - task: type: Retrieval dataset: type: mteb/scifact name: MTEB SciFact config: default split: test revision: 0228b52cf27578f30900b9e5271d331663a030d7 metrics: - type: map_at_1 value: 65.75 - type: map_at_10 value: 77.701 - type: map_at_100 value: 78.005 - type: map_at_1000 value: 78.006 - type: map_at_3 value: 75.48 - type: map_at_5 value: 76.927 - type: mrr_at_1 value: 68.333 - type: mrr_at_10 value: 78.511 - type: mrr_at_100 value: 78.704 - type: mrr_at_1000 value: 78.704 - type: mrr_at_3 value: 77 - type: mrr_at_5 value: 78.083 - type: ndcg_at_1 value: 68.333 - type: ndcg_at_10 value: 82.42699999999999 - type: ndcg_at_100 value: 83.486 - type: ndcg_at_1000 value: 83.511 - type: ndcg_at_3 value: 78.96300000000001 - type: ndcg_at_5 value: 81.028 - type: precision_at_1 value: 68.333 - type: precision_at_10 value: 10.667 - type: precision_at_100 value: 1.127 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 31.333 - type: precision_at_5 value: 20.133000000000003 - type: recall_at_1 value: 65.75 - type: recall_at_10 value: 95.578 - type: recall_at_100 value: 99.833 - type: recall_at_1000 value: 100 - type: recall_at_3 value: 86.506 - type: recall_at_5 value: 91.75 - task: type: PairClassification dataset: type: mteb/sprintduplicatequestions-pairclassification name: MTEB SprintDuplicateQuestions config: default split: test revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 metrics: - type: cos_sim_accuracy value: 99.75247524752476 - type: cos_sim_ap value: 94.16065078045173 - type: cos_sim_f1 value: 87.22986247544205 - type: cos_sim_precision value: 85.71428571428571 - type: cos_sim_recall value: 88.8 - type: dot_accuracy value: 99.74554455445545 - type: dot_ap value: 93.90633887037264 - type: dot_f1 value: 86.9873417721519 - type: dot_precision value: 88.1025641025641 - type: dot_recall value: 85.9 - type: euclidean_accuracy value: 99.75247524752476 - type: euclidean_ap value: 94.17466319018055 - type: euclidean_f1 value: 87.3405299313052 - type: euclidean_precision value: 85.74181117533719 - type: euclidean_recall value: 89 - type: manhattan_accuracy value: 99.75445544554455 - type: manhattan_ap value: 94.27688371923577 - type: manhattan_f1 value: 87.74002954209749 - type: manhattan_precision value: 86.42095053346266 - type: manhattan_recall value: 89.1 - type: max_accuracy value: 99.75445544554455 - type: max_ap value: 94.27688371923577 - type: max_f1 value: 87.74002954209749 - task: type: Clustering dataset: type: mteb/stackexchange-clustering name: MTEB StackExchangeClustering config: default split: test revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 metrics: - type: v_measure value: 71.26500637517056 - task: type: Clustering dataset: type: mteb/stackexchange-clustering-p2p name: MTEB StackExchangeClusteringP2P config: default split: test revision: 815ca46b2622cec33ccafc3735d572c266efdb44 metrics: - type: v_measure value: 39.17507906280528 - task: type: Reranking dataset: type: mteb/stackoverflowdupquestions-reranking name: MTEB StackOverflowDupQuestions config: default split: test revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 metrics: - type: map value: 52.4848744828509 - type: mrr value: 53.33678168236992 - task: type: Summarization dataset: type: mteb/summeval name: MTEB SummEval config: default split: test revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c metrics: - type: cos_sim_pearson value: 30.599864323827887 - type: cos_sim_spearman value: 30.91116204665598 - type: dot_pearson value: 30.82637894269936 - type: dot_spearman value: 30.957573868416066 - task: type: Retrieval dataset: type: mteb/trec-covid name: MTEB TRECCOVID config: default split: test revision: None metrics: - type: map_at_1 value: 0.23600000000000002 - type: map_at_10 value: 1.892 - type: map_at_100 value: 11.586 - type: map_at_1000 value: 27.761999999999997 - type: map_at_3 value: 0.653 - type: map_at_5 value: 1.028 - type: mrr_at_1 value: 88 - type: mrr_at_10 value: 94 - type: mrr_at_100 value: 94 - type: mrr_at_1000 value: 94 - type: mrr_at_3 value: 94 - type: mrr_at_5 value: 94 - type: ndcg_at_1 value: 82 - type: ndcg_at_10 value: 77.48899999999999 - type: ndcg_at_100 value: 60.141 - type: ndcg_at_1000 value: 54.228 - type: ndcg_at_3 value: 82.358 - type: ndcg_at_5 value: 80.449 - type: precision_at_1 value: 88 - type: precision_at_10 value: 82.19999999999999 - type: precision_at_100 value: 61.760000000000005 - type: precision_at_1000 value: 23.684 - type: precision_at_3 value: 88 - type: precision_at_5 value: 85.6 - type: recall_at_1 value: 0.23600000000000002 - type: recall_at_10 value: 2.117 - type: recall_at_100 value: 14.985000000000001 - type: recall_at_1000 value: 51.107 - type: recall_at_3 value: 0.688 - type: recall_at_5 value: 1.1039999999999999 - task: type: Retrieval dataset: type: mteb/touche2020 name: MTEB Touche2020 config: default split: test revision: a34f9a33db75fa0cbb21bb5cfc3dae8dc8bec93f metrics: - type: map_at_1 value: 2.3040000000000003 - type: map_at_10 value: 9.025 - type: map_at_100 value: 15.312999999999999 - type: map_at_1000 value: 16.954 - type: map_at_3 value: 4.981 - type: map_at_5 value: 6.32 - type: mrr_at_1 value: 24.490000000000002 - type: mrr_at_10 value: 39.835 - type: mrr_at_100 value: 40.8 - type: mrr_at_1000 value: 40.8 - type: mrr_at_3 value: 35.034 - type: mrr_at_5 value: 37.687 - type: ndcg_at_1 value: 22.448999999999998 - type: ndcg_at_10 value: 22.545 - type: ndcg_at_100 value: 35.931999999999995 - type: ndcg_at_1000 value: 47.665 - type: ndcg_at_3 value: 23.311 - type: ndcg_at_5 value: 22.421 - type: precision_at_1 value: 24.490000000000002 - type: precision_at_10 value: 20.408 - type: precision_at_100 value: 7.815999999999999 - type: precision_at_1000 value: 1.553 - type: precision_at_3 value: 25.169999999999998 - type: precision_at_5 value: 23.265 - type: recall_at_1 value: 2.3040000000000003 - type: recall_at_10 value: 15.693999999999999 - type: recall_at_100 value: 48.917 - type: recall_at_1000 value: 84.964 - type: recall_at_3 value: 6.026 - type: recall_at_5 value: 9.066 - task: type: Classification dataset: type: mteb/toxic_conversations_50k name: MTEB ToxicConversationsClassification config: default split: test revision: d7c0de2777da35d6aae2200a62c6e0e5af397c4c metrics: - type: accuracy value: 82.6074 - type: ap value: 23.187467098602013 - type: f1 value: 65.36829506379657 - task: type: Classification dataset: type: mteb/tweet_sentiment_extraction name: MTEB TweetSentimentExtractionClassification config: default split: test revision: d604517c81ca91fe16a244d1248fc021f9ecee7a metrics: - type: accuracy value: 63.16355404640635 - type: f1 value: 63.534725639863346 - task: type: Clustering dataset: type: mteb/twentynewsgroups-clustering name: MTEB TwentyNewsgroupsClustering config: default split: test revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 metrics: - type: v_measure value: 50.91004094411276 - task: type: PairClassification dataset: type: mteb/twittersemeval2015-pairclassification name: MTEB TwitterSemEval2015 config: default split: test revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 metrics: - type: cos_sim_accuracy value: 86.55301901412649 - type: cos_sim_ap value: 75.25312618556728 - type: cos_sim_f1 value: 68.76561719140429 - type: cos_sim_precision value: 65.3061224489796 - type: cos_sim_recall value: 72.61213720316623 - type: dot_accuracy value: 86.29671574178936 - type: dot_ap value: 75.11910195501207 - type: dot_f1 value: 68.44048376830045 - type: dot_precision value: 66.12546125461255 - type: dot_recall value: 70.92348284960423 - type: euclidean_accuracy value: 86.5828217202122 - type: euclidean_ap value: 75.22986344900924 - type: euclidean_f1 value: 68.81267797449549 - type: euclidean_precision value: 64.8238861674831 - type: euclidean_recall value: 73.3245382585752 - type: manhattan_accuracy value: 86.61262442629791 - type: manhattan_ap value: 75.24401608557328 - type: manhattan_f1 value: 68.80473982483257 - type: manhattan_precision value: 67.21187720181177 - type: manhattan_recall value: 70.47493403693932 - type: max_accuracy value: 86.61262442629791 - type: max_ap value: 75.25312618556728 - type: max_f1 value: 68.81267797449549 - task: type: PairClassification dataset: type: mteb/twitterurlcorpus-pairclassification name: MTEB TwitterURLCorpus config: default split: test revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf metrics: - type: cos_sim_accuracy value: 88.10688089416696 - type: cos_sim_ap value: 84.17862178779863 - type: cos_sim_f1 value: 76.17305208781748 - type: cos_sim_precision value: 71.31246641590543 - type: cos_sim_recall value: 81.74468740375731 - type: dot_accuracy value: 88.1844995536927 - type: dot_ap value: 84.33816725235876 - type: dot_f1 value: 76.43554032918746 - type: dot_precision value: 74.01557767200346 - type: dot_recall value: 79.0190945488143 - type: euclidean_accuracy value: 88.07001203089223 - type: euclidean_ap value: 84.12267000814985 - type: euclidean_f1 value: 76.12232600180778 - type: euclidean_precision value: 74.50604541433205 - type: euclidean_recall value: 77.81028641823221 - type: manhattan_accuracy value: 88.06419063142779 - type: manhattan_ap value: 84.11648917164187 - type: manhattan_f1 value: 76.20579953925474 - type: manhattan_precision value: 72.56772755762935 - type: manhattan_recall value: 80.22790267939637 - type: max_accuracy value: 88.1844995536927 - type: max_ap value: 84.33816725235876 - type: max_f1 value: 76.43554032918746 --- <!-- **English** | [中文](./README_zh.md) --> # gte-large-en-v1.5 We introduce `gte-v1.5` series, upgraded `gte` embeddings that support the context length of up to **8192**, while further enhancing model performance. The models are built upon the `transformer++` encoder [backbone](https://huggingface.co/Alibaba-NLP/new-impl) (BERT + RoPE + GLU). The `gte-v1.5` series achieve state-of-the-art scores on the MTEB benchmark within the same model size category and prodvide competitive on the LoCo long-context retrieval tests (refer to [Evaluation](#evaluation)). We also present the [`gte-Qwen1.5-7B-instruct`](https://huggingface.co/Alibaba-NLP/gte-Qwen1.5-7B-instruct), a SOTA instruction-tuned multi-lingual embedding model that ranked 2nd in MTEB and 1st in C-MTEB. <!-- Provide a longer summary of what this model is. --> - **Developed by:** Institute for Intelligent Computing, Alibaba Group - **Model type:** Text Embeddings - **Paper:** [mGTE: Generalized Long-Context Text Representation and Reranking Models for Multilingual Text Retrieval](https://arxiv.org/pdf/2407.19669) <!-- - **Demo [optional]:** [More Information Needed] --> ### Model list | Models | Language | Model Size | Max Seq. Length | Dimension | MTEB-en | LoCo | |:-----: | :-----: |:-----: |:-----: |:-----: | :-----: | :-----: | |[`gte-Qwen1.5-7B-instruct`](https://huggingface.co/Alibaba-NLP/gte-Qwen1.5-7B-instruct)| Multiple | 7720 | 32768 | 4096 | 67.34 | 87.57 | |[`gte-large-en-v1.5`](https://huggingface.co/Alibaba-NLP/gte-large-en-v1.5) | English | 434 | 8192 | 1024 | 65.39 | 86.71 | |[`gte-base-en-v1.5`](https://huggingface.co/Alibaba-NLP/gte-base-en-v1.5) | English | 137 | 8192 | 768 | 64.11 | 87.44 | ## How to Get Started with the Model Use the code below to get started with the model. ```python # Requires transformers>=4.36.0 import torch.nn.functional as F from transformers import AutoModel, AutoTokenizer input_texts = [ "what is the capital of China?", "how to implement quick sort in python?", "Beijing", "sorting algorithms" ] model_path = 'Alibaba-NLP/gte-large-en-v1.5' tokenizer = AutoTokenizer.from_pretrained(model_path) model = AutoModel.from_pretrained(model_path, trust_remote_code=True) # Tokenize the input texts batch_dict = tokenizer(input_texts, max_length=8192, padding=True, truncation=True, return_tensors='pt') outputs = model(**batch_dict) embeddings = outputs.last_hidden_state[:, 0] # (Optionally) normalize embeddings embeddings = F.normalize(embeddings, p=2, dim=1) scores = (embeddings[:1] @ embeddings[1:].T) * 100 print(scores.tolist()) ``` **It is recommended to install xformers and enable unpadding for acceleration, refer to [enable-unpadding-and-xformers](https://huggingface.co/Alibaba-NLP/new-impl#recommendation-enable-unpadding-and-acceleration-with-xformers).** Use with sentence-transformers: ```python # Requires sentence_transformers>=2.7.0 from sentence_transformers import SentenceTransformer from sentence_transformers.util import cos_sim sentences = ['That is a happy person', 'That is a very happy person'] model = SentenceTransformer('Alibaba-NLP/gte-large-en-v1.5', trust_remote_code=True) embeddings = model.encode(sentences) print(cos_sim(embeddings[0], embeddings[1])) ``` Use with `transformers.js`: ```js // npm i @xenova/transformers import { pipeline, dot } from '@xenova/transformers'; // Create feature extraction pipeline const extractor = await pipeline('feature-extraction', 'Alibaba-NLP/gte-large-en-v1.5', { quantized: false, // Comment out this line to use the quantized version }); // Generate sentence embeddings const sentences = [ "what is the capital of China?", "how to implement quick sort in python?", "Beijing", "sorting algorithms" ] const output = await extractor(sentences, { normalize: true, pooling: 'cls' }); // Compute similarity scores const [source_embeddings, ...document_embeddings ] = output.tolist(); const similarities = document_embeddings.map(x => 100 * dot(source_embeddings, x)); console.log(similarities); // [41.86354093370361, 77.07076371259589, 37.02981979677899] ``` ## Training Details ### Training Data - Masked language modeling (MLM): `c4-en` - Weak-supervised contrastive pre-training (CPT): [GTE](https://arxiv.org/pdf/2308.03281.pdf) pre-training data - Supervised contrastive fine-tuning: [GTE](https://arxiv.org/pdf/2308.03281.pdf) fine-tuning data ### Training Procedure To enable the backbone model to support a context length of 8192, we adopted a multi-stage training strategy. The model first undergoes preliminary MLM pre-training on shorter lengths. And then, we resample the data, reducing the proportion of short texts, and continue the MLM pre-training. The entire training process is as follows: - MLM-512: lr 2e-4, mlm_probability 0.3, batch_size 4096, num_steps 300000, rope_base 10000 - MLM-2048: lr 5e-5, mlm_probability 0.3, batch_size 4096, num_steps 30000, rope_base 10000 - [MLM-8192](https://huggingface.co/Alibaba-NLP/gte-en-mlm-large): lr 5e-5, mlm_probability 0.3, batch_size 1024, num_steps 30000, rope_base 160000 - CPT: max_len 512, lr 5e-5, batch_size 28672, num_steps 100000 - Fine-tuning: TODO ## Evaluation ### MTEB The results of other models are retrieved from [MTEB leaderboard](https://huggingface.co/spaces/mteb/leaderboard). The gte evaluation setting: `mteb==1.2.0, fp16 auto mix precision, max_length=8192`, and set ntk scaling factor to 2 (equivalent to rope_base * 2). | Model Name | Param Size (M) | Dimension | Sequence Length | Average (56) | Class. (12) | Clust. (11) | Pair Class. (3) | Reran. (4) | Retr. (15) | STS (10) | Summ. (1) | |:----:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:| | [**gte-large-en-v1.5**](https://huggingface.co/Alibaba-NLP/gte-large-en-v1.5) | 409 | 1024 | 8192 | **65.39** | 77.75 | 47.95 | 84.63 | 58.50 | 57.91 | 81.43 | 30.91 | | [mxbai-embed-large-v1](https://huggingface.co/mixedbread-ai/mxbai-embed-large-v1) | 335 | 1024 | 512 | 64.68 | 75.64 | 46.71 | 87.2 | 60.11 | 54.39 | 85 | 32.71 | | [multilingual-e5-large-instruct](https://huggingface.co/intfloat/multilingual-e5-large-instruct) | 560 | 1024 | 514 | 64.41 | 77.56 | 47.1 | 86.19 | 58.58 | 52.47 | 84.78 | 30.39 | | [bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5)| 335 | 1024 | 512 | 64.23 | 75.97 | 46.08 | 87.12 | 60.03 | 54.29 | 83.11 | 31.61 | | [**gte-base-en-v1.5**](https://huggingface.co/Alibaba-NLP/gte-base-en-v1.5) | 137 | 768 | 8192 | **64.11** | 77.17 | 46.82 | 85.33 | 57.66 | 54.09 | 81.97 | 31.17 | | [bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5)| 109 | 768 | 512 | 63.55 | 75.53 | 45.77 | 86.55 | 58.86 | 53.25 | 82.4 | 31.07 | ### LoCo | Model Name | Dimension | Sequence Length | Average (5) | QsmsumRetrieval | SummScreenRetrieval | QasperAbastractRetrieval | QasperTitleRetrieval | GovReportRetrieval | |:----:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:| | [gte-qwen1.5-7b](https://huggingface.co/Alibaba-NLP/gte-qwen1.5-7b) | 4096 | 32768 | 87.57 | 49.37 | 93.10 | 99.67 | 97.54 | 98.21 | | [gte-large-v1.5](https://huggingface.co/Alibaba-NLP/gte-large-v1.5) |1024 | 8192 | 86.71 | 44.55 | 92.61 | 99.82 | 97.81 | 98.74 | | [gte-base-v1.5](https://huggingface.co/Alibaba-NLP/gte-base-v1.5) | 768 | 8192 | 87.44 | 49.91 | 91.78 | 99.82 | 97.13 | 98.58 | ## Citation If you find our paper or models helpful, please consider citing them as follows: ``` @article{zhang2024mgte, title={mGTE: Generalized Long-Context Text Representation and Reranking Models for Multilingual Text Retrieval}, author={Zhang, Xin and Zhang, Yanzhao and Long, Dingkun and Xie, Wen and Dai, Ziqi and Tang, Jialong and Lin, Huan and Yang, Baosong and Xie, Pengjun and Huang, Fei and others}, journal={arXiv preprint arXiv:2407.19669}, year={2024} } @article{li2023towards, title={Towards general text embeddings with multi-stage contrastive learning}, author={Li, Zehan and Zhang, Xin and Zhang, Yanzhao and Long, Dingkun and Xie, Pengjun and Zhang, Meishan}, journal={arXiv preprint arXiv:2308.03281}, year={2023} } ```

google/gemma-2-9b-it

google

transformers

text-generation

--- license: gemma library_name: transformers pipeline_tag: text-generation extra_gated_heading: Access Gemma on Hugging Face extra_gated_prompt: >- To access Gemma on Hugging Face, you’re required to review and agree to Google’s usage license. To do this, please ensure you’re logged in to Hugging Face and click below. Requests are processed immediately. extra_gated_button_content: Acknowledge license tags: - conversational --- # Gemma 2 model card **Model Page**: [Gemma](https://ai.google.dev/gemma/docs) **Resources and Technical Documentation**: * [Responsible Generative AI Toolkit][rai-toolkit] * [Gemma on Kaggle][kaggle-gemma] * [Gemma on Vertex Model Garden][vertex-mg-gemma] **Terms of Use**: [Terms](https://www.kaggle.com/models/google/gemma/license/consent/verify/huggingface?returnModelRepoId=google/gemma-2-9b-it) **Authors**: Google ## Model Information Summary description and brief definition of inputs and outputs. ### Description Gemma is a family of lightweight, state-of-the-art open models from Google, built from the same research and technology used to create the Gemini models. They are text-to-text, decoder-only large language models, available in English, with open weights for both pre-trained variants and instruction-tuned variants. Gemma models are well-suited for a variety of text generation tasks, including question answering, summarization, and reasoning. Their relatively small size makes it possible to deploy them in environments with limited resources such as a laptop, desktop or your own cloud infrastructure, democratizing access to state of the art AI models and helping foster innovation for everyone. ### Usage Below we share some code snippets on how to get quickly started with running the model. First, install the Transformers library with: ```sh pip install -U transformers ``` Then, copy the snippet from the section that is relevant for your usecase. #### Running with the `pipeline` API ```python import torch from transformers import pipeline pipe = pipeline( "text-generation", model="google/gemma-2-9b-it", model_kwargs={"torch_dtype": torch.bfloat16}, device="cuda", # replace with "mps" to run on a Mac device ) messages = [ {"role": "user", "content": "Who are you? Please, answer in pirate-speak."}, ] outputs = pipe(messages, max_new_tokens=256) assistant_response = outputs[0]["generated_text"][-1]["content"].strip() print(assistant_response) # Ahoy, matey! I be Gemma, a digital scallywag, a language-slingin' parrot of the digital seas. I be here to help ye with yer wordy woes, answer yer questions, and spin ye yarns of the digital world. So, what be yer pleasure, eh? 🦜 ``` #### Running the model on a single / multi GPU ```python # pip install accelerate from transformers import AutoTokenizer, AutoModelForCausalLM import torch tokenizer = AutoTokenizer.from_pretrained("google/gemma-2-9b-it") model = AutoModelForCausalLM.from_pretrained( "google/gemma-2-9b-it", device_map="auto", torch_dtype=torch.bfloat16, ) input_text = "Write me a poem about Machine Learning." input_ids = tokenizer(input_text, return_tensors="pt").to("cuda") outputs = model.generate(**input_ids, max_new_tokens=32) print(tokenizer.decode(outputs[0])) ``` You can ensure the correct chat template is applied by using `tokenizer.apply_chat_template` as follows: ```python messages = [ {"role": "user", "content": "Write me a poem about Machine Learning."}, ] input_ids = tokenizer.apply_chat_template(messages, return_tensors="pt", return_dict=True).to("cuda") outputs = model.generate(**input_ids, max_new_tokens=256) print(tokenizer.decode(outputs[0])) ``` <a name="precisions"></a> #### Running the model on a GPU using different precisions The native weights of this model were exported in `bfloat16` precision. You can also use `float32` if you skip the dtype, but no precision increase will occur (model weights will just be upcasted to `float32`). See examples below. * _Upcasting to `torch.float32`_ ```python # pip install accelerate from transformers import AutoTokenizer, AutoModelForCausalLM tokenizer = AutoTokenizer.from_pretrained("google/gemma-2-9b-it") model = AutoModelForCausalLM.from_pretrained( "google/gemma-2-9b-it", device_map="auto", ) input_text = "Write me a poem about Machine Learning." input_ids = tokenizer(input_text, return_tensors="pt").to("cuda") outputs = model.generate(**input_ids, max_new_tokens=32) print(tokenizer.decode(outputs[0])) ``` #### Running the model through a CLI The [local-gemma](https://github.com/huggingface/local-gemma) repository contains a lightweight wrapper around Transformers for running Gemma 2 through a command line interface, or CLI. Follow the [installation instructions](https://github.com/huggingface/local-gemma#cli-usage) for getting started, then launch the CLI through the following command: ```shell local-gemma --model 9b --preset speed ``` #### Quantized Versions through `bitsandbytes` <details> <summary> Using 8-bit precision (int8) </summary> ```python # pip install bitsandbytes accelerate from transformers import AutoTokenizer, AutoModelForCausalLM, BitsAndBytesConfig quantization_config = BitsAndBytesConfig(load_in_8bit=True) tokenizer = AutoTokenizer.from_pretrained("google/gemma-2-9b-it") model = AutoModelForCausalLM.from_pretrained( "google/gemma-2-9b-it", quantization_config=quantization_config, ) input_text = "Write me a poem about Machine Learning." input_ids = tokenizer(input_text, return_tensors="pt").to("cuda") outputs = model.generate(**input_ids, max_new_tokens=32) print(tokenizer.decode(outputs[0])) ``` </details> <details> <summary> Using 4-bit precision </summary> ```python # pip install bitsandbytes accelerate from transformers import AutoTokenizer, AutoModelForCausalLM, BitsAndBytesConfig quantization_config = BitsAndBytesConfig(load_in_4bit=True) tokenizer = AutoTokenizer.from_pretrained("google/gemma-2-9b-it") model = AutoModelForCausalLM.from_pretrained( "google/gemma-2-9b-it", quantization_config=quantization_config, ) input_text = "Write me a poem about Machine Learning." input_ids = tokenizer(input_text, return_tensors="pt").to("cuda") outputs = model.generate(**input_ids, max_new_tokens=32) print(tokenizer.decode(outputs[0])) ``` </details> #### Advanced Usage <details> <summary> Torch compile </summary> [Torch compile](https://pytorch.org/tutorials/intermediate/torch_compile_tutorial.html) is a method for speeding-up the inference of PyTorch modules. The Gemma-2 model can be run up to 6x faster by leveraging torch compile. Note that two warm-up steps are required before the full inference speed is realised: ```python import os os.environ["TOKENIZERS_PARALLELISM"] = "false" from transformers import AutoTokenizer, Gemma2ForCausalLM from transformers.cache_utils import HybridCache import torch torch.set_float32_matmul_precision("high") # load the model + tokenizer tokenizer = AutoTokenizer.from_pretrained("google/gemma-2-9b-it") model = Gemma2ForCausalLM.from_pretrained("google/gemma-2-9b-it", torch_dtype=torch.bfloat16) model.to("cuda") # apply the torch compile transformation model.forward = torch.compile(model.forward, mode="reduce-overhead", fullgraph=True) # pre-process inputs input_text = "The theory of special relativity states " model_inputs = tokenizer(input_text, return_tensors="pt").to("cuda") prompt_length = model_inputs.input_ids.shape[1] # set-up k/v cache past_key_values = HybridCache( config=model.config, max_batch_size=1, max_cache_len=model.config.max_position_embeddings, device=model.device, dtype=model.dtype ) # enable passing kv cache to generate model._supports_cache_class = True model.generation_config.cache_implementation = None # two warm-up steps for idx in range(2): outputs = model.generate(**model_inputs, past_key_values=past_key_values, do_sample=True, temperature=1.0, max_new_tokens=128) past_key_values.reset() # fast run outputs = model.generate(**model_inputs, past_key_values=past_key_values, do_sample=True, temperature=1.0, max_new_tokens=128) print(tokenizer.decode(outputs[0], skip_special_tokens=True)) ``` For more details, refer to the [Transformers documentation](https://huggingface.co/docs/transformers/main/en/llm_optims?static-kv=basic+usage%3A+generation_config). </details> ### Chat Template The instruction-tuned models use a chat template that must be adhered to for conversational use. The easiest way to apply it is using the tokenizer's built-in chat template, as shown in the following snippet. Let's load the model and apply the chat template to a conversation. In this example, we'll start with a single user interaction: ```py from transformers import AutoTokenizer, AutoModelForCausalLM import transformers import torch model_id = "google/gemma-2-9b-it" dtype = torch.bfloat16 tokenizer = AutoTokenizer.from_pretrained(model_id) model = AutoModelForCausalLM.from_pretrained( model_id, device_map="cuda", torch_dtype=dtype,) chat = [ { "role": "user", "content": "Write a hello world program" }, ] prompt = tokenizer.apply_chat_template(chat, tokenize=False, add_generation_prompt=True) ``` At this point, the prompt contains the following text: ``` <bos><start_of_turn>user Write a hello world program<end_of_turn> <start_of_turn>model ``` As you can see, each turn is preceded by a `<start_of_turn>` delimiter and then the role of the entity (either `user`, for content supplied by the user, or `model` for LLM responses). Turns finish with the `<end_of_turn>` token. You can follow this format to build the prompt manually, if you need to do it without the tokenizer's chat template. After the prompt is ready, generation can be performed like this: ```py inputs = tokenizer.encode(prompt, add_special_tokens=False, return_tensors="pt") outputs = model.generate(input_ids=inputs.to(model.device), max_new_tokens=150) print(tokenizer.decode(outputs[0])) ``` ### Inputs and outputs * **Input:** Text string, such as a question, a prompt, or a document to be summarized. * **Output:** Generated English-language text in response to the input, such as an answer to a question, or a summary of a document. ### Citation ```none @article{gemma_2024, title={Gemma}, url={https://www.kaggle.com/m/3301}, DOI={10.34740/KAGGLE/M/3301}, publisher={Kaggle}, author={Gemma Team}, year={2024} } ``` ## Model Data Data used for model training and how the data was processed. ### Training Dataset These models were trained on a dataset of text data that includes a wide variety of sources. The 27B model was trained with 13 trillion tokens and the 9B model was trained with 8 trillion tokens. Here are the key components: * Web Documents: A diverse collection of web text ensures the model is exposed to a broad range of linguistic styles, topics, and vocabulary. Primarily English-language content. * Code: Exposing the model to code helps it to learn the syntax and patterns of programming languages, which improves its ability to generate code or understand code-related questions. * Mathematics: Training on mathematical text helps the model learn logical reasoning, symbolic representation, and to address mathematical queries. The combination of these diverse data sources is crucial for training a powerful language model that can handle a wide variety of different tasks and text formats. ### Data Preprocessing Here are the key data cleaning and filtering methods applied to the training data: * CSAM Filtering: Rigorous CSAM (Child Sexual Abuse Material) filtering was applied at multiple stages in the data preparation process to ensure the exclusion of harmful and illegal content. * Sensitive Data Filtering: As part of making Gemma pre-trained models safe and reliable, automated techniques were used to filter out certain personal information and other sensitive data from training sets. * Additional methods: Filtering based on content quality and safety in line with [our policies][safety-policies]. ## Implementation Information Details about the model internals. ### Hardware Gemma was trained using the latest generation of [Tensor Processing Unit (TPU)][tpu] hardware (TPUv5p). Training large language models requires significant computational power. TPUs, designed specifically for matrix operations common in machine learning, offer several advantages in this domain: * Performance: TPUs are specifically designed to handle the massive computations involved in training LLMs. They can speed up training considerably compared to CPUs. * Memory: TPUs often come with large amounts of high-bandwidth memory, allowing for the handling of large models and batch sizes during training. This can lead to better model quality. * Scalability: TPU Pods (large clusters of TPUs) provide a scalable solution for handling the growing complexity of large foundation models. You can distribute training across multiple TPU devices for faster and more efficient processing. * Cost-effectiveness: In many scenarios, TPUs can provide a more cost-effective solution for training large models compared to CPU-based infrastructure, especially when considering the time and resources saved due to faster training. * These advantages are aligned with [Google's commitments to operate sustainably][sustainability]. ### Software Training was done using [JAX][jax] and [ML Pathways][ml-pathways]. JAX allows researchers to take advantage of the latest generation of hardware, including TPUs, for faster and more efficient training of large models. ML Pathways is Google's latest effort to build artificially intelligent systems capable of generalizing across multiple tasks. This is specially suitable for [foundation models][foundation-models], including large language models like these ones. Together, JAX and ML Pathways are used as described in the [paper about the Gemini family of models][gemini-2-paper]; "the 'single controller' programming model of Jax and Pathways allows a single Python process to orchestrate the entire training run, dramatically simplifying the development workflow." ## Evaluation Model evaluation metrics and results. ### Benchmark Results These models were evaluated against a large collection of different datasets and metrics to cover different aspects of text generation: | Benchmark | Metric | Gemma PT 9B | Gemma PT 27B | | ------------------------------ | ------------- | ----------- | ------------ | | [MMLU][mmlu] | 5-shot, top-1 | 71.3 | 75.2 | | [HellaSwag][hellaswag] | 10-shot | 81.9 | 86.4 | | [PIQA][piqa] | 0-shot | 81.7 | 83.2 | | [SocialIQA][socialiqa] | 0-shot | 53.4 | 53.7 | | [BoolQ][boolq] | 0-shot | 84.2 | 84.8 | | [WinoGrande][winogrande] | partial score | 80.6 | 83.7 | | [ARC-e][arc] | 0-shot | 88.0 | 88.6 | | [ARC-c][arc] | 25-shot | 68.4 | 71.4 | | [TriviaQA][triviaqa] | 5-shot | 76.6 | 83.7 | | [Natural Questions][naturalq] | 5-shot | 29.2 | 34.5 | | [HumanEval][humaneval] | pass@1 | 40.2 | 51.8 | | [MBPP][mbpp] | 3-shot | 52.4 | 62.6 | | [GSM8K][gsm8k] | 5-shot, maj@1 | 68.6 | 74.0 | | [MATH][math] | 4-shot | 36.6 | 42.3 | | [AGIEval][agieval] | 3-5-shot | 52.8 | 55.1 | | [BIG-Bench][big-bench] | 3-shot, CoT | 68.2 | 74.9 | | ------------------------------ | ------------- | ----------- | ------------ | ## Ethics and Safety Ethics and safety evaluation approach and results. ### Evaluation Approach Our evaluation methods include structured evaluations and internal red-teaming testing of relevant content policies. Red-teaming was conducted by a number of different teams, each with different goals and human evaluation metrics. These models were evaluated against a number of different categories relevant to ethics and safety, including: * Text-to-Text Content Safety: Human evaluation on prompts covering safety policies including child sexual abuse and exploitation, harassment, violence and gore, and hate speech. * Text-to-Text Representational Harms: Benchmark against relevant academic datasets such as [WinoBias][winobias] and [BBQ Dataset][bbq]. * Memorization: Automated evaluation of memorization of training data, including the risk of personally identifiable information exposure. * Large-scale harm: Tests for "dangerous capabilities," such as chemical, biological, radiological, and nuclear (CBRN) risks. ### Evaluation Results The results of ethics and safety evaluations are within acceptable thresholds for meeting [internal policies][safety-policies] for categories such as child safety, content safety, representational harms, memorization, large-scale harms. On top of robust internal evaluations, the results of well-known safety benchmarks like BBQ, BOLD, Winogender, Winobias, RealToxicity, and TruthfulQA are shown here. #### Gemma 2.0 | Benchmark | Metric | Gemma 2 IT 9B | Gemma 2 IT 27B | | ------------------------ | ------------- | --------------- | ---------------- | | [RealToxicity][realtox] | average | 8.25 | 8.84 | | [CrowS-Pairs][crows] | top-1 | 37.47 | 36.67 | | [BBQ Ambig][bbq] | 1-shot, top-1 | 88.58 | 85.99 | | [BBQ Disambig][bbq] | top-1 | 82.67 | 86.94 | | [Winogender][winogender] | top-1 | 79.17 | 77.22 | | [TruthfulQA][truthfulqa] | | 50.27 | 51.60 | | [Winobias 1_2][winobias] | | 78.09 | 81.94 | | [Winobias 2_2][winobias] | | 95.32 | 97.22 | | [Toxigen][toxigen] | | 39.30 | 38.42 | | ------------------------ | ------------- | --------------- | ---------------- | ## Usage and Limitations These models have certain limitations that users should be aware of. ### Intended Usage Open Large Language Models (LLMs) have a wide range of applications across various industries and domains. The following list of potential uses is not comprehensive. The purpose of this list is to provide contextual information about the possible use-cases that the model creators considered as part of model training and development. * Content Creation and Communication * Text Generation: These models can be used to generate creative text formats such as poems, scripts, code, marketing copy, and email drafts. * Chatbots and Conversational AI: Power conversational interfaces for customer service, virtual assistants, or interactive applications. * Text Summarization: Generate concise summaries of a text corpus, research papers, or reports. * Research and Education * Natural Language Processing (NLP) Research: These models can serve as a foundation for researchers to experiment with NLP techniques, develop algorithms, and contribute to the advancement of the field. * Language Learning Tools: Support interactive language learning experiences, aiding in grammar correction or providing writing practice. * Knowledge Exploration: Assist researchers in exploring large bodies of text by generating summaries or answering questions about specific topics. ### Limitations * Training Data * The quality and diversity of the training data significantly influence the model's capabilities. Biases or gaps in the training data can lead to limitations in the model's responses. * The scope of the training dataset determines the subject areas the model can handle effectively. * Context and Task Complexity * LLMs are better at tasks that can be framed with clear prompts and instructions. Open-ended or highly complex tasks might be challenging. * A model's performance can be influenced by the amount of context provided (longer context generally leads to better outputs, up to a certain point). * Language Ambiguity and Nuance * Natural language is inherently complex. LLMs might struggle to grasp subtle nuances, sarcasm, or figurative language. * Factual Accuracy * LLMs generate responses based on information they learned from their training datasets, but they are not knowledge bases. They may generate incorrect or outdated factual statements. * Common Sense * LLMs rely on statistical patterns in language. They might lack the ability to apply common sense reasoning in certain situations. ### Ethical Considerations and Risks The development of large language models (LLMs) raises several ethical concerns. In creating an open model, we have carefully considered the following: * Bias and Fairness * LLMs trained on large-scale, real-world text data can reflect socio-cultural biases embedded in the training material. These models underwent careful scrutiny, input data pre-processing described and posterior evaluations reported in this card. * Misinformation and Misuse * LLMs can be misused to generate text that is false, misleading, or harmful. * Guidelines are provided for responsible use with the model, see the [Responsible Generative AI Toolkit][rai-toolkit]. * Transparency and Accountability: * This model card summarizes details on the models' architecture, capabilities, limitations, and evaluation processes. * A responsibly developed open model offers the opportunity to share innovation by making LLM technology accessible to developers and researchers across the AI ecosystem. Risks identified and mitigations: * Perpetuation of biases: It's encouraged to perform continuous monitoring (using evaluation metrics, human review) and the exploration of de-biasing techniques during model training, fine-tuning, and other use cases. * Generation of harmful content: Mechanisms and guidelines for content safety are essential. Developers are encouraged to exercise caution and implement appropriate content safety safeguards based on their specific product policies and application use cases. * Misuse for malicious purposes: Technical limitations and developer and end-user education can help mitigate against malicious applications of LLMs. Educational resources and reporting mechanisms for users to flag misuse are provided. Prohibited uses of Gemma models are outlined in the [Gemma Prohibited Use Policy][prohibited-use]. * Privacy violations: Models were trained on data filtered for removal of PII (Personally Identifiable Information). Developers are encouraged to adhere to privacy regulations with privacy-preserving techniques. ### Benefits At the time of release, this family of models provides high-performance open large language model implementations designed from the ground up for Responsible AI development compared to similarly sized models. Using the benchmark evaluation metrics described in this document, these models have shown to provide superior performance to other, comparably-sized open model alternatives. [rai-toolkit]: https://ai.google.dev/responsible [kaggle-gemma]: https://www.kaggle.com/models/google/gemma-2 [terms]: https://ai.google.dev/gemma/terms [vertex-mg-gemma]: https://console.cloud.google.com/vertex-ai/publishers/google/model-garden/335 [sensitive-info]: https://cloud.google.com/dlp/docs/high-sensitivity-infotypes-reference [safety-policies]: https://storage.googleapis.com/gweb-uniblog-publish-prod/documents/2023_Google_AI_Principles_Progress_Update.pdf#page=11 [prohibited-use]: https://ai.google.dev/gemma/prohibited_use_policy [tpu]: https://cloud.google.com/tpu/docs/intro-to-tpu [sustainability]: https://sustainability.google/operating-sustainably/ [jax]: https://github.com/google/jax [ml-pathways]: https://blog.google/technology/ai/introducing-pathways-next-generation-ai-architecture/ [sustainability]: https://sustainability.google/operating-sustainably/ [foundation-models]: https://ai.google/discover/foundation-models/ [gemini-2-paper]: https://goo.gle/gemma2report [mmlu]: https://arxiv.org/abs/2009.03300 [hellaswag]: https://arxiv.org/abs/1905.07830 [piqa]: https://arxiv.org/abs/1911.11641 [socialiqa]: https://arxiv.org/abs/1904.09728 [boolq]: https://arxiv.org/abs/1905.10044 [winogrande]: https://arxiv.org/abs/1907.10641 [commonsenseqa]: https://arxiv.org/abs/1811.00937 [openbookqa]: https://arxiv.org/abs/1809.02789 [arc]: https://arxiv.org/abs/1911.01547 [triviaqa]: https://arxiv.org/abs/1705.03551 [naturalq]: https://github.com/google-research-datasets/natural-questions [humaneval]: https://arxiv.org/abs/2107.03374 [mbpp]: https://arxiv.org/abs/2108.07732 [gsm8k]: https://arxiv.org/abs/2110.14168 [realtox]: https://arxiv.org/abs/2009.11462 [bold]: https://arxiv.org/abs/2101.11718 [crows]: https://aclanthology.org/2020.emnlp-main.154/ [bbq]: https://arxiv.org/abs/2110.08193v2 [winogender]: https://arxiv.org/abs/1804.09301 [truthfulqa]: https://arxiv.org/abs/2109.07958 [winobias]: https://arxiv.org/abs/1804.06876 [math]: https://arxiv.org/abs/2103.03874 [agieval]: https://arxiv.org/abs/2304.06364 [big-bench]: https://arxiv.org/abs/2206.04615 [toxigen]: https://arxiv.org/abs/2203.09509

WinKawaks/vit-small-patch16-224

WinKawaks

transformers

image-classification

--- license: apache-2.0 tags: - vision - image-classification datasets: - imagenet widget: - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/tiger.jpg example_title: Tiger - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/teapot.jpg example_title: Teapot - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/palace.jpg example_title: Palace --- Google didn't publish vit-tiny and vit-small model checkpoints in Hugging Face. I converted the weights from the [timm repository](https://github.com/rwightman/pytorch-image-models). This model is used in the same way as [ViT-base](https://huggingface.co/google/vit-base-patch16-224). Note that [safetensors] model requires torch 2.0 environment.

jonatasgrosman/wav2vec2-large-xlsr-53-arabic

jonatasgrosman

transformers

automatic-speech-recognition

--- language: ar datasets: - common_voice - arabic_speech_corpus metrics: - wer - cer tags: - audio - automatic-speech-recognition - speech - xlsr-fine-tuning-week license: apache-2.0 model-index: - name: XLSR Wav2Vec2 Arabic by Jonatas Grosman results: - task: name: Speech Recognition type: automatic-speech-recognition dataset: name: Common Voice ar type: common_voice args: ar metrics: - name: Test WER type: wer value: 39.59 - name: Test CER type: cer value: 18.18 --- # Fine-tuned XLSR-53 large model for speech recognition in Arabic Fine-tuned [facebook/wav2vec2-large-xlsr-53](https://huggingface.co/facebook/wav2vec2-large-xlsr-53) on Arabic using the train and validation splits of [Common Voice 6.1](https://huggingface.co/datasets/common_voice) and [Arabic Speech Corpus](https://huggingface.co/datasets/arabic_speech_corpus). When using this model, make sure that your speech input is sampled at 16kHz. This model has been fine-tuned thanks to the GPU credits generously given by the [OVHcloud](https://www.ovhcloud.com/en/public-cloud/ai-training/) :) The script used for training can be found here: https://github.com/jonatasgrosman/wav2vec2-sprint ## Usage The model can be used directly (without a language model) as follows... Using the [HuggingSound](https://github.com/jonatasgrosman/huggingsound) library: ```python from huggingsound import SpeechRecognitionModel model = SpeechRecognitionModel("jonatasgrosman/wav2vec2-large-xlsr-53-arabic") audio_paths = ["/path/to/file.mp3", "/path/to/another_file.wav"] transcriptions = model.transcribe(audio_paths) ``` Writing your own inference script: ```python import torch import librosa from datasets import load_dataset from transformers import Wav2Vec2ForCTC, Wav2Vec2Processor LANG_ID = "ar" MODEL_ID = "jonatasgrosman/wav2vec2-large-xlsr-53-arabic" SAMPLES = 10 test_dataset = load_dataset("common_voice", LANG_ID, split=f"test[:{SAMPLES}]") processor = Wav2Vec2Processor.from_pretrained(MODEL_ID) model = Wav2Vec2ForCTC.from_pretrained(MODEL_ID) # Preprocessing the datasets. # We need to read the audio files as arrays def speech_file_to_array_fn(batch): speech_array, sampling_rate = librosa.load(batch["path"], sr=16_000) batch["speech"] = speech_array batch["sentence"] = batch["sentence"].upper() return batch test_dataset = test_dataset.map(speech_file_to_array_fn) inputs = processor(test_dataset["speech"], sampling_rate=16_000, return_tensors="pt", padding=True) with torch.no_grad(): logits = model(inputs.input_values, attention_mask=inputs.attention_mask).logits predicted_ids = torch.argmax(logits, dim=-1) predicted_sentences = processor.batch_decode(predicted_ids) for i, predicted_sentence in enumerate(predicted_sentences): print("-" * 100) print("Reference:", test_dataset[i]["sentence"]) print("Prediction:", predicted_sentence) ``` | Reference | Prediction | | ------------- | ------------- | | ألديك قلم ؟ | ألديك قلم | | ليست هناك مسافة على هذه الأرض أبعد من يوم أمس. | ليست نالك مسافة على هذه الأرض أبعد من يوم الأمس م | | إنك تكبر المشكلة. | إنك تكبر المشكلة | | يرغب أن يلتقي بك. | يرغب أن يلتقي بك | | إنهم لا يعرفون لماذا حتى. | إنهم لا يعرفون لماذا حتى | | سيسعدني مساعدتك أي وقت تحب. | سيسئدنيمساعدتك أي وقد تحب | | أَحَبُّ نظريّة علمية إليّ هي أن حلقات زحل مكونة بالكامل من الأمتعة المفقودة. | أحب نظرية علمية إلي هي أن حل قتزح المكوينا بالكامل من الأمت عن المفقودة | | سأشتري له قلماً. | سأشتري له قلما | | أين المشكلة ؟ | أين المشكل | | وَلِلَّهِ يَسْجُدُ مَا فِي السَّمَاوَاتِ وَمَا فِي الْأَرْضِ مِنْ دَابَّةٍ وَالْمَلَائِكَةُ وَهُمْ لَا يَسْتَكْبِرُونَ | ولله يسجد ما في السماوات وما في الأرض من دابة والملائكة وهم لا يستكبرون | ## Evaluation The model can be evaluated as follows on the Arabic test data of Common Voice. ```python import torch import re import librosa from datasets import load_dataset, load_metric from transformers import Wav2Vec2ForCTC, Wav2Vec2Processor LANG_ID = "ar" MODEL_ID = "jonatasgrosman/wav2vec2-large-xlsr-53-arabic" DEVICE = "cuda" CHARS_TO_IGNORE = [",", "?", "¿", ".", "!", "¡", ";", "；", ":", '""', "%", '"', "�", "ʿ", "·", "჻", "~", "՞", "؟", "،", "।", "॥", "«", "»", "„", "“", "”", "「", "」", "‘", "’", "《", "》", "(", ")", "[", "]", "{", "}", "=", "`", "_", "+", "<", ">", "…", "–", "°", "´", "ʾ", "‹", "›", "©", "®", "—", "→", "。", "、", "﹂", "﹁", "‧", "～", "﹏", "，", "｛", "｝", "（", "）", "［", "］", "【", "】", "‥", "〽", "『", "』", "〝", "〟", "⟨", "⟩", "〜", "：", "！", "？", "♪", "؛", "/", "\\", "º", "−", "^", "'", "ʻ", "ˆ"] test_dataset = load_dataset("common_voice", LANG_ID, split="test") wer = load_metric("wer.py") # https://github.com/jonatasgrosman/wav2vec2-sprint/blob/main/wer.py cer = load_metric("cer.py") # https://github.com/jonatasgrosman/wav2vec2-sprint/blob/main/cer.py chars_to_ignore_regex = f"[{re.escape(''.join(CHARS_TO_IGNORE))}]" processor = Wav2Vec2Processor.from_pretrained(MODEL_ID) model = Wav2Vec2ForCTC.from_pretrained(MODEL_ID) model.to(DEVICE) # Preprocessing the datasets. # We need to read the audio files as arrays def speech_file_to_array_fn(batch): with warnings.catch_warnings(): warnings.simplefilter("ignore") speech_array, sampling_rate = librosa.load(batch["path"], sr=16_000) batch["speech"] = speech_array batch["sentence"] = re.sub(chars_to_ignore_regex, "", batch["sentence"]).upper() return batch test_dataset = test_dataset.map(speech_file_to_array_fn) # Preprocessing the datasets. # We need to read the audio files as arrays def evaluate(batch): inputs = processor(batch["speech"], sampling_rate=16_000, return_tensors="pt", padding=True) with torch.no_grad(): logits = model(inputs.input_values.to(DEVICE), attention_mask=inputs.attention_mask.to(DEVICE)).logits pred_ids = torch.argmax(logits, dim=-1) batch["pred_strings"] = processor.batch_decode(pred_ids) return batch result = test_dataset.map(evaluate, batched=True, batch_size=8) predictions = [x.upper() for x in result["pred_strings"]] references = [x.upper() for x in result["sentence"]] print(f"WER: {wer.compute(predictions=predictions, references=references, chunk_size=1000) * 100}") print(f"CER: {cer.compute(predictions=predictions, references=references, chunk_size=1000) * 100}") ``` **Test Result**: In the table below I report the Word Error Rate (WER) and the Character Error Rate (CER) of the model. I ran the evaluation script described above on other models as well (on 2021-05-14). Note that the table below may show different results from those already reported, this may have been caused due to some specificity of the other evaluation scripts used. | Model | WER | CER | | ------------- | ------------- | ------------- | | jonatasgrosman/wav2vec2-large-xlsr-53-arabic | **39.59%** | **18.18%** | | bakrianoo/sinai-voice-ar-stt | 45.30% | 21.84% | | othrif/wav2vec2-large-xlsr-arabic | 45.93% | 20.51% | | kmfoda/wav2vec2-large-xlsr-arabic | 54.14% | 26.07% | | mohammed/wav2vec2-large-xlsr-arabic | 56.11% | 26.79% | | anas/wav2vec2-large-xlsr-arabic | 62.02% | 27.09% | | elgeish/wav2vec2-large-xlsr-53-arabic | 100.00% | 100.56% | ## Citation If you want to cite this model you can use this: ```bibtex @misc{grosman2021xlsr53-large-arabic, title={Fine-tuned {XLSR}-53 large model for speech recognition in {A}rabic}, author={Grosman, Jonatas}, howpublished={\url{https://huggingface.co/jonatasgrosman/wav2vec2-large-xlsr-53-arabic}}, year={2021} } ```

facebook/esm2_t6_8M_UR50D

facebook

transformers

fill-mask

--- license: mit widget: - text: "MQIFVKTLTGKTITLEVEPS<mask>TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG" --- ## ESM-2 ESM-2 is a state-of-the-art protein model trained on a masked language modelling objective. It is suitable for fine-tuning on a wide range of tasks that take protein sequences as input. For detailed information on the model architecture and training data, please refer to the [accompanying paper](https://www.biorxiv.org/content/10.1101/2022.07.20.500902v2). You may also be interested in some demo notebooks ([PyTorch](https://colab.research.google.com/github/huggingface/notebooks/blob/main/examples/protein_language_modeling.ipynb), [TensorFlow](https://colab.research.google.com/github/huggingface/notebooks/blob/main/examples/protein_language_modeling-tf.ipynb)) which demonstrate how to fine-tune ESM-2 models on your tasks of interest. Several ESM-2 checkpoints are available in the Hub with varying sizes. Larger sizes generally have somewhat better accuracy, but require much more memory and time to train: | Checkpoint name | Num layers | Num parameters | |------------------------------|----|----------| | [esm2_t48_15B_UR50D](https://huggingface.co/facebook/esm2_t48_15B_UR50D) | 48 | 15B | | [esm2_t36_3B_UR50D](https://huggingface.co/facebook/esm2_t36_3B_UR50D) | 36 | 3B | | [esm2_t33_650M_UR50D](https://huggingface.co/facebook/esm2_t33_650M_UR50D) | 33 | 650M | | [esm2_t30_150M_UR50D](https://huggingface.co/facebook/esm2_t30_150M_UR50D) | 30 | 150M | | [esm2_t12_35M_UR50D](https://huggingface.co/facebook/esm2_t12_35M_UR50D) | 12 | 35M | | [esm2_t6_8M_UR50D](https://huggingface.co/facebook/esm2_t6_8M_UR50D) | 6 | 8M |

amazon/chronos-t5-mini

amazon

transformers

time-series-forecasting

--- license: apache-2.0 pipeline_tag: time-series-forecasting tags: - time series - forecasting - pretrained models - foundation models - time series foundation models - time-series --- # Chronos-T5 (Mini) Chronos is a family of **pretrained time series forecasting models** based on language model architectures. A time series is transformed into a sequence of tokens via scaling and quantization, and a language model is trained on these tokens using the cross-entropy loss. Once trained, probabilistic forecasts are obtained by sampling multiple future trajectories given the historical context. Chronos models have been trained on a large corpus of publicly available time series data, as well as synthetic data generated using Gaussian processes. For details on Chronos models, training data and procedures, and experimental results, please refer to the paper [Chronos: Learning the Language of Time Series](https://arxiv.org/abs/2403.07815). <p align="center"> <img src="figures/main-figure.png" width="100%"> <br /> <span> Fig. 1: High-level depiction of Chronos. (<b>Left</b>) The input time series is scaled and quantized to obtain a sequence of tokens. (<b>Center</b>) The tokens are fed into a language model which may either be an encoder-decoder or a decoder-only model. The model is trained using the cross-entropy loss. (<b>Right</b>) During inference, we autoregressively sample tokens from the model and map them back to numerical values. Multiple trajectories are sampled to obtain a predictive distribution. </span> </p> --- ## Architecture The models in this repository are based on the [T5 architecture](https://arxiv.org/abs/1910.10683). The only difference is in the vocabulary size: Chronos-T5 models use 4096 different tokens, compared to 32128 of the original T5 models, resulting in fewer parameters. | Model | Parameters | Based on | | ---------------------------------------------------------------------- | ---------- | ---------------------------------------------------------------------- | | [**chronos-t5-tiny**](https://huggingface.co/amazon/chronos-t5-tiny) | 8M | [t5-efficient-tiny](https://huggingface.co/google/t5-efficient-tiny) | | [**chronos-t5-mini**](https://huggingface.co/amazon/chronos-t5-mini) | 20M | [t5-efficient-mini](https://huggingface.co/google/t5-efficient-mini) | | [**chronos-t5-small**](https://huggingface.co/amazon/chronos-t5-small) | 46M | [t5-efficient-small](https://huggingface.co/google/t5-efficient-small) | | [**chronos-t5-base**](https://huggingface.co/amazon/chronos-t5-base) | 200M | [t5-efficient-base](https://huggingface.co/google/t5-efficient-base) | | [**chronos-t5-large**](https://huggingface.co/amazon/chronos-t5-large) | 710M | [t5-efficient-large](https://huggingface.co/google/t5-efficient-large) | ## Usage To perform inference with Chronos models, install the package in the GitHub [companion repo](https://github.com/amazon-science/chronos-forecasting) by running: ``` pip install git+https://github.com/amazon-science/chronos-forecasting.git ``` A minimal example showing how to perform inference using Chronos models: ```python import matplotlib.pyplot as plt import numpy as np import pandas as pd import torch from chronos import ChronosPipeline pipeline = ChronosPipeline.from_pretrained( "amazon/chronos-t5-mini", device_map="cuda", torch_dtype=torch.bfloat16, ) df = pd.read_csv("https://raw.githubusercontent.com/AileenNielsen/TimeSeriesAnalysisWithPython/master/data/AirPassengers.csv") # context must be either a 1D tensor, a list of 1D tensors, # or a left-padded 2D tensor with batch as the first dimension context = torch.tensor(df["#Passengers"]) prediction_length = 12 forecast = pipeline.predict(context, prediction_length) # shape [num_series, num_samples, prediction_length] # visualize the forecast forecast_index = range(len(df), len(df) + prediction_length) low, median, high = np.quantile(forecast[0].numpy(), [0.1, 0.5, 0.9], axis=0) plt.figure(figsize=(8, 4)) plt.plot(df["#Passengers"], color="royalblue", label="historical data") plt.plot(forecast_index, median, color="tomato", label="median forecast") plt.fill_between(forecast_index, low, high, color="tomato", alpha=0.3, label="80% prediction interval") plt.legend() plt.grid() plt.show() ``` ## Citation If you find Chronos models useful for your research, please consider citing the associated [paper](https://arxiv.org/abs/2403.07815): ``` @article{ansari2024chronos, author = {Ansari, Abdul Fatir and Stella, Lorenzo and Turkmen, Caner and Zhang, Xiyuan, and Mercado, Pedro and Shen, Huibin and Shchur, Oleksandr and Rangapuram, Syama Syndar and Pineda Arango, Sebastian and Kapoor, Shubham and Zschiegner, Jasper and Maddix, Danielle C. and Mahoney, Michael W. and Torkkola, Kari and Gordon Wilson, Andrew and Bohlke-Schneider, Michael and Wang, Yuyang}, title = {Chronos: Learning the Language of Time Series}, journal = {arXiv preprint arXiv:2403.07815}, year = {2024} } ``` ## Security See [CONTRIBUTING](CONTRIBUTING.md#security-issue-notifications) for more information. ## License This project is licensed under the Apache-2.0 License.

facebook/roberta-hate-speech-dynabench-r4-target

facebook

transformers

text-classification

--- language: en --- # LFTW R4 Target The R4 Target model from [Learning from the Worst: Dynamically Generated Datasets to Improve Online Hate Detection](https://arxiv.org/abs/2012.15761) ## Citation Information ```bibtex @inproceedings{vidgen2021lftw, title={Learning from the Worst: Dynamically Generated Datasets to Improve Online Hate Detection}, author={Bertie Vidgen and Tristan Thrush and Zeerak Waseem and Douwe Kiela}, booktitle={ACL}, year={2021} } ``` Thanks to Kushal Tirumala and Adina Williams for helping the authors put the model on the hub!

facebook/wav2vec2-base

facebook

transformers

--- language: en datasets: - librispeech_asr tags: - speech license: apache-2.0 --- # Wav2Vec2-Base [Facebook's Wav2Vec2](https://ai.facebook.com/blog/wav2vec-20-learning-the-structure-of-speech-from-raw-audio/) The base model pretrained on 16kHz sampled speech audio. When using the model make sure that your speech input is also sampled at 16Khz. **Note**: This model does not have a tokenizer as it was pretrained on audio alone. In order to use this model **speech recognition**, a tokenizer should be created and the model should be fine-tuned on labeled text data. Check out [this blog](https://huggingface.co/blog/fine-tune-wav2vec2-english) for more in-detail explanation of how to fine-tune the model. [Paper](https://arxiv.org/abs/2006.11477) Authors: Alexei Baevski, Henry Zhou, Abdelrahman Mohamed, Michael Auli **Abstract** We show for the first time that learning powerful representations from speech audio alone followed by fine-tuning on transcribed speech can outperform the best semi-supervised methods while being conceptually simpler. wav2vec 2.0 masks the speech input in the latent space and solves a contrastive task defined over a quantization of the latent representations which are jointly learned. Experiments using all labeled data of Librispeech achieve 1.8/3.3 WER on the clean/other test sets. When lowering the amount of labeled data to one hour, wav2vec 2.0 outperforms the previous state of the art on the 100 hour subset while using 100 times less labeled data. Using just ten minutes of labeled data and pre-training on 53k hours of unlabeled data still achieves 4.8/8.2 WER. This demonstrates the feasibility of speech recognition with limited amounts of labeled data. The original model can be found under https://github.com/pytorch/fairseq/tree/master/examples/wav2vec#wav2vec-20. # Usage See [this notebook](https://colab.research.google.com/drive/1FjTsqbYKphl9kL-eILgUc-bl4zVThL8F?usp=sharing) for more information on how to fine-tune the model.

cointegrated/rubert-tiny

cointegrated

transformers

fill-mask

--- language: - ru - en tags: - russian - fill-mask - pretraining - embeddings - masked-lm - tiny - feature-extraction - sentence-similarity license: mit widget: - text: Миниатюрная модель для [MASK] разных задач. pipeline_tag: fill-mask --- This is a very small distilled version of the [bert-base-multilingual-cased](https://huggingface.co/bert-base-multilingual-cased) model for Russian and English (45 MB, 12M parameters). There is also an **updated version of this model**, [rubert-tiny2](https://huggingface.co/cointegrated/rubert-tiny2), with a larger vocabulary and better quality on practically all Russian NLU tasks. This model is useful if you want to fine-tune it for a relatively simple Russian task (e.g. NER or sentiment classification), and you care more about speed and size than about accuracy. It is approximately x10 smaller and faster than a base-sized BERT. Its `[CLS]` embeddings can be used as a sentence representation aligned between Russian and English. It was trained on the [Yandex Translate corpus](https://translate.yandex.ru/corpus), [OPUS-100](https://huggingface.co/datasets/opus100) and [Tatoeba](https://huggingface.co/datasets/tatoeba), using MLM loss (distilled from [bert-base-multilingual-cased](https://huggingface.co/bert-base-multilingual-cased)), translation ranking loss, and `[CLS]` embeddings distilled from [LaBSE](https://huggingface.co/sentence-transformers/LaBSE), [rubert-base-cased-sentence](https://huggingface.co/DeepPavlov/rubert-base-cased-sentence), Laser and USE. There is a more detailed [description in Russian](https://habr.com/ru/post/562064/). Sentence embeddings can be produced as follows: ```python # pip install transformers sentencepiece import torch from transformers import AutoTokenizer, AutoModel tokenizer = AutoTokenizer.from_pretrained("cointegrated/rubert-tiny") model = AutoModel.from_pretrained("cointegrated/rubert-tiny") # model.cuda() # uncomment it if you have a GPU def embed_bert_cls(text, model, tokenizer): t = tokenizer(text, padding=True, truncation=True, return_tensors='pt') with torch.no_grad(): model_output = model(**{k: v.to(model.device) for k, v in t.items()}) embeddings = model_output.last_hidden_state[:, 0, :] embeddings = torch.nn.functional.normalize(embeddings) return embeddings[0].cpu().numpy() print(embed_bert_cls('привет мир', model, tokenizer).shape) # (312,) ```

pysentimiento/robertuito-sentiment-analysis

pysentimiento

pysentimiento

text-classification

--- language: - es library_name: pysentimiento pipeline_tag: text-classification tags: - twitter - sentiment-analysis --- # Sentiment Analysis in Spanish ## robertuito-sentiment-analysis Repository: [https://github.com/pysentimiento/pysentimiento/](https://github.com/finiteautomata/pysentimiento/) Model trained with TASS 2020 corpus (around ~5k tweets) of several dialects of Spanish. Base model is [RoBERTuito](https://github.com/pysentimiento/robertuito), a RoBERTa model trained in Spanish tweets. Uses `POS`, `NEG`, `NEU` labels. ## Usage Use it directly with [pysentimiento](https://github.com/pysentimiento/pysentimiento) ```python from pysentimiento import create_analyzer analyzer = create_analyzer(task="sentiment", lang="es") analyzer.predict("Qué gran jugador es Messi") # returns AnalyzerOutput(output=POS, probas={POS: 0.998, NEG: 0.002, NEU: 0.000}) ``` ## Results Results for the four tasks evaluated in `pysentimiento`. Results are expressed as Macro F1 scores | model | emotion | hate_speech | irony | sentiment | |:--------------|:--------------|:--------------|:--------------|:--------------| | robertuito | 0.560 ± 0.010 | 0.759 ± 0.007 | 0.739 ± 0.005 | 0.705 ± 0.003 | | roberta | 0.527 ± 0.015 | 0.741 ± 0.012 | 0.721 ± 0.008 | 0.670 ± 0.006 | | bertin | 0.524 ± 0.007 | 0.738 ± 0.007 | 0.713 ± 0.012 | 0.666 ± 0.005 | | beto_uncased | 0.532 ± 0.012 | 0.727 ± 0.016 | 0.701 ± 0.007 | 0.651 ± 0.006 | | beto_cased | 0.516 ± 0.012 | 0.724 ± 0.012 | 0.705 ± 0.009 | 0.662 ± 0.005 | | mbert_uncased | 0.493 ± 0.010 | 0.718 ± 0.011 | 0.681 ± 0.010 | 0.617 ± 0.003 | | biGRU | 0.264 ± 0.007 | 0.592 ± 0.018 | 0.631 ± 0.011 | 0.585 ± 0.011 | Note that for Hate Speech, these are the results for Semeval 2019, Task 5 Subtask B ## Citation If you use this model in your research, please cite pysentimiento, RoBERTuito and TASS papers: ```latex @article{perez2021pysentimiento, title={pysentimiento: a python toolkit for opinion mining and social NLP tasks}, author={P{\'e}rez, Juan Manuel and Rajngewerc, Mariela and Giudici, Juan Carlos and Furman, Dami{\'a}n A and Luque, Franco and Alemany, Laura Alonso and Mart{\'\i}nez, Mar{\'\i}a Vanina}, journal={arXiv preprint arXiv:2106.09462}, year={2021} } @inproceedings{perez-etal-2022-robertuito, title = "{R}o{BERT}uito: a pre-trained language model for social media text in {S}panish", author = "P{\'e}rez, Juan Manuel and Furman, Dami{\'a}n Ariel and Alonso Alemany, Laura and Luque, Franco M.", booktitle = "Proceedings of the Thirteenth Language Resources and Evaluation Conference", month = jun, year = "2022", address = "Marseille, France", publisher = "European Language Resources Association", url = "https://aclanthology.org/2022.lrec-1.785", pages = "7235--7243", abstract = "Since BERT appeared, Transformer language models and transfer learning have become state-of-the-art for natural language processing tasks. Recently, some works geared towards pre-training specially-crafted models for particular domains, such as scientific papers, medical documents, user-generated texts, among others. These domain-specific models have been shown to improve performance significantly in most tasks; however, for languages other than English, such models are not widely available. In this work, we present RoBERTuito, a pre-trained language model for user-generated text in Spanish, trained on over 500 million tweets. Experiments on a benchmark of tasks involving user-generated text showed that RoBERTuito outperformed other pre-trained language models in Spanish. In addition to this, our model has some cross-lingual abilities, achieving top results for English-Spanish tasks of the Linguistic Code-Switching Evaluation benchmark (LinCE) and also competitive performance against monolingual models in English Twitter tasks. To facilitate further research, we make RoBERTuito publicly available at the HuggingFace model hub together with the dataset used to pre-train it.", } @inproceedings{garcia2020overview, title={Overview of TASS 2020: Introducing emotion detection}, author={Garc{\'\i}a-Vega, Manuel and D{\'\i}az-Galiano, MC and Garc{\'\i}a-Cumbreras, MA and Del Arco, FMP and Montejo-R{\'a}ez, A and Jim{\'e}nez-Zafra, SM and Mart{\'\i}nez C{\'a}mara, E and Aguilar, CA and Cabezudo, MAS and Chiruzzo, L and others}, booktitle={Proceedings of the Iberian Languages Evaluation Forum (IberLEF 2020) Co-Located with 36th Conference of the Spanish Society for Natural Language Processing (SEPLN 2020), M{\'a}laga, Spain}, pages={163--170}, year={2020} } ```

nlpconnect/vit-gpt2-image-captioning

nlpconnect

transformers

image-to-text

--- tags: - image-to-text - image-captioning license: apache-2.0 widget: - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/savanna.jpg example_title: Savanna - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/football-match.jpg example_title: Football Match - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/airport.jpg example_title: Airport --- # nlpconnect/vit-gpt2-image-captioning This is an image captioning model trained by @ydshieh in [flax ](https://github.com/huggingface/transformers/tree/main/examples/flax/image-captioning) this is pytorch version of [this](https://huggingface.co/ydshieh/vit-gpt2-coco-en-ckpts). # The Illustrated Image Captioning using transformers  * https://ankur3107.github.io/blogs/the-illustrated-image-captioning-using-transformers/ # Sample running code ```python from transformers import VisionEncoderDecoderModel, ViTImageProcessor, AutoTokenizer import torch from PIL import Image model = VisionEncoderDecoderModel.from_pretrained("nlpconnect/vit-gpt2-image-captioning") feature_extractor = ViTImageProcessor.from_pretrained("nlpconnect/vit-gpt2-image-captioning") tokenizer = AutoTokenizer.from_pretrained("nlpconnect/vit-gpt2-image-captioning") device = torch.device("cuda" if torch.cuda.is_available() else "cpu") model.to(device) max_length = 16 num_beams = 4 gen_kwargs = {"max_length": max_length, "num_beams": num_beams} def predict_step(image_paths): images = [] for image_path in image_paths: i_image = Image.open(image_path) if i_image.mode != "RGB": i_image = i_image.convert(mode="RGB") images.append(i_image) pixel_values = feature_extractor(images=images, return_tensors="pt").pixel_values pixel_values = pixel_values.to(device) output_ids = model.generate(pixel_values, **gen_kwargs) preds = tokenizer.batch_decode(output_ids, skip_special_tokens=True) preds = [pred.strip() for pred in preds] return preds predict_step(['doctor.e16ba4e4.jpg']) # ['a woman in a hospital bed with a woman in a hospital bed'] ``` # Sample running code using transformers pipeline ```python from transformers import pipeline image_to_text = pipeline("image-to-text", model="nlpconnect/vit-gpt2-image-captioning") image_to_text("https://ankur3107.github.io/assets/images/image-captioning-example.png") # [{'generated_text': 'a soccer game with a player jumping to catch the ball '}] ``` # Contact for any help * https://huggingface.co/ankur310794 * https://twitter.com/ankur310794 * http://github.com/ankur3107 * https://www.linkedin.com/in/ankur310794

BAAI/bge-m3

BAAI

sentence-transformers

sentence-similarity

--- pipeline_tag: sentence-similarity tags: - sentence-transformers - feature-extraction - sentence-similarity license: mit --- For more details please refer to our github repo: https://github.com/FlagOpen/FlagEmbedding # BGE-M3 ([paper](https://arxiv.org/pdf/2402.03216.pdf), [code](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3)) In this project, we introduce BGE-M3, which is distinguished for its versatility in Multi-Functionality, Multi-Linguality, and Multi-Granularity. - Multi-Functionality: It can simultaneously perform the three common retrieval functionalities of embedding model: dense retrieval, multi-vector retrieval, and sparse retrieval. - Multi-Linguality: It can support more than 100 working languages. - Multi-Granularity: It is able to process inputs of different granularities, spanning from short sentences to long documents of up to 8192 tokens. **Some suggestions for retrieval pipeline in RAG** We recommend to use the following pipeline: hybrid retrieval + re-ranking. - Hybrid retrieval leverages the strengths of various methods, offering higher accuracy and stronger generalization capabilities. A classic example: using both embedding retrieval and the BM25 algorithm. Now, you can try to use BGE-M3, which supports both embedding and sparse retrieval. This allows you to obtain token weights (similar to the BM25) without any additional cost when generate dense embeddings. To use hybrid retrieval, you can refer to [Vespa](https://github.com/vespa-engine/pyvespa/blob/master/docs/sphinx/source/examples/mother-of-all-embedding-models-cloud.ipynb ) and [Milvus](https://github.com/milvus-io/pymilvus/blob/master/examples/hello_hybrid_sparse_dense.py). - As cross-encoder models, re-ranker demonstrates higher accuracy than bi-encoder embedding model. Utilizing the re-ranking model (e.g., [bge-reranker](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker), [bge-reranker-v2](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_reranker)) after retrieval can further filter the selected text. ## News: - 2024/7/1: **We update the MIRACL evaluation results of BGE-M3**. To reproduce the new results, you can refer to: [bge-m3_miracl_2cr](https://huggingface.co/datasets/hanhainebula/bge-m3_miracl_2cr). We have also updated our [paper](https://arxiv.org/pdf/2402.03216) on arXiv. <details> <summary> Details </summary> The previous test results were lower because we mistakenly removed the passages that have the same id as the query from the search results. After correcting this mistake, the overall performance of BGE-M3 on MIRACL is higher than the previous results, but the experimental conclusion remains unchanged. The other results are not affected by this mistake. To reproduce the previous lower results, you need to add the `--remove-query` parameter when using `pyserini.search.faiss` or `pyserini.search.lucene` to search the passages. </details> - 2024/3/20: **Thanks Milvus team!** Now you can use hybrid retrieval of bge-m3 in Milvus: [pymilvus/examples /hello_hybrid_sparse_dense.py](https://github.com/milvus-io/pymilvus/blob/master/examples/hello_hybrid_sparse_dense.py). - 2024/3/8: **Thanks for the [experimental results](https://towardsdatascience.com/openai-vs-open-source-multilingual-embedding-models-e5ccb7c90f05) from @[Yannael](https://huggingface.co/Yannael). In this benchmark, BGE-M3 achieves top performance in both English and other languages, surpassing models such as OpenAI.** - 2024/3/2: Release unified fine-tuning [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/unified_finetune) and [data](https://huggingface.co/datasets/Shitao/bge-m3-data) - 2024/2/6: We release the [MLDR](https://huggingface.co/datasets/Shitao/MLDR) (a long document retrieval dataset covering 13 languages) and [evaluation pipeline](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB/MLDR). - 2024/2/1: **Thanks for the excellent tool from Vespa.** You can easily use multiple modes of BGE-M3 following this [notebook](https://github.com/vespa-engine/pyvespa/blob/master/docs/sphinx/source/examples/mother-of-all-embedding-models-cloud.ipynb) ## Specs - Model | Model Name | Dimension | Sequence Length | Introduction | |:----:|:---:|:---:|:---:| | [BAAI/bge-m3](https://huggingface.co/BAAI/bge-m3) | 1024 | 8192 | multilingual; unified fine-tuning (dense, sparse, and colbert) from bge-m3-unsupervised| | [BAAI/bge-m3-unsupervised](https://huggingface.co/BAAI/bge-m3-unsupervised) | 1024 | 8192 | multilingual; contrastive learning from bge-m3-retromae | | [BAAI/bge-m3-retromae](https://huggingface.co/BAAI/bge-m3-retromae) | -- | 8192 | multilingual; extend the max_length of [xlm-roberta](https://huggingface.co/FacebookAI/xlm-roberta-large) to 8192 and further pretrained via [retromae](https://github.com/staoxiao/RetroMAE)| | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | 1024 | 512 | English model | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | 768 | 512 | English model | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | 384 | 512 | English model | - Data | Dataset | Introduction | |:----------------------------------------------------------:|:-------------------------------------------------:| | [MLDR](https://huggingface.co/datasets/Shitao/MLDR) | Docuemtn Retrieval Dataset, covering 13 languages | | [bge-m3-data](https://huggingface.co/datasets/Shitao/bge-m3-data) | Fine-tuning data used by bge-m3 | ## FAQ **1. Introduction for different retrieval methods** - Dense retrieval: map the text into a single embedding, e.g., [DPR](https://arxiv.org/abs/2004.04906), [BGE-v1.5](https://github.com/FlagOpen/FlagEmbedding) - Sparse retrieval (lexical matching): a vector of size equal to the vocabulary, with the majority of positions set to zero, calculating a weight only for tokens present in the text. e.g., BM25, [unicoil](https://arxiv.org/pdf/2106.14807.pdf), and [splade](https://arxiv.org/abs/2107.05720) - Multi-vector retrieval: use multiple vectors to represent a text, e.g., [ColBERT](https://arxiv.org/abs/2004.12832). **2. How to use BGE-M3 in other projects?** For embedding retrieval, you can employ the BGE-M3 model using the same approach as BGE. The only difference is that the BGE-M3 model no longer requires adding instructions to the queries. For hybrid retrieval, you can use [Vespa](https://github.com/vespa-engine/pyvespa/blob/master/docs/sphinx/source/examples/mother-of-all-embedding-models-cloud.ipynb ) and [Milvus](https://github.com/milvus-io/pymilvus/blob/master/examples/hello_hybrid_sparse_dense.py). **3. How to fine-tune bge-M3 model?** You can follow the common in this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) to fine-tune the dense embedding. If you want to fine-tune all embedding function of m3 (dense, sparse and colbert), you can refer to the [unified_fine-tuning example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/unified_finetune) ## Usage Install: ``` git clone https://github.com/FlagOpen/FlagEmbedding.git cd FlagEmbedding pip install -e . ``` or: ``` pip install -U FlagEmbedding ``` ### Generate Embedding for text - Dense Embedding ```python from FlagEmbedding import BGEM3FlagModel model = BGEM3FlagModel('BAAI/bge-m3', use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation sentences_1 = ["What is BGE M3?", "Defination of BM25"] sentences_2 = ["BGE M3 is an embedding model supporting dense retrieval, lexical matching and multi-vector interaction.", "BM25 is a bag-of-words retrieval function that ranks a set of documents based on the query terms appearing in each document"] embeddings_1 = model.encode(sentences_1, batch_size=12, max_length=8192, # If you don't need such a long length, you can set a smaller value to speed up the encoding process. )['dense_vecs'] embeddings_2 = model.encode(sentences_2)['dense_vecs'] similarity = embeddings_1 @ embeddings_2.T print(similarity) # [[0.6265, 0.3477], [0.3499, 0.678 ]] ``` You also can use sentence-transformers and huggingface transformers to generate dense embeddings. Refer to [baai_general_embedding](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/baai_general_embedding#usage) for details. - Sparse Embedding (Lexical Weight) ```python from FlagEmbedding import BGEM3FlagModel model = BGEM3FlagModel('BAAI/bge-m3', use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation sentences_1 = ["What is BGE M3?", "Defination of BM25"] sentences_2 = ["BGE M3 is an embedding model supporting dense retrieval, lexical matching and multi-vector interaction.", "BM25 is a bag-of-words retrieval function that ranks a set of documents based on the query terms appearing in each document"] output_1 = model.encode(sentences_1, return_dense=True, return_sparse=True, return_colbert_vecs=False) output_2 = model.encode(sentences_2, return_dense=True, return_sparse=True, return_colbert_vecs=False) # you can see the weight for each token: print(model.convert_id_to_token(output_1['lexical_weights'])) # [{'What': 0.08356, 'is': 0.0814, 'B': 0.1296, 'GE': 0.252, 'M': 0.1702, '3': 0.2695, '?': 0.04092}, # {'De': 0.05005, 'fin': 0.1368, 'ation': 0.04498, 'of': 0.0633, 'BM': 0.2515, '25': 0.3335}] # compute the scores via lexical mathcing lexical_scores = model.compute_lexical_matching_score(output_1['lexical_weights'][0], output_2['lexical_weights'][0]) print(lexical_scores) # 0.19554901123046875 print(model.compute_lexical_matching_score(output_1['lexical_weights'][0], output_1['lexical_weights'][1])) # 0.0 ``` - Multi-Vector (ColBERT) ```python from FlagEmbedding import BGEM3FlagModel model = BGEM3FlagModel('BAAI/bge-m3', use_fp16=True) sentences_1 = ["What is BGE M3?", "Defination of BM25"] sentences_2 = ["BGE M3 is an embedding model supporting dense retrieval, lexical matching and multi-vector interaction.", "BM25 is a bag-of-words retrieval function that ranks a set of documents based on the query terms appearing in each document"] output_1 = model.encode(sentences_1, return_dense=True, return_sparse=True, return_colbert_vecs=True) output_2 = model.encode(sentences_2, return_dense=True, return_sparse=True, return_colbert_vecs=True) print(model.colbert_score(output_1['colbert_vecs'][0], output_2['colbert_vecs'][0])) print(model.colbert_score(output_1['colbert_vecs'][0], output_2['colbert_vecs'][1])) # 0.7797 # 0.4620 ``` ### Compute score for text pairs Input a list of text pairs, you can get the scores computed by different methods. ```python from FlagEmbedding import BGEM3FlagModel model = BGEM3FlagModel('BAAI/bge-m3', use_fp16=True) sentences_1 = ["What is BGE M3?", "Defination of BM25"] sentences_2 = ["BGE M3 is an embedding model supporting dense retrieval, lexical matching and multi-vector interaction.", "BM25 is a bag-of-words retrieval function that ranks a set of documents based on the query terms appearing in each document"] sentence_pairs = [[i,j] for i in sentences_1 for j in sentences_2] print(model.compute_score(sentence_pairs, max_passage_length=128, # a smaller max length leads to a lower latency weights_for_different_modes=[0.4, 0.2, 0.4])) # weights_for_different_modes(w) is used to do weighted sum: w[0]*dense_score + w[1]*sparse_score + w[2]*colbert_score # { # 'colbert': [0.7796499729156494, 0.4621465802192688, 0.4523794651031494, 0.7898575067520142], # 'sparse': [0.195556640625, 0.00879669189453125, 0.0, 0.1802978515625], # 'dense': [0.6259765625, 0.347412109375, 0.349853515625, 0.67822265625], # 'sparse+dense': [0.482503205537796, 0.23454029858112335, 0.2332356721162796, 0.5122477412223816], # 'colbert+sparse+dense': [0.6013619303703308, 0.3255828022956848, 0.32089319825172424, 0.6232916116714478] # } ``` ## Evaluation We provide the evaluation script for [MKQA](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB/MKQA) and [MLDR](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB/MLDR) ### Benchmarks from the open-source community  The BGE-M3 model emerged as the top performer on this benchmark (OAI is short for OpenAI). For more details, please refer to the [article](https://towardsdatascience.com/openai-vs-open-source-multilingual-embedding-models-e5ccb7c90f05) and [Github Repo](https://github.com/Yannael/multilingual-embeddings) ### Our results - Multilingual (Miracl dataset)  - Cross-lingual (MKQA dataset)  - Long Document Retrieval - MLDR:  Please note that [MLDR](https://huggingface.co/datasets/Shitao/MLDR) is a document retrieval dataset we constructed via LLM, covering 13 languages, including test set, validation set, and training set. We utilized the training set from MLDR to enhance the model's long document retrieval capabilities. Therefore, comparing baselines with `Dense w.o.long`(fine-tuning without long document dataset) is more equitable. Additionally, this long document retrieval dataset will be open-sourced to address the current lack of open-source multilingual long text retrieval datasets. We believe that this data will be helpful for the open-source community in training document retrieval models. - NarritiveQA:  - Comparison with BM25 We utilized Pyserini to implement BM25, and the test results can be reproduced by this [script](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB/MLDR#bm25-baseline). We tested BM25 using two different tokenizers: one using Lucene Analyzer and the other using the same tokenizer as M3 (i.e., the tokenizer of xlm-roberta). The results indicate that BM25 remains a competitive baseline, especially in long document retrieval.  ## Training - Self-knowledge Distillation: combining multiple outputs from different retrieval modes as reward signal to enhance the performance of single mode(especially for sparse retrieval and multi-vec(colbert) retrival) - Efficient Batching: Improve the efficiency when fine-tuning on long text. The small-batch strategy is simple but effective, which also can used to fine-tune large embedding model. - MCLS: A simple method to improve the performance on long text without fine-tuning. If you have no enough resource to fine-tuning model with long text, the method is useful. Refer to our [report](https://arxiv.org/pdf/2402.03216.pdf) for more details. ## Acknowledgement Thanks to the authors of open-sourced datasets, including Miracl, MKQA, NarritiveQA, etc. Thanks to the open-sourced libraries like [Tevatron](https://github.com/texttron/tevatron), [Pyserini](https://github.com/castorini/pyserini). ## Citation If you find this repository useful, please consider giving a star :star: and citation ``` @misc{bge-m3, title={BGE M3-Embedding: Multi-Lingual, Multi-Functionality, Multi-Granularity Text Embeddings Through Self-Knowledge Distillation}, author={Jianlv Chen and Shitao Xiao and Peitian Zhang and Kun Luo and Defu Lian and Zheng Liu}, year={2024}, eprint={2402.03216}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

autogluon/chronos-t5-tiny

autogluon

transformers

time-series-forecasting

--- license: apache-2.0 pipeline_tag: time-series-forecasting tags: - time series - forecasting - pretrained models - foundation models - time series foundation models - time-series --- # Chronos-T5 (Tiny) Chronos is a family of **pretrained time series forecasting models** based on language model architectures. A time series is transformed into a sequence of tokens via scaling and quantization, and a language model is trained on these tokens using the cross-entropy loss. Once trained, probabilistic forecasts are obtained by sampling multiple future trajectories given the historical context. Chronos models have been trained on a large corpus of publicly available time series data, as well as synthetic data generated using Gaussian processes. For details on Chronos models, training data and procedures, and experimental results, please refer to the paper [Chronos: Learning the Language of Time Series](https://arxiv.org/abs/2403.07815). <p align="center"> <img src="figures/main-figure.png" width="100%"> <br /> <span> Fig. 1: High-level depiction of Chronos. (<b>Left</b>) The input time series is scaled and quantized to obtain a sequence of tokens. (<b>Center</b>) The tokens are fed into a language model which may either be an encoder-decoder or a decoder-only model. The model is trained using the cross-entropy loss. (<b>Right</b>) During inference, we autoregressively sample tokens from the model and map them back to numerical values. Multiple trajectories are sampled to obtain a predictive distribution. </span> </p> --- ## Architecture The models in this repository are based on the [T5 architecture](https://arxiv.org/abs/1910.10683). The only difference is in the vocabulary size: Chronos-T5 models use 4096 different tokens, compared to 32128 of the original T5 models, resulting in fewer parameters. | Model | Parameters | Based on | | ---------------------------------------------------------------------- | ---------- | ---------------------------------------------------------------------- | | [**chronos-t5-tiny**](https://huggingface.co/amazon/chronos-t5-tiny) | 8M | [t5-efficient-tiny](https://huggingface.co/google/t5-efficient-tiny) | | [**chronos-t5-mini**](https://huggingface.co/amazon/chronos-t5-mini) | 20M | [t5-efficient-mini](https://huggingface.co/google/t5-efficient-mini) | | [**chronos-t5-small**](https://huggingface.co/amazon/chronos-t5-small) | 46M | [t5-efficient-small](https://huggingface.co/google/t5-efficient-small) | | [**chronos-t5-base**](https://huggingface.co/amazon/chronos-t5-base) | 200M | [t5-efficient-base](https://huggingface.co/google/t5-efficient-base) | | [**chronos-t5-large**](https://huggingface.co/amazon/chronos-t5-large) | 710M | [t5-efficient-large](https://huggingface.co/google/t5-efficient-large) | ## Usage To perform inference with Chronos models, install the package in the GitHub [companion repo](https://github.com/amazon-science/chronos-forecasting) by running: ``` pip install git+https://github.com/amazon-science/chronos-forecasting.git ``` A minimal example showing how to perform inference using Chronos models: ```python import matplotlib.pyplot as plt import numpy as np import pandas as pd import torch from chronos import ChronosPipeline pipeline = ChronosPipeline.from_pretrained( "amazon/chronos-t5-tiny", device_map="cuda", torch_dtype=torch.bfloat16, ) df = pd.read_csv("https://raw.githubusercontent.com/AileenNielsen/TimeSeriesAnalysisWithPython/master/data/AirPassengers.csv") # context must be either a 1D tensor, a list of 1D tensors, # or a left-padded 2D tensor with batch as the first dimension context = torch.tensor(df["#Passengers"]) prediction_length = 12 forecast = pipeline.predict(context, prediction_length) # shape [num_series, num_samples, prediction_length] # visualize the forecast forecast_index = range(len(df), len(df) + prediction_length) low, median, high = np.quantile(forecast[0].numpy(), [0.1, 0.5, 0.9], axis=0) plt.figure(figsize=(8, 4)) plt.plot(df["#Passengers"], color="royalblue", label="historical data") plt.plot(forecast_index, median, color="tomato", label="median forecast") plt.fill_between(forecast_index, low, high, color="tomato", alpha=0.3, label="80% prediction interval") plt.legend() plt.grid() plt.show() ``` ## Citation If you find Chronos models useful for your research, please consider citing the associated [paper](https://arxiv.org/abs/2403.07815): ``` @article{ansari2024chronos, author = {Ansari, Abdul Fatir and Stella, Lorenzo and Turkmen, Caner and Zhang, Xiyuan, and Mercado, Pedro and Shen, Huibin and Shchur, Oleksandr and Rangapuram, Syama Syndar and Pineda Arango, Sebastian and Kapoor, Shubham and Zschiegner, Jasper and Maddix, Danielle C. and Mahoney, Michael W. and Torkkola, Kari and Gordon Wilson, Andrew and Bohlke-Schneider, Michael and Wang, Yuyang}, title = {Chronos: Learning the Language of Time Series}, journal = {arXiv preprint arXiv:2403.07815}, year = {2024} } ``` ## Security See [CONTRIBUTING](CONTRIBUTING.md#security-issue-notifications) for more information. ## License This project is licensed under the Apache-2.0 License.

BAAI/bge-reranker-large

BAAI

transformers

feature-extraction

--- license: mit language: - en - zh tags: - mteb model-index: - name: bge-reranker-base results: - task: type: Reranking dataset: type: C-MTEB/CMedQAv1-reranking name: MTEB CMedQAv1 config: default split: test revision: None metrics: - type: map value: 81.27206722525007 - type: mrr value: 84.14238095238095 - task: type: Reranking dataset: type: C-MTEB/CMedQAv2-reranking name: MTEB CMedQAv2 config: default split: test revision: None metrics: - type: map value: 84.10369934291236 - type: mrr value: 86.79376984126984 - task: type: Reranking dataset: type: C-MTEB/Mmarco-reranking name: MTEB MMarcoReranking config: default split: dev revision: None metrics: - type: map value: 35.4600511272538 - type: mrr value: 34.60238095238095 - task: type: Reranking dataset: type: C-MTEB/T2Reranking name: MTEB T2Reranking config: default split: dev revision: None metrics: - type: map value: 67.27728847727172 - type: mrr value: 77.1315192743764 pipeline_tag: feature-extraction --- **We have updated the [new reranker](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_reranker), supporting larger lengths, more languages, and achieving better performance.** <h1 align="center">FlagEmbedding</h1> <h4 align="center"> <p> <a href=#model-list>Model List</a> | <a href=#frequently-asked-questions>FAQ</a> | <a href=#usage>Usage</a> | <a href="#evaluation">Evaluation</a> | <a href="#train">Train</a> | <a href="#citation">Citation</a> | <a href="#license">License</a> <p> </h4> **More details please refer to our Github: [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding).** [English](README.md) | [中文](https://github.com/FlagOpen/FlagEmbedding/blob/master/README_zh.md) FlagEmbedding focuses on retrieval-augmented LLMs, consisting of the following projects currently: - **Long-Context LLM**: [Activation Beacon](https://github.com/FlagOpen/FlagEmbedding/tree/master/Long_LLM/activation_beacon) - **Fine-tuning of LM** : [LM-Cocktail](https://github.com/FlagOpen/FlagEmbedding/tree/master/LM_Cocktail) - **Embedding Model**: [Visualized-BGE](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/visual), [BGE-M3](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3), [LLM Embedder](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder), [BGE Embedding](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/baai_general_embedding) - **Reranker Model**: [llm rerankers](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_reranker), [BGE Reranker](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker) - **Benchmark**: [C-MTEB](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB) ## News - 3/18/2024: Release new [rerankers](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_reranker), built upon powerful M3 and LLM (GEMMA and MiniCPM, not so large actually) backbones, supporitng multi-lingual processing and larger inputs, massive improvements of ranking performances on BEIR, C-MTEB/Retrieval, MIRACL, LlamaIndex Evaluation. - 3/18/2024: Release [Visualized-BGE](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/visual), equipping BGE with visual capabilities. Visualized-BGE can be utilized to generate embeddings for hybrid image-text data. - 1/30/2024: Release **BGE-M3**, a new member to BGE model series! M3 stands for **M**ulti-linguality (100+ languages), **M**ulti-granularities (input length up to 8192), **M**ulti-Functionality (unification of dense, lexical, multi-vec/colbert retrieval). It is the first embedding model which supports all three retrieval methods, achieving new SOTA on multi-lingual (MIRACL) and cross-lingual (MKQA) benchmarks. [Technical Report](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/BGE_M3/BGE_M3.pdf) and [Code](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3). :fire: - 1/9/2024: Release [Activation-Beacon](https://github.com/FlagOpen/FlagEmbedding/tree/master/Long_LLM/activation_beacon), an effective, efficient, compatible, and low-cost (training) method to extend the context length of LLM. [Technical Report](https://arxiv.org/abs/2401.03462) :fire: - 12/24/2023: Release **LLaRA**, a LLaMA-7B based dense retriever, leading to state-of-the-art performances on MS MARCO and BEIR. Model and code will be open-sourced. Please stay tuned. [Technical Report](https://arxiv.org/abs/2312.15503) - 11/23/2023: Release [LM-Cocktail](https://github.com/FlagOpen/FlagEmbedding/tree/master/LM_Cocktail), a method to maintain general capabilities during fine-tuning by merging multiple language models. [Technical Report](https://arxiv.org/abs/2311.13534) :fire: - 10/12/2023: Release [LLM-Embedder](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder), a unified embedding model to support diverse retrieval augmentation needs for LLMs. [Technical Report](https://arxiv.org/pdf/2310.07554.pdf) - 09/15/2023: The [technical report](https://arxiv.org/pdf/2309.07597.pdf) of BGE has been released - 09/15/2023: The [massive training data](https://data.baai.ac.cn/details/BAAI-MTP) of BGE has been released - 09/12/2023: New models: - **New reranker model**: release cross-encoder models `BAAI/bge-reranker-base` and `BAAI/bge-reranker-large`, which are more powerful than embedding model. We recommend to use/fine-tune them to re-rank top-k documents returned by embedding models. - **update embedding model**: release `bge-*-v1.5` embedding model to alleviate the issue of the similarity distribution, and enhance its retrieval ability without instruction. <details> <summary>More</summary> <!-- ### More --> - 09/07/2023: Update [fine-tune code](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md): Add script to mine hard negatives and support adding instruction during fine-tuning. - 08/09/2023: BGE Models are integrated into **Langchain**, you can use it like [this](#using-langchain); C-MTEB **leaderboard** is [available](https://huggingface.co/spaces/mteb/leaderboard). - 08/05/2023: Release base-scale and small-scale models, **best performance among the models of the same size 🤗** - 08/02/2023: Release `bge-large-*`(short for BAAI General Embedding) Models, **rank 1st on MTEB and C-MTEB benchmark!** :tada: :tada: - 08/01/2023: We release the [Chinese Massive Text Embedding Benchmark](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB) (**C-MTEB**), consisting of 31 test dataset. </details> ## Model List `bge` is short for `BAAI general embedding`. | Model | Language | | Description | query instruction for retrieval [1] | |:-------------------------------|:--------:| :--------:| :--------:|:--------:| | [BAAI/bge-m3](https://huggingface.co/BAAI/bge-m3) | Multilingual | [Inference](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3#usage) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3) | Multi-Functionality(dense retrieval, sparse retrieval, multi-vector(colbert)), Multi-Linguality, and Multi-Granularity(8192 tokens) | | | [BAAI/llm-embedder](https://huggingface.co/BAAI/llm-embedder) | English | [Inference](./FlagEmbedding/llm_embedder/README.md) [Fine-tune](./FlagEmbedding/llm_embedder/README.md) | a unified embedding model to support diverse retrieval augmentation needs for LLMs | See [README](./FlagEmbedding/llm_embedder/README.md) | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh-v1.5](https://huggingface.co/BAAI/bge-large-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-large-en](https://huggingface.co/BAAI/bge-large-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [MTEB](https://huggingface.co/spaces/mteb/leaderboard) leaderboard | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en](https://huggingface.co/BAAI/bge-base-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-en` | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en](https://huggingface.co/BAAI/bge-small-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) |a small-scale model but with competitive performance | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [C-MTEB](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB) benchmark | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-zh` | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a small-scale model but with competitive performance | `为这个句子生成表示以用于检索相关文章：` | [1\]: If you need to search the relevant passages to a query, we suggest to add the instruction to the query; in other cases, no instruction is needed, just use the original query directly. In all cases, **no instruction** needs to be added to passages. [2\]: Different from embedding model, reranker uses question and document as input and directly output similarity instead of embedding. To balance the accuracy and time cost, cross-encoder is widely used to re-rank top-k documents retrieved by other simple models. For examples, use bge embedding model to retrieve top 100 relevant documents, and then use bge reranker to re-rank the top 100 document to get the final top-3 results. All models have been uploaded to Huggingface Hub, and you can see them at https://huggingface.co/BAAI. If you cannot open the Huggingface Hub, you also can download the models at https://model.baai.ac.cn/models . ## Frequently asked questions <details> <summary>1. How to fine-tune bge embedding model?</summary> <!-- ### How to fine-tune bge embedding model? --> Following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) to prepare data and fine-tune your model. Some suggestions: - Mine hard negatives following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune#hard-negatives), which can improve the retrieval performance. - If you pre-train bge on your data, the pre-trained model cannot be directly used to calculate similarity, and it must be fine-tuned with contrastive learning before computing similarity. - If the accuracy of the fine-tuned model is still not high, it is recommended to use/fine-tune the cross-encoder model (bge-reranker) to re-rank top-k results. Hard negatives also are needed to fine-tune reranker. Refer to this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) for the fine-tuning for reranker </details> <details> <summary>2. The similarity score between two dissimilar sentences is higher than 0.5</summary> <!-- ### The similarity score between two dissimilar sentences is higher than 0.5 --> **Suggest to use bge v1.5, which alleviates the issue of the similarity distribution.** Since we finetune the models by contrastive learning with a temperature of 0.01, the similarity distribution of the current BGE model is about in the interval \[0.6, 1\]. So a similarity score greater than 0.5 does not indicate that the two sentences are similar. For downstream tasks, such as passage retrieval or semantic similarity, **what matters is the relative order of the scores, not the absolute value.** If you need to filter similar sentences based on a similarity threshold, please select an appropriate similarity threshold based on the similarity distribution on your data (such as 0.8, 0.85, or even 0.9). </details> <details> <summary>3. When does the query instruction need to be used</summary> <!-- ### When does the query instruction need to be used --> For the `bge-*-v1.5`, we improve its retrieval ability when not using instruction. No instruction only has a slight degradation in retrieval performance compared with using instruction. So you can generate embedding without instruction in all cases for convenience. For a retrieval task that uses short queries to find long related documents, it is recommended to add instructions for these short queries. **The best method to decide whether to add instructions for queries is choosing the setting that achieves better performance on your task.** In all cases, the documents/passages do not need to add the instruction. </details> ## Usage ### Usage for Embedding Model Here are some examples for using `bge` models with [FlagEmbedding](#using-flagembedding), [Sentence-Transformers](#using-sentence-transformers), [Langchain](#using-langchain), or [Huggingface Transformers](#using-huggingface-transformers). #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` If it doesn't work for you, you can see [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md) for more methods to install FlagEmbedding. ```python from FlagEmbedding import FlagModel sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = FlagModel('BAAI/bge-large-zh-v1.5', query_instruction_for_retrieval="为这个句子生成表示以用于检索相关文章：", use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation embeddings_1 = model.encode(sentences_1) embeddings_2 = model.encode(sentences_2) similarity = embeddings_1 @ embeddings_2.T print(similarity) # for s2p(short query to long passage) retrieval task, suggest to use encode_queries() which will automatically add the instruction to each query # corpus in retrieval task can still use encode() or encode_corpus(), since they don't need instruction queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] q_embeddings = model.encode_queries(queries) p_embeddings = model.encode(passages) scores = q_embeddings @ p_embeddings.T ``` For the value of the argument `query_instruction_for_retrieval`, see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list). By default, FlagModel will use all available GPUs when encoding. Please set `os.environ["CUDA_VISIBLE_DEVICES"]` to select specific GPUs. You also can set `os.environ["CUDA_VISIBLE_DEVICES"]=""` to make all GPUs unavailable. #### Using Sentence-Transformers You can also use the `bge` models with [sentence-transformers](https://www.SBERT.net): ``` pip install -U sentence-transformers ``` ```python from sentence_transformers import SentenceTransformer sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = SentenceTransformer('BAAI/bge-large-zh-v1.5') embeddings_1 = model.encode(sentences_1, normalize_embeddings=True) embeddings_2 = model.encode(sentences_2, normalize_embeddings=True) similarity = embeddings_1 @ embeddings_2.T print(similarity) ``` For s2p(short query to long passage) retrieval task, each short query should start with an instruction (instructions see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list)). But the instruction is not needed for passages. ```python from sentence_transformers import SentenceTransformer queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] instruction = "为这个句子生成表示以用于检索相关文章：" model = SentenceTransformer('BAAI/bge-large-zh-v1.5') q_embeddings = model.encode([instruction+q for q in queries], normalize_embeddings=True) p_embeddings = model.encode(passages, normalize_embeddings=True) scores = q_embeddings @ p_embeddings.T ``` #### Using Langchain You can use `bge` in langchain like this: ```python from langchain.embeddings import HuggingFaceBgeEmbeddings model_name = "BAAI/bge-large-en-v1.5" model_kwargs = {'device': 'cuda'} encode_kwargs = {'normalize_embeddings': True} # set True to compute cosine similarity model = HuggingFaceBgeEmbeddings( model_name=model_name, model_kwargs=model_kwargs, encode_kwargs=encode_kwargs, query_instruction="为这个句子生成表示以用于检索相关文章：" ) model.query_instruction = "为这个句子生成表示以用于检索相关文章：" ``` #### Using HuggingFace Transformers With the transformers package, you can use the model like this: First, you pass your input through the transformer model, then you select the last hidden state of the first token (i.e., [CLS]) as the sentence embedding. ```python from transformers import AutoTokenizer, AutoModel import torch # Sentences we want sentence embeddings for sentences = ["样例数据-1", "样例数据-2"] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-large-zh-v1.5') model = AutoModel.from_pretrained('BAAI/bge-large-zh-v1.5') model.eval() # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # for s2p(short query to long passage) retrieval task, add an instruction to query (not add instruction for passages) # encoded_input = tokenizer([instruction + q for q in queries], padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, cls pooling. sentence_embeddings = model_output[0][:, 0] # normalize embeddings sentence_embeddings = torch.nn.functional.normalize(sentence_embeddings, p=2, dim=1) print("Sentence embeddings:", sentence_embeddings) ``` ### Usage for Reranker Different from embedding model, reranker uses question and document as input and directly output similarity instead of embedding. You can get a relevance score by inputting query and passage to the reranker. The reranker is optimized based cross-entropy loss, so the relevance score is not bounded to a specific range. #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` Get relevance scores (higher scores indicate more relevance): ```python from FlagEmbedding import FlagReranker reranker = FlagReranker('BAAI/bge-reranker-large', use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation score = reranker.compute_score(['query', 'passage']) print(score) scores = reranker.compute_score([['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']]) print(scores) ``` #### Using Huggingface transformers ```python import torch from transformers import AutoModelForSequenceClassification, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-reranker-large') model = AutoModelForSequenceClassification.from_pretrained('BAAI/bge-reranker-large') model.eval() pairs = [['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']] with torch.no_grad(): inputs = tokenizer(pairs, padding=True, truncation=True, return_tensors='pt', max_length=512) scores = model(**inputs, return_dict=True).logits.view(-1, ).float() print(scores) ``` #### Usage reranker with the ONNX files ```python from optimum.onnxruntime import ORTModelForSequenceClassification # type: ignore import torch from transformers import AutoModelForSequenceClassification, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-reranker-large') model = AutoModelForSequenceClassification.from_pretrained('BAAI/bge-reranker-base') model_ort = ORTModelForSequenceClassification.from_pretrained('BAAI/bge-reranker-base', file_name="onnx/model.onnx") # Sentences we want sentence embeddings for pairs = [['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']] # Tokenize sentences encoded_input = tokenizer(pairs, padding=True, truncation=True, return_tensors='pt') scores_ort = model_ort(**encoded_input, return_dict=True).logits.view(-1, ).float() # Compute token embeddings with torch.inference_mode(): scores = model_ort(**encoded_input, return_dict=True).logits.view(-1, ).float() # scores and scores_ort are identical ``` #### Usage reranker with infinity Its also possible to deploy the onnx/torch files with the [infinity_emb](https://github.com/michaelfeil/infinity) pip package. ```python import asyncio from infinity_emb import AsyncEmbeddingEngine, EngineArgs query='what is a panda?' docs = ['The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear', "Paris is in France."] engine = AsyncEmbeddingEngine.from_args( EngineArgs(model_name_or_path = "BAAI/bge-reranker-base", device="cpu", engine="torch" # or engine="optimum" for onnx )) async def main(): async with engine: ranking, usage = await engine.rerank(query=query, docs=docs) print(list(zip(ranking, docs))) asyncio.run(main()) ``` ## Evaluation `baai-general-embedding` models achieve **state-of-the-art performance on both MTEB and C-MTEB leaderboard!** For more details and evaluation tools see our [scripts](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md). - **MTEB**: | Model Name | Dimension | Sequence Length | Average (56) | Retrieval (15) |Clustering (11) | Pair Classification (3) | Reranking (4) | STS (10) | Summarization (1) | Classification (12) | |:----:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:| | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | 1024 | 512 | **64.23** | **54.29** | 46.08 | 87.12 | 60.03 | 83.11 | 31.61 | 75.97 | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | 768 | 512 | 63.55 | 53.25 | 45.77 | 86.55 | 58.86 | 82.4 | 31.07 | 75.53 | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | 384 | 512 | 62.17 |51.68 | 43.82 | 84.92 | 58.36 | 81.59 | 30.12 | 74.14 | | [bge-large-en](https://huggingface.co/BAAI/bge-large-en) | 1024 | 512 | 63.98 | 53.9 | 46.98 | 85.8 | 59.48 | 81.56 | 32.06 | 76.21 | | [bge-base-en](https://huggingface.co/BAAI/bge-base-en) | 768 | 512 | 63.36 | 53.0 | 46.32 | 85.86 | 58.7 | 81.84 | 29.27 | 75.27 | | [gte-large](https://huggingface.co/thenlper/gte-large) | 1024 | 512 | 63.13 | 52.22 | 46.84 | 85.00 | 59.13 | 83.35 | 31.66 | 73.33 | | [gte-base](https://huggingface.co/thenlper/gte-base) | 768 | 512 | 62.39 | 51.14 | 46.2 | 84.57 | 58.61 | 82.3 | 31.17 | 73.01 | | [e5-large-v2](https://huggingface.co/intfloat/e5-large-v2) | 1024| 512 | 62.25 | 50.56 | 44.49 | 86.03 | 56.61 | 82.05 | 30.19 | 75.24 | | [bge-small-en](https://huggingface.co/BAAI/bge-small-en) | 384 | 512 | 62.11 | 51.82 | 44.31 | 83.78 | 57.97 | 80.72 | 30.53 | 74.37 | | [instructor-xl](https://huggingface.co/hkunlp/instructor-xl) | 768 | 512 | 61.79 | 49.26 | 44.74 | 86.62 | 57.29 | 83.06 | 32.32 | 61.79 | | [e5-base-v2](https://huggingface.co/intfloat/e5-base-v2) | 768 | 512 | 61.5 | 50.29 | 43.80 | 85.73 | 55.91 | 81.05 | 30.28 | 73.84 | | [gte-small](https://huggingface.co/thenlper/gte-small) | 384 | 512 | 61.36 | 49.46 | 44.89 | 83.54 | 57.7 | 82.07 | 30.42 | 72.31 | | [text-embedding-ada-002](https://platform.openai.com/docs/guides/embeddings) | 1536 | 8192 | 60.99 | 49.25 | 45.9 | 84.89 | 56.32 | 80.97 | 30.8 | 70.93 | | [e5-small-v2](https://huggingface.co/intfloat/e5-base-v2) | 384 | 512 | 59.93 | 49.04 | 39.92 | 84.67 | 54.32 | 80.39 | 31.16 | 72.94 | | [sentence-t5-xxl](https://huggingface.co/sentence-transformers/sentence-t5-xxl) | 768 | 512 | 59.51 | 42.24 | 43.72 | 85.06 | 56.42 | 82.63 | 30.08 | 73.42 | | [all-mpnet-base-v2](https://huggingface.co/sentence-transformers/all-mpnet-base-v2) | 768 | 514 | 57.78 | 43.81 | 43.69 | 83.04 | 59.36 | 80.28 | 27.49 | 65.07 | | [sgpt-bloom-7b1-msmarco](https://huggingface.co/bigscience/sgpt-bloom-7b1-msmarco) | 4096 | 2048 | 57.59 | 48.22 | 38.93 | 81.9 | 55.65 | 77.74 | 33.6 | 66.19 | - **C-MTEB**: We create the benchmark C-MTEB for Chinese text embedding which consists of 31 datasets from 6 tasks. Please refer to [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md) for a detailed introduction. | Model | Embedding dimension | Avg | Retrieval | STS | PairClassification | Classification | Reranking | Clustering | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | [**BAAI/bge-large-zh-v1.5**](https://huggingface.co/BAAI/bge-large-zh-v1.5) | 1024 | **64.53** | 70.46 | 56.25 | 81.6 | 69.13 | 65.84 | 48.99 | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | 768 | 63.13 | 69.49 | 53.72 | 79.75 | 68.07 | 65.39 | 47.53 | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | 512 | 57.82 | 61.77 | 49.11 | 70.41 | 63.96 | 60.92 | 44.18 | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | 1024 | 64.20 | 71.53 | 54.98 | 78.94 | 68.32 | 65.11 | 48.39 | | [bge-large-zh-noinstruct](https://huggingface.co/BAAI/bge-large-zh-noinstruct) | 1024 | 63.53 | 70.55 | 53 | 76.77 | 68.58 | 64.91 | 50.01 | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | 768 | 62.96 | 69.53 | 54.12 | 77.5 | 67.07 | 64.91 | 47.63 | | [multilingual-e5-large](https://huggingface.co/intfloat/multilingual-e5-large) | 1024 | 58.79 | 63.66 | 48.44 | 69.89 | 67.34 | 56.00 | 48.23 | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | 512 | 58.27 | 63.07 | 49.45 | 70.35 | 63.64 | 61.48 | 45.09 | | [m3e-base](https://huggingface.co/moka-ai/m3e-base) | 768 | 57.10 | 56.91 | 50.47 | 63.99 | 67.52 | 59.34 | 47.68 | | [m3e-large](https://huggingface.co/moka-ai/m3e-large) | 1024 | 57.05 | 54.75 | 50.42 | 64.3 | 68.2 | 59.66 | 48.88 | | [multilingual-e5-base](https://huggingface.co/intfloat/multilingual-e5-base) | 768 | 55.48 | 61.63 | 46.49 | 67.07 | 65.35 | 54.35 | 40.68 | | [multilingual-e5-small](https://huggingface.co/intfloat/multilingual-e5-small) | 384 | 55.38 | 59.95 | 45.27 | 66.45 | 65.85 | 53.86 | 45.26 | | [text-embedding-ada-002(OpenAI)](https://platform.openai.com/docs/guides/embeddings/what-are-embeddings) | 1536 | 53.02 | 52.0 | 43.35 | 69.56 | 64.31 | 54.28 | 45.68 | | [luotuo](https://huggingface.co/silk-road/luotuo-bert-medium) | 1024 | 49.37 | 44.4 | 42.78 | 66.62 | 61 | 49.25 | 44.39 | | [text2vec-base](https://huggingface.co/shibing624/text2vec-base-chinese) | 768 | 47.63 | 38.79 | 43.41 | 67.41 | 62.19 | 49.45 | 37.66 | | [text2vec-large](https://huggingface.co/GanymedeNil/text2vec-large-chinese) | 1024 | 47.36 | 41.94 | 44.97 | 70.86 | 60.66 | 49.16 | 30.02 | - **Reranking**: See [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/) for evaluation script. | Model | T2Reranking | T2RerankingZh2En\* | T2RerankingEn2Zh\* | MMarcoReranking | CMedQAv1 | CMedQAv2 | Avg | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | text2vec-base-multilingual | 64.66 | 62.94 | 62.51 | 14.37 | 48.46 | 48.6 | 50.26 | | multilingual-e5-small | 65.62 | 60.94 | 56.41 | 29.91 | 67.26 | 66.54 | 57.78 | | multilingual-e5-large | 64.55 | 61.61 | 54.28 | 28.6 | 67.42 | 67.92 | 57.4 | | multilingual-e5-base | 64.21 | 62.13 | 54.68 | 29.5 | 66.23 | 66.98 | 57.29 | | m3e-base | 66.03 | 62.74 | 56.07 | 17.51 | 77.05 | 76.76 | 59.36 | | m3e-large | 66.13 | 62.72 | 56.1 | 16.46 | 77.76 | 78.27 | 59.57 | | bge-base-zh-v1.5 | 66.49 | 63.25 | 57.02 | 29.74 | 80.47 | 84.88 | 63.64 | | bge-large-zh-v1.5 | 65.74 | 63.39 | 57.03 | 28.74 | 83.45 | 85.44 | 63.97 | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | 67.28 | 63.95 | 60.45 | 35.46 | 81.26 | 84.1 | 65.42 | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | 67.6 | 64.03 | 61.44 | 37.16 | 82.15 | 84.18 | 66.09 | \* : T2RerankingZh2En and T2RerankingEn2Zh are cross-language retrieval tasks ## Train ### BAAI Embedding We pre-train the models using [retromae](https://github.com/staoxiao/RetroMAE) and train them on large-scale pairs data using contrastive learning. **You can fine-tune the embedding model on your data following our [examples](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune).** We also provide a [pre-train example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/pretrain). Note that the goal of pre-training is to reconstruct the text, and the pre-trained model cannot be used for similarity calculation directly, it needs to be fine-tuned. More training details for bge see [baai_general_embedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md). ### BGE Reranker Cross-encoder will perform full-attention over the input pair, which is more accurate than embedding model (i.e., bi-encoder) but more time-consuming than embedding model. Therefore, it can be used to re-rank the top-k documents returned by embedding model. We train the cross-encoder on a multilingual pair data, The data format is the same as embedding model, so you can fine-tune it easily following our [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker). More details please refer to [./FlagEmbedding/reranker/README.md](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker) ## Citation If you find this repository useful, please consider giving a star :star: and citation ``` @misc{bge_embedding, title={C-Pack: Packaged Resources To Advance General Chinese Embedding}, author={Shitao Xiao and Zheng Liu and Peitian Zhang and Niklas Muennighoff}, year={2023}, eprint={2309.07597}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` ## License FlagEmbedding is licensed under the [MIT License](https://github.com/FlagOpen/FlagEmbedding/blob/master/LICENSE). The released models can be used for commercial purposes free of charge.

nguyenvulebinh/wav2vec2-base-vi

nguyenvulebinh

transformers

--- language: vi datasets: - youtube-vi-13k-hours tags: - speech license: cc-by-nc-4.0 --- # Vietnamese Self-Supervised Learning Wav2Vec2 model ## Model We use wav2vec2 architecture for doing Self-Supervised learning <img src="https://raw.githubusercontent.com/patrickvonplaten/scientific_images/master/wav2vec2.png" width=75% height=75%> ## Data Our self-supervised model is pre-trained on a massive audio set of 13k hours of Vietnamese youtube audio, which includes: - Clean audio - Noise audio - Conversation - Multi-gender and dialects ## Download We have already upload our pre-trained model to the Huggingface. The base model trained 35 epochs and the large model trained 20 epochs in about 30 days using TPU V3-8. - [Based version](https://huggingface.co/nguyenvulebinh/wav2vec2-base-vi) ~ 95M params - [Large version](https://huggingface.co/nguyenvulebinh/wav2vec2-large-vi) ~ 317M params ## Usage ```python from transformers import Wav2Vec2ForPreTraining, Wav2Vec2Processor model_name = 'nguyenvulebinh/wav2vec2-base-vi' # model_name = 'nguyenvulebinh/wav2vec2-large-vi' model = Wav2Vec2ForPreTraining.from_pretrained(model_name) processor = Wav2Vec2Processor.from_pretrained(model_name) ``` Since our model has the same architecture as the English wav2vec2 version, you can use [this notebook](https://colab.research.google.com/drive/1FjTsqbYKphl9kL-eILgUc-bl4zVThL8F?usp=sharing) for more information on how to fine-tune the model. ## Finetuned version ### VLSP 2020 ASR dataset Benchmark WER result on VLSP T1 testset: | | [base model](https://huggingface.co/nguyenvulebinh/wav2vec2-base-vi-vlsp2020) | [large model](https://huggingface.co/nguyenvulebinh/wav2vec2-large-vi-vlsp2020) | |---|---|---| |without LM| 8.66 | 6.90 | |with 5-grams LM| 6.53 | 5.32 | Usage ```python #pytorch #!pip install transformers==4.20.0 #!pip install https://github.com/kpu/kenlm/archive/master.zip #!pip install pyctcdecode==0.4.0 from transformers.file_utils import cached_path, hf_bucket_url from importlib.machinery import SourceFileLoader from transformers import Wav2Vec2ProcessorWithLM from IPython.lib.display import Audio import torchaudio import torch # Load model & processor model_name = "nguyenvulebinh/wav2vec2-base-vi-vlsp2020" # model_name = "nguyenvulebinh/wav2vec2-large-vi-vlsp2020" model = SourceFileLoader("model", cached_path(hf_bucket_url(model_name,filename="model_handling.py"))).load_module().Wav2Vec2ForCTC.from_pretrained(model_name) processor = Wav2Vec2ProcessorWithLM.from_pretrained(model_name) # Load an example audio (16k) audio, sample_rate = torchaudio.load(cached_path(hf_bucket_url(model_name, filename="t2_0000006682.wav"))) input_data = processor.feature_extractor(audio[0], sampling_rate=16000, return_tensors='pt') # Infer output = model(**input_data) # Output transcript without LM print(processor.tokenizer.decode(output.logits.argmax(dim=-1)[0].detach().cpu().numpy())) # Output transcript with LM print(processor.decode(output.logits.cpu().detach().numpy()[0], beam_width=100).text) ``` ## Acknowledgment - We would like to thank the Google TPU Research Cloud (TRC) program and Soonson Kwon (Google ML Ecosystem programs Lead) for their support. - Special thanks to my colleagues at [VietAI](https://vietai.org/) and [VAIS](https://vais.vn/) for their advice. ## Contact nguyenvulebinh@gmail.com / binh@vietai.org [](https://twitter.com/intent/follow?screen_name=nguyenvulebinh)

flaviagiammarino/pubmed-clip-vit-base-patch32

flaviagiammarino

transformers

zero-shot-image-classification

--- license: mit language: - en tags: - medical - vision widget: - src: "https://huggingface.co/flaviagiammarino/pubmed-clip-vit-base-patch32/resolve/main/scripts/input.jpeg" candidate_labels: "Chest X-Ray, Brain MRI, Abdomen CT Scan" example_title: "Abdomen CT Scan" --- # Model Card for PubMedCLIP PubMedCLIP is a fine-tuned version of [CLIP](https://huggingface.co/docs/transformers/model_doc/clip) for the medical domain. ## Model Description PubMedCLIP was trained on the [Radiology Objects in COntext (ROCO)](https://github.com/razorx89/roco-dataset) dataset, a large-scale multimodal medical imaging dataset. The ROCO dataset includes diverse imaging modalities (such as X-Ray, MRI, ultrasound, fluoroscopy, etc.) from various human body regions (such as head, spine, chest, abdomen, etc.) captured from open-access [PubMed](https://pubmed.ncbi.nlm.nih.gov/) articles.<br> PubMedCLIP was trained for 50 epochs with a batch size of 64 using the Adam optimizer with a learning rate of 10−5. The authors have released three different pre-trained models at this [link](https://1drv.ms/u/s!ApXgPqe9kykTgwD4Np3-f7ODAot8?e=zLVlJ2) which use ResNet-50, ResNet-50x4 and ViT32 as image encoders. This repository includes only the ViT32 variant of the PubMedCLIP model.<br> - **Repository:** [PubMedCLIP Official GitHub Repository](https://github.com/sarahESL/PubMedCLIP) - **Paper:** [Does CLIP Benefit Visual Question Answering in the Medical Domain as Much as it Does in the General Domain?](https://arxiv.org/abs/2112.13906) ## Usage ```python import requests from PIL import Image import matplotlib.pyplot as plt from transformers import CLIPProcessor, CLIPModel model = CLIPModel.from_pretrained("flaviagiammarino/pubmed-clip-vit-base-patch32") processor = CLIPProcessor.from_pretrained("flaviagiammarino/pubmed-clip-vit-base-patch32") url = "https://huggingface.co/flaviagiammarino/pubmed-clip-vit-base-patch32/resolve/main/scripts/input.jpeg" image = Image.open(requests.get(url, stream=True).raw) text = ["Chest X-Ray", "Brain MRI", "Abdominal CT Scan"] inputs = processor(text=text, images=image, return_tensors="pt", padding=True) probs = model(**inputs).logits_per_image.softmax(dim=1).squeeze() plt.subplots() plt.imshow(image) plt.title("".join([x[0] + ": " + x[1] + "\n" for x in zip(text, [format(prob, ".4%") for prob in probs])])) plt.axis("off") plt.tight_layout() plt.show() ```  ## Additional Information ### Licensing Information The authors have released the model code and pre-trained checkpoints under the [MIT License](https://github.com/sarahESL/PubMedCLIP/blob/main/LICENSE). ### Citation Information ``` @article{eslami2021does, title={Does clip benefit visual question answering in the medical domain as much as it does in the general domain?}, author={Eslami, Sedigheh and de Melo, Gerard and Meinel, Christoph}, journal={arXiv preprint arXiv:2112.13906}, year={2021} } ```

briaai/RMBG-1.4

briaai

transformers

image-segmentation

--- license: other license_name: bria-rmbg-1.4 license_link: https://bria.ai/bria-huggingface-model-license-agreement/ pipeline_tag: image-segmentation tags: - remove background - background - background-removal - Pytorch - vision - legal liability - transformers extra_gated_description: RMBG v1.4 is available as a source-available model for non-commercial use extra_gated_heading: "Fill in this form to get instant access" extra_gated_fields: Name: text Company/Org name: text Org Type (Early/Growth Startup, Enterprise, Academy): text Role: text Country: text Email: text By submitting this form, I agree to BRIA’s Privacy policy and Terms & conditions, see links below: checkbox --- # BRIA Background Removal v1.4 Model Card RMBG v1.4 is our state-of-the-art background removal model, designed to effectively separate foreground from background in a range of categories and image types. This model has been trained on a carefully selected dataset, which includes: general stock images, e-commerce, gaming, and advertising content, making it suitable for commercial use cases powering enterprise content creation at scale. The accuracy, efficiency, and versatility currently rival leading source-available models. It is ideal where content safety, legally licensed datasets, and bias mitigation are paramount. Developed by BRIA AI, RMBG v1.4 is available as a source-available model for non-commercial use. [CLICK HERE FOR A DEMO](https://huggingface.co/spaces/briaai/BRIA-RMBG-1.4)  ### Model Description - **Developed by:** [BRIA AI](https://bria.ai/) - **Model type:** Background Removal - **License:** [bria-rmbg-1.4](https://bria.ai/bria-huggingface-model-license-agreement/) - The model is released under a Creative Commons license for non-commercial use. - Commercial use is subject to a commercial agreement with BRIA. [Contact Us](https://bria.ai/contact-us) for more information. - **Model Description:** BRIA RMBG 1.4 is a saliency segmentation model trained exclusively on a professional-grade dataset. - **BRIA:** Resources for more information: [BRIA AI](https://bria.ai/) ## Training data Bria-RMBG model was trained with over 12,000 high-quality, high-resolution, manually labeled (pixel-wise accuracy), fully licensed images. Our benchmark included balanced gender, balanced ethnicity, and people with different types of disabilities. For clarity, we provide our data distribution according to different categories, demonstrating our model’s versatility. ### Distribution of images: | Category | Distribution | | -----------------------------------| -----------------------------------:| | Objects only | 45.11% | | People with objects/animals | 25.24% | | People only | 17.35% | | people/objects/animals with text | 8.52% | | Text only | 2.52% | | Animals only | 1.89% | | Category | Distribution | | -----------------------------------| -----------------------------------------:| | Photorealistic | 87.70% | | Non-Photorealistic | 12.30% | | Category | Distribution | | -----------------------------------| -----------------------------------:| | Non Solid Background | 52.05% | | Solid Background | 47.95% | Category | Distribution | | -----------------------------------| -----------------------------------:| | Single main foreground object | 51.42% | | Multiple objects in the foreground | 48.58% | ## Qualitative Evaluation  ## Architecture RMBG v1.4 is developed on the [IS-Net](https://github.com/xuebinqin/DIS) enhanced with our unique training scheme and proprietary dataset. These modifications significantly improve the model’s accuracy and effectiveness in diverse image-processing scenarios. ## Installation ```bash pip install -qr https://huggingface.co/briaai/RMBG-1.4/resolve/main/requirements.txt ``` ## Usage Either load the pipeline ```python from transformers import pipeline image_path = "https://farm5.staticflickr.com/4007/4322154488_997e69e4cf_z.jpg" pipe = pipeline("image-segmentation", model="briaai/RMBG-1.4", trust_remote_code=True) pillow_mask = pipe(image_path, return_mask = True) # outputs a pillow mask pillow_image = pipe(image_path) # applies mask on input and returns a pillow image ``` Or load the model ```python from transformers import AutoModelForImageSegmentation from torchvision.transforms.functional import normalize model = AutoModelForImageSegmentation.from_pretrained("briaai/RMBG-1.4",trust_remote_code=True) def preprocess_image(im: np.ndarray, model_input_size: list) -> torch.Tensor: if len(im.shape) < 3: im = im[:, :, np.newaxis] # orig_im_size=im.shape[0:2] im_tensor = torch.tensor(im, dtype=torch.float32).permute(2,0,1) im_tensor = F.interpolate(torch.unsqueeze(im_tensor,0), size=model_input_size, mode='bilinear') image = torch.divide(im_tensor,255.0) image = normalize(image,[0.5,0.5,0.5],[1.0,1.0,1.0]) return image def postprocess_image(result: torch.Tensor, im_size: list)-> np.ndarray: result = torch.squeeze(F.interpolate(result, size=im_size, mode='bilinear') ,0) ma = torch.max(result) mi = torch.min(result) result = (result-mi)/(ma-mi) im_array = (result*255).permute(1,2,0).cpu().data.numpy().astype(np.uint8) im_array = np.squeeze(im_array) return im_array device = torch.device("cuda:0" if torch.cuda.is_available() else "cpu") model.to(device) # prepare input image_path = "https://farm5.staticflickr.com/4007/4322154488_997e69e4cf_z.jpg" orig_im = io.imread(image_path) orig_im_size = orig_im.shape[0:2] image = preprocess_image(orig_im, model_input_size).to(device) # inference result=model(image) # post process result_image = postprocess_image(result[0][0], orig_im_size) # save result pil_im = Image.fromarray(result_image) no_bg_image = Image.new("RGBA", pil_im.size, (0,0,0,0)) orig_image = Image.open(image_path) no_bg_image.paste(orig_image, mask=pil_im) ```

black-forest-labs/FLUX.1-schnell

black-forest-labs

diffusers

text-to-image

--- language: - en license: apache-2.0 tags: - text-to-image - image-generation - flux --- ![FLUX.1 [schnell] Grid](./schnell_grid.jpeg) `FLUX.1 [schnell]` is a 12 billion parameter rectified flow transformer capable of generating images from text descriptions. For more information, please read our [blog post](https://blackforestlabs.ai/announcing-black-forest-labs/). # Key Features 1. Cutting-edge output quality and competitive prompt following, matching the performance of closed source alternatives. 2. Trained using latent adversarial diffusion distillation, `FLUX.1 [schnell]` can generate high-quality images in only 1 to 4 steps. 3. Released under the `apache-2.0` licence, the model can be used for personal, scientific, and commercial purposes. # Usage We provide a reference implementation of `FLUX.1 [schnell]`, as well as sampling code, in a dedicated [github repository](https://github.com/black-forest-labs/flux). Developers and creatives looking to build on top of `FLUX.1 [schnell]` are encouraged to use this as a starting point. ## API Endpoints The FLUX.1 models are also available via API from the following sources - [bfl.ml](https://docs.bfl.ml/) (currently `FLUX.1 [pro]`) - [replicate.com](https://replicate.com/collections/flux) - [fal.ai](https://fal.ai/models/fal-ai/flux/schnell) - [mystic.ai](https://www.mystic.ai/black-forest-labs/flux1-schnell) ## ComfyUI `FLUX.1 [schnell]` is also available in [Comfy UI](https://github.com/comfyanonymous/ComfyUI) for local inference with a node-based workflow. ## Diffusers To use `FLUX.1 [schnell]` with the 🧨 diffusers python library, first install or upgrade diffusers ```shell pip install -U diffusers ``` Then you can use `FluxPipeline` to run the model ```python import torch from diffusers import FluxPipeline pipe = FluxPipeline.from_pretrained("black-forest-labs/FLUX.1-schnell", torch_dtype=torch.bfloat16) pipe.enable_model_cpu_offload() #save some VRAM by offloading the model to CPU. Remove this if you have enough GPU power prompt = "A cat holding a sign that says hello world" image = pipe( prompt, guidance_scale=0.0, num_inference_steps=4, max_sequence_length=256, generator=torch.Generator("cpu").manual_seed(0) ).images[0] image.save("flux-schnell.png") ``` To learn more check out the [diffusers](https://huggingface.co/docs/diffusers/main/en/api/pipelines/flux) documentation --- # Limitations - This model is not intended or able to provide factual information. - As a statistical model this checkpoint might amplify existing societal biases. - The model may fail to generate output that matches the prompts. - Prompt following is heavily influenced by the prompting-style. # Out-of-Scope Use The model and its derivatives may not be used - In any way that violates any applicable national, federal, state, local or international law or regulation. - For the purpose of exploiting, harming or attempting to exploit or harm minors in any way; including but not limited to the solicitation, creation, acquisition, or dissemination of child exploitative content. - To generate or disseminate verifiably false information and/or content with the purpose of harming others. - To generate or disseminate personal identifiable information that can be used to harm an individual. - To harass, abuse, threaten, stalk, or bully individuals or groups of individuals. - To create non-consensual nudity or illegal pornographic content. - For fully automated decision making that adversely impacts an individual's legal rights or otherwise creates or modifies a binding, enforceable obligation. - Generating or facilitating large-scale disinformation campaigns.

flair/ner-english-fast

flair

flair

token-classification

--- tags: - flair - token-classification - sequence-tagger-model language: en datasets: - conll2003 widget: - text: "George Washington went to Washington" --- ## English NER in Flair (fast model) This is the fast 4-class NER model for English that ships with [Flair](https://github.com/flairNLP/flair/). F1-Score: **92,92** (corrected CoNLL-03) Predicts 4 tags: | **tag** | **meaning** | |---------------------------------|-----------| | PER | person name | | LOC | location name | | ORG | organization name | | MISC | other name | Based on [Flair embeddings](https://www.aclweb.org/anthology/C18-1139/) and LSTM-CRF. --- ### Demo: How to use in Flair Requires: **[Flair](https://github.com/flairNLP/flair/)** (`pip install flair`) ```python from flair.data import Sentence from flair.models import SequenceTagger # load tagger tagger = SequenceTagger.load("flair/ner-english-fast") # make example sentence sentence = Sentence("George Washington went to Washington") # predict NER tags tagger.predict(sentence) # print sentence print(sentence) # print predicted NER spans print('The following NER tags are found:') # iterate over entities and print for entity in sentence.get_spans('ner'): print(entity) ``` This yields the following output: ``` Span [1,2]: "George Washington" [− Labels: PER (0.9515)] Span [5]: "Washington" [− Labels: LOC (0.992)] ``` So, the entities "*George Washington*" (labeled as a **person**) and "*Washington*" (labeled as a **location**) are found in the sentence "*George Washington went to Washington*". --- ### Training: Script to train this model The following Flair script was used to train this model: ```python from flair.data import Corpus from flair.datasets import CONLL_03 from flair.embeddings import WordEmbeddings, StackedEmbeddings, FlairEmbeddings # 1. get the corpus corpus: Corpus = CONLL_03() # 2. what tag do we want to predict? tag_type = 'ner' # 3. make the tag dictionary from the corpus tag_dictionary = corpus.make_tag_dictionary(tag_type=tag_type) # 4. initialize each embedding we use embedding_types = [ # GloVe embeddings WordEmbeddings('glove'), # contextual string embeddings, forward FlairEmbeddings('news-forward-fast'), # contextual string embeddings, backward FlairEmbeddings('news-backward-fast'), ] # embedding stack consists of Flair and GloVe embeddings embeddings = StackedEmbeddings(embeddings=embedding_types) # 5. initialize sequence tagger from flair.models import SequenceTagger tagger = SequenceTagger(hidden_size=256, embeddings=embeddings, tag_dictionary=tag_dictionary, tag_type=tag_type) # 6. initialize trainer from flair.trainers import ModelTrainer trainer = ModelTrainer(tagger, corpus) # 7. run training trainer.train('resources/taggers/ner-english', train_with_dev=True, max_epochs=150) ``` --- ### Cite Please cite the following paper when using this model. ``` @inproceedings{akbik2018coling, title={Contextual String Embeddings for Sequence Labeling}, author={Akbik, Alan and Blythe, Duncan and Vollgraf, Roland}, booktitle = {{COLING} 2018, 27th International Conference on Computational Linguistics}, pages = {1638--1649}, year = {2018} } ``` --- ### Issues? The Flair issue tracker is available [here](https://github.com/flairNLP/flair/issues/).

Ashishkr/query_wellformedness_score

Ashishkr

transformers

text-classification

--- license: apache-2.0 inference: false datasets: google_wellformed_query --- ```DOI @misc {ashish_kumar_2024, author = { {Ashish Kumar} }, title = { query_wellformedness_score (Revision 55a424c) }, year = 2024, url = { https://huggingface.co/Ashishkr/query_wellformedness_score }, doi = { 10.57967/hf/1980 }, publisher = { Hugging Face } } ``` **Intended Use Cases** *Content Creation*: Validate the well-formedness of written content. *Educational Platforms*: Helps students check the grammaticality of their sentences. *Chatbots & Virtual Assistants*: To validate user queries or generate well-formed responses. **contact: kua613@g.harvard.edu** **Model name**: Query Wellformedness Scoring **Description** : Evaluate the well-formedness of sentences by checking grammatical correctness and completeness. Sensitive to case and penalizes sentences for incorrect grammar and case. **Features**: - *Wellformedness Score*: Provides a score indicating grammatical correctness and completeness. - *Case Sensitivity*: Recognizes and penalizes incorrect casing in sentences. - *Broad Applicability*: Can be used on a wide range of sentences. **Example**: 1. Dogs are mammals. 2. she loves to read books on history. 3. When the rain in Spain. 4. Eating apples are healthy for you. 5. The Eiffel Tower is in Paris. Among these sentences: Sentences 1 and 5 are well-formed and have correct grammar and case. Sentence 2 starts with a lowercase letter. Sentence 3 is a fragment and is not well-formed. Sentence 4 has a subject-verb agreement error. **example_usage:** *library: HuggingFace transformers* ```python import torch from transformers import AutoTokenizer, AutoModelForSequenceClassification tokenizer = AutoTokenizer.from_pretrained("Ashishkr/query_wellformedness_score") model = AutoModelForSequenceClassification.from_pretrained("Ashishkr/query_wellformedness_score") sentences = [ "The quarterly financial report are showing an increase.", # Incorrect "Him has completed the audit for last fiscal year.", # Incorrect "Please to inform the board about the recent developments.", # Incorrect "The team successfully achieved all its targets for the last quarter.", # Correct "Our company is exploring new ventures in the European market." # Correct ] features = tokenizer(sentences, padding=True, truncation=True, return_tensors="pt") model.eval() with torch.no_grad(): scores = model(**features).logits print(scores) ``` Cite Ashishkr/query_wellformedness_score

cardiffnlp/twitter-roberta-base-sentiment

cardiffnlp

transformers

text-classification

--- datasets: - tweet_eval language: - en --- # Twitter-roBERTa-base for Sentiment Analysis This is a roBERTa-base model trained on ~58M tweets and finetuned for sentiment analysis with the TweetEval benchmark. This model is suitable for English (for a similar multilingual model, see [XLM-T](https://huggingface.co/cardiffnlp/twitter-xlm-roberta-base-sentiment)). - Reference Paper: [_TweetEval_ (Findings of EMNLP 2020)](https://arxiv.org/pdf/2010.12421.pdf). - Git Repo: [Tweeteval official repository](https://github.com/cardiffnlp/tweeteval). <b>Labels</b>: 0 -> Negative; 1 -> Neutral; 2 -> Positive <b>New!</b> We just released a new sentiment analysis model trained on more recent and a larger quantity of tweets. See [twitter-roberta-base-sentiment-latest](https://huggingface.co/cardiffnlp/twitter-roberta-base-sentiment-latest) and [TweetNLP](https://tweetnlp.org) for more details. ## Example of classification ```python from transformers import AutoModelForSequenceClassification from transformers import TFAutoModelForSequenceClassification from transformers import AutoTokenizer import numpy as np from scipy.special import softmax import csv import urllib.request # Preprocess text (username and link placeholders) def preprocess(text): new_text = [] for t in text.split(" "): t = '@user' if t.startswith('@') and len(t) > 1 else t t = 'http' if t.startswith('http') else t new_text.append(t) return " ".join(new_text) # Tasks: # emoji, emotion, hate, irony, offensive, sentiment # stance/abortion, stance/atheism, stance/climate, stance/feminist, stance/hillary task='sentiment' MODEL = f"cardiffnlp/twitter-roberta-base-{task}" tokenizer = AutoTokenizer.from_pretrained(MODEL) # download label mapping labels=[] mapping_link = f"https://raw.githubusercontent.com/cardiffnlp/tweeteval/main/datasets/{task}/mapping.txt" with urllib.request.urlopen(mapping_link) as f: html = f.read().decode('utf-8').split("\n") csvreader = csv.reader(html, delimiter='\t') labels = [row[1] for row in csvreader if len(row) > 1] # PT model = AutoModelForSequenceClassification.from_pretrained(MODEL) model.save_pretrained(MODEL) text = "Good night 😊" text = preprocess(text) encoded_input = tokenizer(text, return_tensors='pt') output = model(**encoded_input) scores = output[0][0].detach().numpy() scores = softmax(scores) # # TF # model = TFAutoModelForSequenceClassification.from_pretrained(MODEL) # model.save_pretrained(MODEL) # text = "Good night 😊" # encoded_input = tokenizer(text, return_tensors='tf') # output = model(encoded_input) # scores = output[0][0].numpy() # scores = softmax(scores) ranking = np.argsort(scores) ranking = ranking[::-1] for i in range(scores.shape[0]): l = labels[ranking[i]] s = scores[ranking[i]] print(f"{i+1}) {l} {np.round(float(s), 4)}") ``` Output: ``` 1) positive 0.8466 2) neutral 0.1458 3) negative 0.0076 ``` ### BibTeX entry and citation info Please cite the [reference paper](https://aclanthology.org/2020.findings-emnlp.148/) if you use this model. ```bibtex @inproceedings{barbieri-etal-2020-tweeteval, title = "{T}weet{E}val: Unified Benchmark and Comparative Evaluation for Tweet Classification", author = "Barbieri, Francesco and Camacho-Collados, Jose and Espinosa Anke, Luis and Neves, Leonardo", booktitle = "Findings of the Association for Computational Linguistics: EMNLP 2020", month = nov, year = "2020", address = "Online", publisher = "Association for Computational Linguistics", url = "https://aclanthology.org/2020.findings-emnlp.148", doi = "10.18653/v1/2020.findings-emnlp.148", pages = "1644--1650" } ```

theainerd/Wav2Vec2-large-xlsr-hindi

theainerd

transformers

automatic-speech-recognition

--- language: - hi --- # Wav2Vec2-Large-XLSR-53-hindi Fine-tuned [facebook/wav2vec2-large-xlsr-53](https://huggingface.co/facebook/wav2vec2-large-xlsr-53) hindi using the [Multilingual and code-switching ASR challenges for low resource Indian languages](https://navana-tech.github.io/IS21SS-indicASRchallenge/data.html). When using this model, make sure that your speech input is sampled at 16kHz. ## Usage The model can be used directly (without a language model) as follows: ```python import torch import torchaudio from datasets import load_dataset from transformers import Wav2Vec2ForCTC, Wav2Vec2Processor test_dataset = load_dataset("common_voice", "hi", split="test[:2%]") processor = Wav2Vec2Processor.from_pretrained("theainerd/Wav2Vec2-large-xlsr-hindi") model = Wav2Vec2ForCTC.from_pretrained("theainerd/Wav2Vec2-large-xlsr-hindi") resampler = torchaudio.transforms.Resample(48_000, 16_000) # Preprocessing the datasets. # We need to read the aduio files as arrays def speech_file_to_array_fn(batch): speech_array, sampling_rate = torchaudio.load(batch["path"]) batch["speech"] = resampler(speech_array).squeeze().numpy() return batch test_dataset = test_dataset.map(speech_file_to_array_fn) inputs = processor(test_dataset["speech"][:2], sampling_rate=16_000, return_tensors="pt", padding=True) with torch.no_grad(): logits = model(inputs.input_values, attention_mask=inputs.attention_mask).logits predicted_ids = torch.argmax(logits, dim=-1) print("Prediction:", processor.batch_decode(predicted_ids)) print("Reference:", test_dataset["sentence"][:2]) ``` ## Evaluation The model can be evaluated as follows on the hindi test data of Common Voice. ```python import torch import torchaudio from datasets import load_dataset, load_metric from transformers import Wav2Vec2ForCTC, Wav2Vec2Processor import re test_dataset = load_dataset("common_voice", "hi", split="test") wer = load_metric("wer") processor = Wav2Vec2Processor.from_pretrained("theainerd/Wav2Vec2-large-xlsr-hindi") model = Wav2Vec2ForCTC.from_pretrained("theainerd/Wav2Vec2-large-xlsr-hindi") model.to("cuda") resampler = torchaudio.transforms.Resample(48_000, 16_000) chars_to_ignore_regex = '[\,\?\.\!\-\;\:\"\“]' # Preprocessing the datasets. # We need to read the aduio files as arrays def speech_file_to_array_fn(batch): batch["sentence"] = re.sub(chars_to_ignore_regex, '', batch["sentence"]).lower() speech_array, sampling_rate = torchaudio.load(batch["path"]) batch["speech"] = resampler(speech_array).squeeze().numpy() return batch test_dataset = test_dataset.map(speech_file_to_array_fn) # Preprocessing the datasets. # We need to read the aduio files as arrays def evaluate(batch): inputs = processor(batch["speech"], sampling_rate=16_000, return_tensors="pt", padding=True) with torch.no_grad(): logits = model(inputs.input_values.to("cuda"), attention_mask=inputs.attention_mask.to("cuda")).logits pred_ids = torch.argmax(logits, dim=-1) batch["pred_strings"] = processor.batch_decode(pred_ids) return batch result = test_dataset.map(evaluate, batched=True, batch_size=8) print("WER: {:2f}".format(100 * wer.compute(predictions=result["pred_strings"], references=result["sentence"]))) ``` **Test Result**: 72.62 % ## Training The script used for training can be found [Hindi ASR Fine Tuning Wav2Vec2](https://colab.research.google.com/drive/1m-F7et3CHT_kpFqg7UffTIwnUV9AKgrg?usp=sharing)

nvidia/speakerverification_en_titanet_large

nvidia

nemo

--- language: - en library_name: nemo datasets: - VOXCELEB-1 - VOXCELEB-2 - FISHER - switchboard - librispeech_asr - SRE thumbnail: null tags: - speaker - speech - audio - speaker-verification - speaker-recognition - speaker-diarization - titanet - NeMo - pytorch license: cc-by-4.0 widget: - src: https://huggingface.co/nvidia/speakerverification_en_titanet_large/resolve/main/an255-fash-b.wav example_title: Speech sample 1 - src: https://huggingface.co/nvidia/speakerverification_en_titanet_large/resolve/main/cen7-fash-b.wav example_title: Speech sample 2 model-index: - name: speakerverification_en_titanet_large results: - task: name: Speaker Verification type: speaker-verification dataset: name: voxceleb1 type: voxceleb1-O config: clean split: test args: language: en metrics: - name: Test EER type: eer value: 0.66 - task: type: Speaker Diarization name: speaker-diarization dataset: name: ami-mixheadset type: ami_diarization config: oracle-vad-known-number-of-speakers split: test args: language: en metrics: - name: Test DER type: der value: 1.73 - task: type: Speaker Diarization name: speaker-diarization dataset: name: ami-lapel type: ami_diarization config: oracle-vad-known-number-of-speakers split: test args: language: en metrics: - name: Test DER type: der value: 2.03 - task: type: Speaker Diarization name: speaker-diarization dataset: name: ch109 type: callhome_diarization config: oracle-vad-known-number-of-speakers split: test args: language: en metrics: - name: Test DER type: der value: 1.19 - task: type: Speaker Diarization name: speaker-diarization dataset: name: nist-sre-2000 type: nist-sre_diarization config: oracle-vad-known-number-of-speakers split: test args: language: en metrics: - name: Test DER type: der value: 6.73 --- # NVIDIA TitaNet-Large (en-US) <style> img { display: inline; } </style> | [](#model-architecture) | [](#model-architecture) | [](#datasets) This model extracts speaker embeddings from given speech, which is the backbone for speaker verification and diarization tasks. It is a "large" version of TitaNet (around 23M parameters) models. See the [model architecture](#model-architecture) section and [NeMo documentation](https://docs.nvidia.com/deeplearning/nemo/user-guide/docs/en/stable/asr/speaker_recognition/models.html#titanet) for complete architecture details. ## NVIDIA NeMo: Training To train, fine-tune or play with the model you will need to install [NVIDIA NeMo](https://github.com/NVIDIA/NeMo). We recommend you install it after you've installed the latest Pytorch version. ``` pip install nemo_toolkit['all'] ``` ## How to Use this Model The model is available for use in the NeMo toolkit [3] and can be used as a pre-trained checkpoint for inference or for fine-tuning on another dataset. ### Automatically instantiate the model ```python import nemo.collections.asr as nemo_asr speaker_model = nemo_asr.models.EncDecSpeakerLabelModel.from_pretrained("nvidia/speakerverification_en_titanet_large") ``` ### Embedding Extraction Using ```python emb = speaker_model.get_embedding("an255-fash-b.wav") ``` ### Verifying two utterances (Speaker Verification) Now to check if two audio files are from the same speaker or not, simply do: ```python speaker_model.verify_speakers("an255-fash-b.wav","cen7-fash-b.wav") ``` ### Extracting Embeddings for more audio files To extract embeddings from a bunch of audio files: Write audio files to a `manifest.json` file with lines as in format: ```json {"audio_filepath": "<absolute path to dataset>/audio_file.wav", "duration": "duration of file in sec", "label": "speaker_id"} ``` Then running following script will extract embeddings and writes to current working directory: ```shell python <NeMo_root>/examples/speaker_tasks/recognition/extract_speaker_embeddings.py --manifest=manifest.json ``` ### Input This model accepts 16000 KHz Mono-channel Audio (wav files) as input. ### Output This model provides speaker embeddings for an audio file. ## Model Architecture TitaNet model is a depth-wise separable conv1D model [1] for Speaker Verification and diarization tasks. You may find more info on the detail of this model here: [TitaNet-Model](https://docs.nvidia.com/deeplearning/nemo/user-guide/docs/en/main/asr/speaker_recognition/models.html). ## Training The NeMo toolkit [3] was used for training the models for over several hundred epochs. These model are trained with this [example script](https://github.com/NVIDIA/NeMo/blob/main/examples/speaker_tasks/recognition/speaker_reco.py) and this [base config](https://github.com/NVIDIA/NeMo/blob/main/examples/speaker_tasks/recognition/conf/titanet-large.yaml). ### Datasets All the models in this collection are trained on a composite dataset comprising several thousand hours of English speech: - Voxceleb-1 - Voxceleb-2 - Fisher - Switchboard - Librispeech - SRE (2004-2010) ## Performance Performances of the these models are reported in terms of Equal Error Rate (EER%) on speaker verification evaluation trial files and as Diarization Error Rate (DER%) on diarization test sessions. * Speaker Verification (EER%) | Version | Model | Model Size | VoxCeleb1 (Cleaned trial file) | |---------|--------------|-----|---------------| | 1.10.0 | TitaNet-Large | 23M | 0.66 | * Speaker Diarization (DER%) | Version | Model | Model Size | Evaluation Condition | NIST SRE 2000 | AMI (Lapel) | AMI (MixHeadset) | CH109 | |---------|--------------|-----|----------------------|---------------|-------------|------------------|-------| | 1.10.0 | TitaNet-Large | 23M | Oracle VAD KNOWN # of Speakers | 6.73 | 2.03 | 1.73 | 1.19 | | 1.10.0 | TitaNet-Large | 23M | Oracle VAD UNKNOWN # of Speakers | 5.38 | 2.03 | 1.89 | 1.63 | ## Limitations This model is trained on both telephonic and non-telephonic speech from voxceleb datasets, Fisher and switch board. If your domain of data differs from trained data or doesnot show relatively good performance consider finetuning for that speech domain. ## NVIDIA Riva: Deployment [NVIDIA Riva](https://developer.nvidia.com/riva), is an accelerated speech AI SDK deployable on-prem, in all clouds, multi-cloud, hybrid, on edge, and embedded. Additionally, Riva provides: * World-class out-of-the-box accuracy for the most common languages with model checkpoints trained on proprietary data with hundreds of thousands of GPU-compute hours * Best in class accuracy with run-time word boosting (e.g., brand and product names) and customization of acoustic model, language model, and inverse text normalization * Streaming speech recognition, Kubernetes compatible scaling, and enterprise-grade support Although this model isn’t supported yet by Riva, the [list of supported models is here](https://huggingface.co/models?other=Riva). Check out [Riva live demo](https://developer.nvidia.com/riva#demos). ## References [1] [TitaNet: Neural Model for Speaker Representation with 1D Depth-wise Separable convolutions and global context](https://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=9746806) [2] [NVIDIA NeMo Toolkit](https://github.com/NVIDIA/NeMo) ## Licence License to use this model is covered by the [CC-BY-4.0](https://creativecommons.org/licenses/by/4.0/). By downloading the public and release version of the model, you accept the terms and conditions of the [CC-BY-4.0](https://creativecommons.org/licenses/by/4.0/) license.

facebook/bart-large

facebook

transformers

feature-extraction

--- license: apache-2.0 language: en --- # BART (large-sized model) BART model pre-trained on English language. It was introduced in the paper [BART: Denoising Sequence-to-Sequence Pre-training for Natural Language Generation, Translation, and Comprehension](https://arxiv.org/abs/1910.13461) by Lewis et al. and first released in [this repository](https://github.com/pytorch/fairseq/tree/master/examples/bart). Disclaimer: The team releasing BART did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description BART is a transformer encoder-decoder (seq2seq) model with a bidirectional (BERT-like) encoder and an autoregressive (GPT-like) decoder. BART is pre-trained by (1) corrupting text with an arbitrary noising function, and (2) learning a model to reconstruct the original text. BART is particularly effective when fine-tuned for text generation (e.g. summarization, translation) but also works well for comprehension tasks (e.g. text classification, question answering). ## Intended uses & limitations You can use the raw model for text infilling. However, the model is mostly meant to be fine-tuned on a supervised dataset. See the [model hub](https://huggingface.co/models?search=bart) to look for fine-tuned versions on a task that interests you. ### How to use Here is how to use this model in PyTorch: ```python from transformers import BartTokenizer, BartModel tokenizer = BartTokenizer.from_pretrained('facebook/bart-large') model = BartModel.from_pretrained('facebook/bart-large') inputs = tokenizer("Hello, my dog is cute", return_tensors="pt") outputs = model(**inputs) last_hidden_states = outputs.last_hidden_state ``` ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-1910-13461, author = {Mike Lewis and Yinhan Liu and Naman Goyal and Marjan Ghazvininejad and Abdelrahman Mohamed and Omer Levy and Veselin Stoyanov and Luke Zettlemoyer}, title = {{BART:} Denoising Sequence-to-Sequence Pre-training for Natural Language Generation, Translation, and Comprehension}, journal = {CoRR}, volume = {abs/1910.13461}, year = {2019}, url = {http://arxiv.org/abs/1910.13461}, eprinttype = {arXiv}, eprint = {1910.13461}, timestamp = {Thu, 31 Oct 2019 14:02:26 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1910-13461.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

dmis-lab/biobert-v1.1

dmis-lab

transformers

feature-extraction

Entry not found

ProsusAI/finbert

ProsusAI

transformers

text-classification

--- language: "en" tags: - financial-sentiment-analysis - sentiment-analysis widget: - text: "Stocks rallied and the British pound gained." --- FinBERT is a pre-trained NLP model to analyze sentiment of financial text. It is built by further training the BERT language model in the finance domain, using a large financial corpus and thereby fine-tuning it for financial sentiment classification. [Financial PhraseBank](https://www.researchgate.net/publication/251231107_Good_Debt_or_Bad_Debt_Detecting_Semantic_Orientations_in_Economic_Texts) by Malo et al. (2014) is used for fine-tuning. For more details, please see the paper [FinBERT: Financial Sentiment Analysis with Pre-trained Language Models](https://arxiv.org/abs/1908.10063) and our related [blog post](https://medium.com/prosus-ai-tech-blog/finbert-financial-sentiment-analysis-with-bert-b277a3607101) on Medium. The model will give softmax outputs for three labels: positive, negative or neutral. --- About Prosus Prosus is a global consumer internet group and one of the largest technology investors in the world. Operating and investing globally in markets with long-term growth potential, Prosus builds leading consumer internet companies that empower people and enrich communities. For more information, please visit www.prosus.com. Contact information Please contact Dogu Araci dogu.araci[at]prosus[dot]com and Zulkuf Genc zulkuf.genc[at]prosus[dot]com about any FinBERT related issues and questions.

cambridgeltl/SapBERT-from-PubMedBERT-fulltext

cambridgeltl

transformers

feature-extraction

--- license: apache-2.0 language: - en tags: - biomedical - lexical semantics - bionlp - biology - science - embedding - entity linking --- --- datasets: - UMLS **[news]** A cross-lingual extension of SapBERT will appear in the main onference of **ACL 2021**! <br> **[news]** SapBERT will appear in the conference proceedings of **NAACL 2021**! ### SapBERT-PubMedBERT SapBERT by [Liu et al. (2020)](https://arxiv.org/pdf/2010.11784.pdf). Trained with [UMLS](https://www.nlm.nih.gov/research/umls/licensedcontent/umlsknowledgesources.html) 2020AA (English only), using [microsoft/BiomedNLP-PubMedBERT-base-uncased-abstract-fulltext](https://huggingface.co/microsoft/BiomedNLP-PubMedBERT-base-uncased-abstract-fulltext) as the base model. ### Expected input and output The input should be a string of biomedical entity names, e.g., "covid infection" or "Hydroxychloroquine". The [CLS] embedding of the last layer is regarded as the output. #### Extracting embeddings from SapBERT The following script converts a list of strings (entity names) into embeddings. ```python import numpy as np import torch from tqdm.auto import tqdm from transformers import AutoTokenizer, AutoModel tokenizer = AutoTokenizer.from_pretrained("cambridgeltl/SapBERT-from-PubMedBERT-fulltext") model = AutoModel.from_pretrained("cambridgeltl/SapBERT-from-PubMedBERT-fulltext").cuda() # replace with your own list of entity names all_names = ["covid-19", "Coronavirus infection", "high fever", "Tumor of posterior wall of oropharynx"] bs = 128 # batch size during inference all_embs = [] for i in tqdm(np.arange(0, len(all_names), bs)): toks = tokenizer.batch_encode_plus(all_names[i:i+bs], padding="max_length", max_length=25, truncation=True, return_tensors="pt") toks_cuda = {} for k,v in toks.items(): toks_cuda[k] = v.cuda() cls_rep = model(**toks_cuda)[0][:,0,:] # use CLS representation as the embedding all_embs.append(cls_rep.cpu().detach().numpy()) all_embs = np.concatenate(all_embs, axis=0) ``` For more details about training and eval, see SapBERT [github repo](https://github.com/cambridgeltl/sapbert). ### Citation ```bibtex @inproceedings{liu-etal-2021-self, title = "Self-Alignment Pretraining for Biomedical Entity Representations", author = "Liu, Fangyu and Shareghi, Ehsan and Meng, Zaiqiao and Basaldella, Marco and Collier, Nigel", booktitle = "Proceedings of the 2021 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies", month = jun, year = "2021", address = "Online", publisher = "Association for Computational Linguistics", url = "https://www.aclweb.org/anthology/2021.naacl-main.334", pages = "4228--4238", abstract = "Despite the widespread success of self-supervised learning via masked language models (MLM), accurately capturing fine-grained semantic relationships in the biomedical domain remains a challenge. This is of paramount importance for entity-level tasks such as entity linking where the ability to model entity relations (especially synonymy) is pivotal. To address this challenge, we propose SapBERT, a pretraining scheme that self-aligns the representation space of biomedical entities. We design a scalable metric learning framework that can leverage UMLS, a massive collection of biomedical ontologies with 4M+ concepts. In contrast with previous pipeline-based hybrid systems, SapBERT offers an elegant one-model-for-all solution to the problem of medical entity linking (MEL), achieving a new state-of-the-art (SOTA) on six MEL benchmarking datasets. In the scientific domain, we achieve SOTA even without task-specific supervision. With substantial improvement over various domain-specific pretrained MLMs such as BioBERT, SciBERTand and PubMedBERT, our pretraining scheme proves to be both effective and robust.", } ```

sentence-transformers/multi-qa-mpnet-base-dot-v1

sentence-transformers

sentence-transformers

sentence-similarity

--- language: - en library_name: sentence-transformers tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers datasets: - flax-sentence-embeddings/stackexchange_xml - ms_marco - gooaq - yahoo_answers_topics - search_qa - eli5 - natural_questions - trivia_qa - embedding-data/QQP - embedding-data/PAQ_pairs - embedding-data/Amazon-QA - embedding-data/WikiAnswers pipeline_tag: sentence-similarity --- # multi-qa-mpnet-base-dot-v1 This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 768 dimensional dense vector space and was designed for **semantic search**. It has been trained on 215M (question, answer) pairs from diverse sources. For an introduction to semantic search, have a look at: [SBERT.net - Semantic Search](https://www.sbert.net/examples/applications/semantic-search/README.html) ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer, util query = "How many people live in London?" docs = ["Around 9 Million people live in London", "London is known for its financial district"] #Load the model model = SentenceTransformer('sentence-transformers/multi-qa-mpnet-base-dot-v1') #Encode query and documents query_emb = model.encode(query) doc_emb = model.encode(docs) #Compute dot score between query and all document embeddings scores = util.dot_score(query_emb, doc_emb)[0].cpu().tolist() #Combine docs & scores doc_score_pairs = list(zip(docs, scores)) #Sort by decreasing score doc_score_pairs = sorted(doc_score_pairs, key=lambda x: x[1], reverse=True) #Output passages & scores for doc, score in doc_score_pairs: print(score, doc) ``` ## Usage (HuggingFace Transformers) Without [sentence-transformers](https://www.SBERT.net), you can use the model like this: First, you pass your input through the transformer model, then you have to apply the correct pooling-operation on-top of the contextualized word embeddings. ```python from transformers import AutoTokenizer, AutoModel import torch #CLS Pooling - Take output from first token def cls_pooling(model_output): return model_output.last_hidden_state[:,0] #Encode text def encode(texts): # Tokenize sentences encoded_input = tokenizer(texts, padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input, return_dict=True) # Perform pooling embeddings = cls_pooling(model_output) return embeddings # Sentences we want sentence embeddings for query = "How many people live in London?" docs = ["Around 9 Million people live in London", "London is known for its financial district"] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained("sentence-transformers/multi-qa-mpnet-base-dot-v1") model = AutoModel.from_pretrained("sentence-transformers/multi-qa-mpnet-base-dot-v1") #Encode query and docs query_emb = encode(query) doc_emb = encode(docs) #Compute dot score between query and all document embeddings scores = torch.mm(query_emb, doc_emb.transpose(0, 1))[0].cpu().tolist() #Combine docs & scores doc_score_pairs = list(zip(docs, scores)) #Sort by decreasing score doc_score_pairs = sorted(doc_score_pairs, key=lambda x: x[1], reverse=True) #Output passages & scores for doc, score in doc_score_pairs: print(score, doc) ``` ## Technical Details In the following some technical details how this model must be used: | Setting | Value | | --- | :---: | | Dimensions | 768 | | Produces normalized embeddings | No | | Pooling-Method | CLS pooling | | Suitable score functions | dot-product (e.g. `util.dot_score`) | ---- ## Background The project aims to train sentence embedding models on very large sentence level datasets using a self-supervised contrastive learning objective. We use a contrastive learning objective: given a sentence from the pair, the model should predict which out of a set of randomly sampled other sentences, was actually paired with it in our dataset. We developped this model during the [Community week using JAX/Flax for NLP & CV](https://discuss.huggingface.co/t/open-to-the-community-community-week-using-jax-flax-for-nlp-cv/7104), organized by Hugging Face. We developped this model as part of the project: [Train the Best Sentence Embedding Model Ever with 1B Training Pairs](https://discuss.huggingface.co/t/train-the-best-sentence-embedding-model-ever-with-1b-training-pairs/7354). We benefited from efficient hardware infrastructure to run the project: 7 TPUs v3-8, as well as intervention from Googles Flax, JAX, and Cloud team member about efficient deep learning frameworks. ## Intended uses Our model is intented to be used for semantic search: It encodes queries / questions and text paragraphs in a dense vector space. It finds relevant documents for the given passages. Note that there is a limit of 512 word pieces: Text longer than that will be truncated. Further note that the model was just trained on input text up to 250 word pieces. It might not work well for longer text. ## Training procedure The full training script is accessible in this current repository: `train_script.py`. ### Pre-training We use the pretrained [`mpnet-base`](https://huggingface.co/microsoft/mpnet-base) model. Please refer to the model card for more detailed information about the pre-training procedure. #### Training We use the concatenation from multiple datasets to fine-tune our model. In total we have about 215M (question, answer) pairs. We sampled each dataset given a weighted probability which configuration is detailed in the `data_config.json` file. The model was trained with [MultipleNegativesRankingLoss](https://www.sbert.net/docs/package_reference/losses.html#multiplenegativesrankingloss) using CLS-pooling, dot-product as similarity function, and a scale of 1. | Dataset | Number of training tuples | |--------------------------------------------------------|:--------------------------:| | [WikiAnswers](https://github.com/afader/oqa#wikianswers-corpus) Duplicate question pairs from WikiAnswers | 77,427,422 | | [PAQ](https://github.com/facebookresearch/PAQ) Automatically generated (Question, Paragraph) pairs for each paragraph in Wikipedia | 64,371,441 | | [Stack Exchange](https://huggingface.co/datasets/flax-sentence-embeddings/stackexchange_xml) (Title, Body) pairs from all StackExchanges | 25,316,456 | | [Stack Exchange](https://huggingface.co/datasets/flax-sentence-embeddings/stackexchange_xml) (Title, Answer) pairs from all StackExchanges | 21,396,559 | | [MS MARCO](https://microsoft.github.io/msmarco/) Triplets (query, answer, hard_negative) for 500k queries from Bing search engine | 17,579,773 | | [GOOAQ: Open Question Answering with Diverse Answer Types](https://github.com/allenai/gooaq) (query, answer) pairs for 3M Google queries and Google featured snippet | 3,012,496 | | [Amazon-QA](http://jmcauley.ucsd.edu/data/amazon/qa/) (Question, Answer) pairs from Amazon product pages | 2,448,839 | [Yahoo Answers](https://www.kaggle.com/soumikrakshit/yahoo-answers-dataset) (Title, Answer) pairs from Yahoo Answers | 1,198,260 | | [Yahoo Answers](https://www.kaggle.com/soumikrakshit/yahoo-answers-dataset) (Question, Answer) pairs from Yahoo Answers | 681,164 | | [Yahoo Answers](https://www.kaggle.com/soumikrakshit/yahoo-answers-dataset) (Title, Question) pairs from Yahoo Answers | 659,896 | | [SearchQA](https://huggingface.co/datasets/search_qa) (Question, Answer) pairs for 140k questions, each with Top5 Google snippets on that question | 582,261 | | [ELI5](https://huggingface.co/datasets/eli5) (Question, Answer) pairs from Reddit ELI5 (explainlikeimfive) | 325,475 | | [Stack Exchange](https://huggingface.co/datasets/flax-sentence-embeddings/stackexchange_xml) Duplicate questions pairs (titles) | 304,525 | | [Quora Question Triplets](https://quoradata.quora.com/First-Quora-Dataset-Release-Question-Pairs) (Question, Duplicate_Question, Hard_Negative) triplets for Quora Questions Pairs dataset | 103,663 | | [Natural Questions (NQ)](https://ai.google.com/research/NaturalQuestions) (Question, Paragraph) pairs for 100k real Google queries with relevant Wikipedia paragraph | 100,231 | | [SQuAD2.0](https://rajpurkar.github.io/SQuAD-explorer/) (Question, Paragraph) pairs from SQuAD2.0 dataset | 87,599 | | [TriviaQA](https://huggingface.co/datasets/trivia_qa) (Question, Evidence) pairs | 73,346 | | **Total** | **214,988,242** |

pyannote/embedding

pyannote

pyannote-audio

--- tags: - pyannote - pyannote-audio - pyannote-audio-model - audio - voice - speech - speaker - speaker-recognition - speaker-verification - speaker-identification - speaker-embedding datasets: - voxceleb license: mit inference: false extra_gated_prompt: "The collected information will help acquire a better knowledge of pyannote.audio userbase and help its maintainers apply for grants to improve it further. If you are an academic researcher, please cite the relevant papers in your own publications using the model. If you work for a company, please consider contributing back to pyannote.audio development (e.g. through unrestricted gifts). We also provide scientific consulting services around speaker diarization and machine listening." extra_gated_fields: Company/university: text Website: text I plan to use this model for (task, type of audio data, etc): text --- Using this open-source model in production? Consider switching to [pyannoteAI](https://www.pyannote.ai) for better and faster options. # 🎹 Speaker embedding Relies on pyannote.audio 2.1: see [installation instructions](https://github.com/pyannote/pyannote-audio/). This model is based on the [canonical x-vector TDNN-based architecture](https://ieeexplore.ieee.org/abstract/document/8461375), but with filter banks replaced with [trainable SincNet features](https://ieeexplore.ieee.org/document/8639585). See [`XVectorSincNet`](https://github.com/pyannote/pyannote-audio/blob/3c988c028dc505c64fe776720372f6fe816b585a/pyannote/audio/models/embedding/xvector.py#L104-L169) architecture for implementation details. ## Basic usage ```python # 1. visit hf.co/pyannote/embedding and accept user conditions # 2. visit hf.co/settings/tokens to create an access token # 3. instantiate pretrained model from pyannote.audio import Model model = Model.from_pretrained("pyannote/embedding", use_auth_token="ACCESS_TOKEN_GOES_HERE") ``` ```python from pyannote.audio import Inference inference = Inference(model, window="whole") embedding1 = inference("speaker1.wav") embedding2 = inference("speaker2.wav") # `embeddingX` is (1 x D) numpy array extracted from the file as a whole. from scipy.spatial.distance import cdist distance = cdist(embedding1, embedding2, metric="cosine")[0,0] # `distance` is a `float` describing how dissimilar speakers 1 and 2 are. ``` Using cosine distance directly, this model reaches 2.8% equal error rate (EER) on VoxCeleb 1 test set. This is without voice activity detection (VAD) nor probabilistic linear discriminant analysis (PLDA). Expect even better results when adding one of those. ## Advanced usage ### Running on GPU ```python import torch inference.to(torch.device("cuda")) embedding = inference("audio.wav") ``` ### Extract embedding from an excerpt ```python from pyannote.audio import Inference from pyannote.core import Segment inference = Inference(model, window="whole") excerpt = Segment(13.37, 19.81) embedding = inference.crop("audio.wav", excerpt) # `embedding` is (1 x D) numpy array extracted from the file excerpt. ``` ### Extract embeddings using a sliding window ```python from pyannote.audio import Inference inference = Inference(model, window="sliding", duration=3.0, step=1.0) embeddings = inference("audio.wav") # `embeddings` is a (N x D) pyannote.core.SlidingWindowFeature # `embeddings[i]` is the embedding of the ith position of the # sliding window, i.e. from [i * step, i * step + duration]. ``` ## Citation ```bibtex @inproceedings{Bredin2020, Title = {{pyannote.audio: neural building blocks for speaker diarization}}, Author = {{Bredin}, Herv{\'e} and {Yin}, Ruiqing and {Coria}, Juan Manuel and {Gelly}, Gregory and {Korshunov}, Pavel and {Lavechin}, Marvin and {Fustes}, Diego and {Titeux}, Hadrien and {Bouaziz}, Wassim and {Gill}, Marie-Philippe}, Booktitle = {ICASSP 2020, IEEE International Conference on Acoustics, Speech, and Signal Processing}, Address = {Barcelona, Spain}, Month = {May}, Year = {2020}, } ``` ```bibtex @inproceedings{Coria2020, author="Coria, Juan M. and Bredin, Herv{\'e} and Ghannay, Sahar and Rosset, Sophie", editor="Espinosa-Anke, Luis and Mart{\'i}n-Vide, Carlos and Spasi{\'{c}}, Irena", title="{A Comparison of Metric Learning Loss Functions for End-To-End Speaker Verification}", booktitle="Statistical Language and Speech Processing", year="2020", publisher="Springer International Publishing", pages="137--148", isbn="978-3-030-59430-5" } ```

lengyue233/content-vec-best

lengyue233

transformers

--- license: mit --- # Content Vec Best Official Repo: [ContentVec](https://github.com/auspicious3000/contentvec) This repo brings fairseq ContentVec model to HuggingFace Transformers. ## How to use To use this model, you need to define ```python class HubertModelWithFinalProj(HubertModel): def __init__(self, config): super().__init__(config) # The final projection layer is only used for backward compatibility. # Following https://github.com/auspicious3000/contentvec/issues/6 # Remove this layer is necessary to achieve the desired outcome. self.final_proj = nn.Linear(config.hidden_size, config.classifier_proj_size) ``` and then load the model with ```python model = HubertModelWithFinalProj.from_pretrained("lengyue233/content-vec-best") x = model(audio)["last_hidden_state"] ``` ## How to convert You need to download the ContentVec_legacy model from the official repo, and then run ```bash python convert.py ```

wasmdashai/vits-ar-sa-huba

wasmdashai

transformers

text-to-speech

--- language: - ar library_name: transformers pipeline_tag: text-to-speech --- # Model Card for Model ID <!-- Provide a quick summary of what the model is/does. --> ## Model Details ### Model Description <!-- Provide a longer summary of what this model is. --> An advanced text-to-speech (TTS) system specifically designed for the Saudi dialect, built on the VITS architecture and utilizing the pre-trained weights from Facebook's vits ara model. The model is capable of: Generating natural and realistic speech: Producing high-quality Saudi dialect speech that closely mimics human voices, preserving intonation and linguistic nuances. Understanding colloquial text: Processing text written in the Saudi dialect, including idiomatic expressions and local vocabulary. Controlling voice characteristics: Adjusting various aspects of the generated speech, such as pitch and speaking rate. Providing ease of use: Offering a simple and user-friendly interface for converting text to speech with high quality. Model Details VITS (Variational Inference with adversarial learning for end-to-end Text-to-Speech) is an end-to-end speech synthesis model that predicts a speech waveform conditional on an input text sequence. It is a conditional variational autoencoder (VAE) comprised of a posterior encoder, decoder, and conditional prior. A set of spectrogram-based acoustic features are predicted by the flow-based module, which is formed of a Transformer-based text encoder and multiple coupling layers. The spectrogram is decoded using a stack of transposed convolutional layers, much in the same style as the HiFi-GAN vocoder. Motivated by the one-to-many nature of the TTS problem, where the same text input can be spoken in multiple ways, the model also includes a stochastic duration predictor, which allows the model to synthesise speech with different rhythms from the same input text. #### Summary ## Model Examination [optional] <!-- Relevant interpretability work for the model goes here --> [More Information Needed] ## Environmental Impact <!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly --> Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). - **Hardware Type:** [More Information Needed] - **Hours used:** [More Information Needed] - **Cloud Provider:** [More Information Needed] - **Compute Region:** [More Information Needed] - **Carbon Emitted:** [More Information Needed] ## Technical Specifications [optional] ### Model Architecture and Objective [More Information Needed] ### Compute Infrastructure [More Information Needed] #### Hardware [More Information Needed] #### Software [More Information Needed] ## Citation [optional] <!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. --> **BibTeX:** [More Information Needed] **APA:** [More Information Needed] ## Glossary [optional] <!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. --> [More Information Needed] ## More Information [optional] [More Information Needed] ## Model Card Authors [optional] [More Information Needed] ## Model Card Contact [More Information Needed]

nlptown/bert-base-multilingual-uncased-sentiment

nlptown

transformers

text-classification

--- language: - en - nl - de - fr - it - es license: mit --- # bert-base-multilingual-uncased-sentiment This is a bert-base-multilingual-uncased model finetuned for sentiment analysis on product reviews in six languages: English, Dutch, German, French, Spanish, and Italian. It predicts the sentiment of the review as a number of stars (between 1 and 5). This model is intended for direct use as a sentiment analysis model for product reviews in any of the six languages above or for further finetuning on related sentiment analysis tasks. ## Training data Here is the number of product reviews we used for finetuning the model: | Language | Number of reviews | | -------- | ----------------- | | English | 150k | | Dutch | 80k | | German | 137k | | French | 140k | | Italian | 72k | | Spanish | 50k | ## Accuracy The fine-tuned model obtained the following accuracy on 5,000 held-out product reviews in each of the languages: - Accuracy (exact) is the exact match for the number of stars. - Accuracy (off-by-1) is the percentage of reviews where the number of stars the model predicts differs by a maximum of 1 from the number given by the human reviewer. | Language | Accuracy (exact) | Accuracy (off-by-1) | | -------- | ---------------------- | ------------------- | | English | 67% | 95% | Dutch | 57% | 93% | German | 61% | 94% | French | 59% | 94% | Italian | 59% | 95% | Spanish | 58% | 95% ## Contact If you found this model useful, you can buy me a coffee at https://www.buymeacoffee.com/yvespeirsman. In addition to this model, [NLP Town](http://nlp.town) offers custom models for many languages and NLP tasks. Feel free to contact me for questions, feedback and/or requests for similar models.

microsoft/layoutlmv3-base

microsoft

transformers

--- language: en license: cc-by-nc-sa-4.0 --- # LayoutLMv3 [Microsoft Document AI](https://www.microsoft.com/en-us/research/project/document-ai/) | [GitHub](https://aka.ms/layoutlmv3) ## Model description LayoutLMv3 is a pre-trained multimodal Transformer for Document AI with unified text and image masking. The simple unified architecture and training objectives make LayoutLMv3 a general-purpose pre-trained model. For example, LayoutLMv3 can be fine-tuned for both text-centric tasks, including form understanding, receipt understanding, and document visual question answering, and image-centric tasks such as document image classification and document layout analysis. [LayoutLMv3: Pre-training for Document AI with Unified Text and Image Masking](https://arxiv.org/abs/2204.08387) Yupan Huang, Tengchao Lv, Lei Cui, Yutong Lu, Furu Wei, ACM Multimedia 2022. ## Citation If you find LayoutLM useful in your research, please cite the following paper: ``` @inproceedings{huang2022layoutlmv3, author={Yupan Huang and Tengchao Lv and Lei Cui and Yutong Lu and Furu Wei}, title={LayoutLMv3: Pre-training for Document AI with Unified Text and Image Masking}, booktitle={Proceedings of the 30th ACM International Conference on Multimedia}, year={2022} } ``` ## License The content of this project itself is licensed under the [Attribution-NonCommercial-ShareAlike 4.0 International (CC BY-NC-SA 4.0)](https://creativecommons.org/licenses/by-nc-sa/4.0/). Portions of the source code are based on the [transformers](https://github.com/huggingface/transformers) project. [Microsoft Open Source Code of Conduct](https://opensource.microsoft.com/codeofconduct)

yiyanghkust/finbert-tone

yiyanghkust

transformers

text-classification

--- language: "en" tags: - financial-sentiment-analysis - sentiment-analysis widget: - text: "growth is strong and we have plenty of liquidity" --- `FinBERT` is a BERT model pre-trained on financial communication text. The purpose is to enhance financial NLP research and practice. It is trained on the following three financial communication corpus. The total corpora size is 4.9B tokens. - Corporate Reports 10-K & 10-Q: 2.5B tokens - Earnings Call Transcripts: 1.3B tokens - Analyst Reports: 1.1B tokens More technical details on `FinBERT`: [Click Link](https://github.com/yya518/FinBERT) This released `finbert-tone` model is the `FinBERT` model fine-tuned on 10,000 manually annotated (positive, negative, neutral) sentences from analyst reports. This model achieves superior performance on financial tone analysis task. If you are simply interested in using `FinBERT` for financial tone analysis, give it a try. If you use the model in your academic work, please cite the following paper: Huang, Allen H., Hui Wang, and Yi Yang. "FinBERT: A Large Language Model for Extracting Information from Financial Text." *Contemporary Accounting Research* (2022). # How to use You can use this model with Transformers pipeline for sentiment analysis. ```python from transformers import BertTokenizer, BertForSequenceClassification from transformers import pipeline finbert = BertForSequenceClassification.from_pretrained('yiyanghkust/finbert-tone',num_labels=3) tokenizer = BertTokenizer.from_pretrained('yiyanghkust/finbert-tone') nlp = pipeline("sentiment-analysis", model=finbert, tokenizer=tokenizer) sentences = ["there is a shortage of capital, and we need extra financing", "growth is strong and we have plenty of liquidity", "there are doubts about our finances", "profits are flat"] results = nlp(sentences) print(results) #LABEL_0: neutral; LABEL_1: positive; LABEL_2: negative ```

stabilityai/stable-diffusion-2-1-base

stabilityai

diffusers

text-to-image

--- license: openrail++ tags: - stable-diffusion - text-to-image --- # Stable Diffusion v2-1-base Model Card This model card focuses on the model associated with the Stable Diffusion v2-1-base model. This `stable-diffusion-2-1-base` model fine-tunes [stable-diffusion-2-base](https://huggingface.co/stabilityai/stable-diffusion-2-base) (`512-base-ema.ckpt`) with 220k extra steps taken, with `punsafe=0.98` on the same dataset. - Use it with the [`stablediffusion`](https://github.com/Stability-AI/stablediffusion) repository: download the `v2-1_512-ema-pruned.ckpt` [here](https://huggingface.co/stabilityai/stable-diffusion-2-1-base/resolve/main/v2-1_512-ema-pruned.ckpt). - Use it with 🧨 [`diffusers`](#examples) ## Model Details - **Developed by:** Robin Rombach, Patrick Esser - **Model type:** Diffusion-based text-to-image generation model - **Language(s):** English - **License:** [CreativeML Open RAIL++-M License](https://huggingface.co/stabilityai/stable-diffusion-2/blob/main/LICENSE-MODEL) - **Model Description:** This is a model that can be used to generate and modify images based on text prompts. It is a [Latent Diffusion Model](https://arxiv.org/abs/2112.10752) that uses a fixed, pretrained text encoder ([OpenCLIP-ViT/H](https://github.com/mlfoundations/open_clip)). - **Resources for more information:** [GitHub Repository](https://github.com/Stability-AI/). - **Cite as:** @InProceedings{Rombach_2022_CVPR, author = {Rombach, Robin and Blattmann, Andreas and Lorenz, Dominik and Esser, Patrick and Ommer, Bj\"orn}, title = {High-Resolution Image Synthesis With Latent Diffusion Models}, booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition (CVPR)}, month = {June}, year = {2022}, pages = {10684-10695} } ## Examples Using the [🤗's Diffusers library](https://github.com/huggingface/diffusers) to run Stable Diffusion 2 in a simple and efficient manner. ```bash pip install diffusers transformers accelerate scipy safetensors ``` Running the pipeline (if you don't swap the scheduler it will run with the default PNDM/PLMS scheduler, in this example we are swapping it to EulerDiscreteScheduler): ```python from diffusers import StableDiffusionPipeline, EulerDiscreteScheduler import torch model_id = "stabilityai/stable-diffusion-2-1-base" scheduler = EulerDiscreteScheduler.from_pretrained(model_id, subfolder="scheduler") pipe = StableDiffusionPipeline.from_pretrained(model_id, scheduler=scheduler, torch_dtype=torch.float16) pipe = pipe.to("cuda") prompt = "a photo of an astronaut riding a horse on mars" image = pipe(prompt).images[0] image.save("astronaut_rides_horse.png") ``` **Notes**: - Despite not being a dependency, we highly recommend you to install [xformers](https://github.com/facebookresearch/xformers) for memory efficient attention (better performance) - If you have low GPU RAM available, make sure to add a `pipe.enable_attention_slicing()` after sending it to `cuda` for less VRAM usage (to the cost of speed) # Uses ## Direct Use The model is intended for research purposes only. Possible research areas and tasks include - Safe deployment of models which have the potential to generate harmful content. - Probing and understanding the limitations and biases of generative models. - Generation of artworks and use in design and other artistic processes. - Applications in educational or creative tools. - Research on generative models. Excluded uses are described below. ### Misuse, Malicious Use, and Out-of-Scope Use _Note: This section is originally taken from the [DALLE-MINI model card](https://huggingface.co/dalle-mini/dalle-mini), was used for Stable Diffusion v1, but applies in the same way to Stable Diffusion v2_. The model should not be used to intentionally create or disseminate images that create hostile or alienating environments for people. This includes generating images that people would foreseeably find disturbing, distressing, or offensive; or content that propagates historical or current stereotypes. #### Out-of-Scope Use The model was not trained to be factual or true representations of people or events, and therefore using the model to generate such content is out-of-scope for the abilities of this model. #### Misuse and Malicious Use Using the model to generate content that is cruel to individuals is a misuse of this model. This includes, but is not limited to: - Generating demeaning, dehumanizing, or otherwise harmful representations of people or their environments, cultures, religions, etc. - Intentionally promoting or propagating discriminatory content or harmful stereotypes. - Impersonating individuals without their consent. - Sexual content without consent of the people who might see it. - Mis- and disinformation - Representations of egregious violence and gore - Sharing of copyrighted or licensed material in violation of its terms of use. - Sharing content that is an alteration of copyrighted or licensed material in violation of its terms of use. ## Limitations and Bias ### Limitations - The model does not achieve perfect photorealism - The model cannot render legible text - The model does not perform well on more difficult tasks which involve compositionality, such as rendering an image corresponding to “A red cube on top of a blue sphere” - Faces and people in general may not be generated properly. - The model was trained mainly with English captions and will not work as well in other languages. - The autoencoding part of the model is lossy - The model was trained on a subset of the large-scale dataset [LAION-5B](https://laion.ai/blog/laion-5b/), which contains adult, violent and sexual content. To partially mitigate this, we have filtered the dataset using LAION's NFSW detector (see Training section). ### Bias While the capabilities of image generation models are impressive, they can also reinforce or exacerbate social biases. Stable Diffusion vw was primarily trained on subsets of [LAION-2B(en)](https://laion.ai/blog/laion-5b/), which consists of images that are limited to English descriptions. Texts and images from communities and cultures that use other languages are likely to be insufficiently accounted for. This affects the overall output of the model, as white and western cultures are often set as the default. Further, the ability of the model to generate content with non-English prompts is significantly worse than with English-language prompts. Stable Diffusion v2 mirrors and exacerbates biases to such a degree that viewer discretion must be advised irrespective of the input or its intent. ## Training **Training Data** The model developers used the following dataset for training the model: - LAION-5B and subsets (details below). The training data is further filtered using LAION's NSFW detector, with a "p_unsafe" score of 0.1 (conservative). For more details, please refer to LAION-5B's [NeurIPS 2022](https://openreview.net/forum?id=M3Y74vmsMcY) paper and reviewer discussions on the topic. **Training Procedure** Stable Diffusion v2 is a latent diffusion model which combines an autoencoder with a diffusion model that is trained in the latent space of the autoencoder. During training, - Images are encoded through an encoder, which turns images into latent representations. The autoencoder uses a relative downsampling factor of 8 and maps images of shape H x W x 3 to latents of shape H/f x W/f x 4 - Text prompts are encoded through the OpenCLIP-ViT/H text-encoder. - The output of the text encoder is fed into the UNet backbone of the latent diffusion model via cross-attention. - The loss is a reconstruction objective between the noise that was added to the latent and the prediction made by the UNet. We also use the so-called _v-objective_, see https://arxiv.org/abs/2202.00512. We currently provide the following checkpoints, for various versions: ### Version 2.1 - `512-base-ema.ckpt`: Fine-tuned on `512-base-ema.ckpt` 2.0 with 220k extra steps taken, with `punsafe=0.98` on the same dataset. - `768-v-ema.ckpt`: Resumed from `768-v-ema.ckpt` 2.0 with an additional 55k steps on the same dataset (`punsafe=0.1`), and then fine-tuned for another 155k extra steps with `punsafe=0.98`. ### Version 2.0 - `512-base-ema.ckpt`: 550k steps at resolution `256x256` on a subset of [LAION-5B](https://laion.ai/blog/laion-5b/) filtered for explicit pornographic material, using the [LAION-NSFW classifier](https://github.com/LAION-AI/CLIP-based-NSFW-Detector) with `punsafe=0.1` and an [aesthetic score](https://github.com/christophschuhmann/improved-aesthetic-predictor) >= `4.5`. 850k steps at resolution `512x512` on the same dataset with resolution `>= 512x512`. - `768-v-ema.ckpt`: Resumed from `512-base-ema.ckpt` and trained for 150k steps using a [v-objective](https://arxiv.org/abs/2202.00512) on the same dataset. Resumed for another 140k steps on a `768x768` subset of our dataset. - `512-depth-ema.ckpt`: Resumed from `512-base-ema.ckpt` and finetuned for 200k steps. Added an extra input channel to process the (relative) depth prediction produced by [MiDaS](https://github.com/isl-org/MiDaS) (`dpt_hybrid`) which is used as an additional conditioning. The additional input channels of the U-Net which process this extra information were zero-initialized. - `512-inpainting-ema.ckpt`: Resumed from `512-base-ema.ckpt` and trained for another 200k steps. Follows the mask-generation strategy presented in [LAMA](https://github.com/saic-mdal/lama) which, in combination with the latent VAE representations of the masked image, are used as an additional conditioning. The additional input channels of the U-Net which process this extra information were zero-initialized. The same strategy was used to train the [1.5-inpainting checkpoint](https://github.com/saic-mdal/lama). - `x4-upscaling-ema.ckpt`: Trained for 1.25M steps on a 10M subset of LAION containing images `>2048x2048`. The model was trained on crops of size `512x512` and is a text-guided [latent upscaling diffusion model](https://arxiv.org/abs/2112.10752). In addition to the textual input, it receives a `noise_level` as an input parameter, which can be used to add noise to the low-resolution input according to a [predefined diffusion schedule](configs/stable-diffusion/x4-upscaling.yaml). - **Hardware:** 32 x 8 x A100 GPUs - **Optimizer:** AdamW - **Gradient Accumulations**: 1 - **Batch:** 32 x 8 x 2 x 4 = 2048 - **Learning rate:** warmup to 0.0001 for 10,000 steps and then kept constant ## Evaluation Results Evaluations with different classifier-free guidance scales (1.5, 2.0, 3.0, 4.0, 5.0, 6.0, 7.0, 8.0) and 50 steps DDIM sampling steps show the relative improvements of the checkpoints:  Evaluated using 50 DDIM steps and 10000 random prompts from the COCO2017 validation set, evaluated at 512x512 resolution. Not optimized for FID scores. ## Environmental Impact **Stable Diffusion v1** **Estimated Emissions** Based on that information, we estimate the following CO2 emissions using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). The hardware, runtime, cloud provider, and compute region were utilized to estimate the carbon impact. - **Hardware Type:** A100 PCIe 40GB - **Hours used:** 200000 - **Cloud Provider:** AWS - **Compute Region:** US-east - **Carbon Emitted (Power consumption x Time x Carbon produced based on location of power grid):** 15000 kg CO2 eq. ## Citation @InProceedings{Rombach_2022_CVPR, author = {Rombach, Robin and Blattmann, Andreas and Lorenz, Dominik and Esser, Patrick and Ommer, Bj\"orn}, title = {High-Resolution Image Synthesis With Latent Diffusion Models}, booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition (CVPR)}, month = {June}, year = {2022}, pages = {10684-10695} } *This model card was written by: Robin Rombach, Patrick Esser and David Ha and is based on the [Stable Diffusion v1](https://github.com/CompVis/stable-diffusion/blob/main/Stable_Diffusion_v1_Model_Card.md) and [DALL-E Mini model card](https://huggingface.co/dalle-mini/dalle-mini).*

distilbert/distilbert-base-multilingual-cased

distilbert

transformers

fill-mask

--- language: - multilingual - af - sq - ar - an - hy - ast - az - ba - eu - bar - be - bn - inc - bs - br - bg - my - ca - ceb - ce - zh - cv - hr - cs - da - nl - en - et - fi - fr - gl - ka - de - el - gu - ht - he - hi - hu - is - io - id - ga - it - ja - jv - kn - kk - ky - ko - la - lv - lt - roa - nds - lm - mk - mg - ms - ml - mr - mn - min - ne - new - nb - nn - oc - fa - pms - pl - pt - pa - ro - ru - sco - sr - hr - scn - sk - sl - aze - es - su - sw - sv - tl - tg - th - ta - tt - te - tr - uk - ud - uz - vi - vo - war - cy - fry - pnb - yo license: apache-2.0 datasets: - wikipedia --- # Model Card for DistilBERT base multilingual (cased) # Table of Contents 1. [Model Details](#model-details) 2. [Uses](#uses) 3. [Bias, Risks, and Limitations](#bias-risks-and-limitations) 4. [Training Details](#training-details) 5. [Evaluation](#evaluation) 6. [Environmental Impact](#environmental-impact) 7. [Citation](#citation) 8. [How To Get Started With the Model](#how-to-get-started-with-the-model) # Model Details ## Model Description This model is a distilled version of the [BERT base multilingual model](https://huggingface.co/bert-base-multilingual-cased/). The code for the distillation process can be found [here](https://github.com/huggingface/transformers/tree/main/examples/research_projects/distillation). This model is cased: it does make a difference between english and English. The model is trained on the concatenation of Wikipedia in 104 different languages listed [here](https://github.com/google-research/bert/blob/master/multilingual.md#list-of-languages). The model has 6 layers, 768 dimension and 12 heads, totalizing 134M parameters (compared to 177M parameters for mBERT-base). On average, this model, referred to as DistilmBERT, is twice as fast as mBERT-base. We encourage potential users of this model to check out the [BERT base multilingual model card](https://huggingface.co/bert-base-multilingual-cased) to learn more about usage, limitations and potential biases. - **Developed by:** Victor Sanh, Lysandre Debut, Julien Chaumond, Thomas Wolf (Hugging Face) - **Model type:** Transformer-based language model - **Language(s) (NLP):** 104 languages; see full list [here](https://github.com/google-research/bert/blob/master/multilingual.md#list-of-languages) - **License:** Apache 2.0 - **Related Models:** [BERT base multilingual model](https://huggingface.co/bert-base-multilingual-cased) - **Resources for more information:** - [GitHub Repository](https://github.com/huggingface/transformers/blob/main/examples/research_projects/distillation/README.md) - [Associated Paper](https://arxiv.org/abs/1910.01108) # Uses ## Direct Use and Downstream Use You can use the raw model for either masked language modeling or next sentence prediction, but it's mostly intended to be fine-tuned on a downstream task. See the [model hub](https://huggingface.co/models?filter=bert) to look for fine-tuned versions on a task that interests you. Note that this model is primarily aimed at being fine-tuned on tasks that use the whole sentence (potentially masked) to make decisions, such as sequence classification, token classification or question answering. For tasks such as text generation you should look at model like GPT2. ## Out of Scope Use The model should not be used to intentionally create hostile or alienating environments for people. The model was not trained to be factual or true representations of people or events, and therefore using the models to generate such content is out-of-scope for the abilities of this model. # Bias, Risks, and Limitations Significant research has explored bias and fairness issues with language models (see, e.g., [Sheng et al. (2021)](https://aclanthology.org/2021.acl-long.330.pdf) and [Bender et al. (2021)](https://dl.acm.org/doi/pdf/10.1145/3442188.3445922)). Predictions generated by the model may include disturbing and harmful stereotypes across protected classes; identity characteristics; and sensitive, social, and occupational groups. ## Recommendations Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. # Training Details - The model was pretrained with the supervision of [bert-base-multilingual-cased](https://huggingface.co/bert-base-multilingual-cased) on the concatenation of Wikipedia in 104 different languages - The model has 6 layers, 768 dimension and 12 heads, totalizing 134M parameters. - Further information about the training procedure and data is included in the [bert-base-multilingual-cased](https://huggingface.co/bert-base-multilingual-cased) model card. # Evaluation The model developers report the following accuracy results for DistilmBERT (see [GitHub Repo](https://github.com/huggingface/transformers/blob/main/examples/research_projects/distillation/README.md)): > Here are the results on the test sets for 6 of the languages available in XNLI. The results are computed in the zero shot setting (trained on the English portion and evaluated on the target language portion): | Model | English | Spanish | Chinese | German | Arabic | Urdu | | :---: | :---: | :---: | :---: | :---: | :---: | :---:| | mBERT base cased (computed) | 82.1 | 74.6 | 69.1 | 72.3 | 66.4 | 58.5 | | mBERT base uncased (reported)| 81.4 | 74.3 | 63.8 | 70.5 | 62.1 | 58.3 | | DistilmBERT | 78.2 | 69.1 | 64.0 | 66.3 | 59.1 | 54.7 | # Environmental Impact Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). - **Hardware Type:** More information needed - **Hours used:** More information needed - **Cloud Provider:** More information needed - **Compute Region:** More information needed - **Carbon Emitted:** More information needed # Citation ```bibtex @article{Sanh2019DistilBERTAD, title={DistilBERT, a distilled version of BERT: smaller, faster, cheaper and lighter}, author={Victor Sanh and Lysandre Debut and Julien Chaumond and Thomas Wolf}, journal={ArXiv}, year={2019}, volume={abs/1910.01108} } ``` APA - Sanh, V., Debut, L., Chaumond, J., & Wolf, T. (2019). DistilBERT, a distilled version of BERT: smaller, faster, cheaper and lighter. arXiv preprint arXiv:1910.01108. # How to Get Started With the Model You can use the model directly with a pipeline for masked language modeling: ```python >>> from transformers import pipeline >>> unmasker = pipeline('fill-mask', model='distilbert-base-multilingual-cased') >>> unmasker("Hello I'm a [MASK] model.") [{'score': 0.040800247341394424, 'sequence': "Hello I'm a virtual model.", 'token': 37859, 'token_str': 'virtual'}, {'score': 0.020015988498926163, 'sequence': "Hello I'm a big model.", 'token': 22185, 'token_str': 'big'}, {'score': 0.018680453300476074, 'sequence': "Hello I'm a Hello model.", 'token': 31178, 'token_str': 'Hello'}, {'score': 0.017396586015820503, 'sequence': "Hello I'm a model model.", 'token': 13192, 'token_str': 'model'}, {'score': 0.014229810796678066, 'sequence': "Hello I'm a perfect model.", 'token': 43477, 'token_str': 'perfect'}] ```

mistralai/Mistral-7B-Instruct-v0.2

mistralai

transformers

text-generation

--- license: apache-2.0 tags: - finetuned pipeline_tag: text-generation inference: true widget: - messages: - role: user content: What is your favorite condiment? extra_gated_description: If you want to learn more about how we process your personal data, please read our <a href="https://mistral.ai/terms/">Privacy Policy</a>. --- # Model Card for Mistral-7B-Instruct-v0.2 ## Encode and Decode with `mistral_common` ```py from mistral_common.tokens.tokenizers.mistral import MistralTokenizer from mistral_common.protocol.instruct.messages import UserMessage from mistral_common.protocol.instruct.request import ChatCompletionRequest mistral_models_path = "MISTRAL_MODELS_PATH" tokenizer = MistralTokenizer.v1() completion_request = ChatCompletionRequest(messages=[UserMessage(content="Explain Machine Learning to me in a nutshell.")]) tokens = tokenizer.encode_chat_completion(completion_request).tokens ``` ## Inference with `mistral_inference` ```py from mistral_inference.transformer import Transformer from mistral_inference.generate import generate model = Transformer.from_folder(mistral_models_path) out_tokens, _ = generate([tokens], model, max_tokens=64, temperature=0.0, eos_id=tokenizer.instruct_tokenizer.tokenizer.eos_id) result = tokenizer.decode(out_tokens[0]) print(result) ``` ## Inference with hugging face `transformers` ```py from transformers import AutoModelForCausalLM model = AutoModelForCausalLM.from_pretrained("mistralai/Mistral-7B-Instruct-v0.2") model.to("cuda") generated_ids = model.generate(tokens, max_new_tokens=1000, do_sample=True) # decode with mistral tokenizer result = tokenizer.decode(generated_ids[0].tolist()) print(result) ``` > [!TIP] > PRs to correct the `transformers` tokenizer so that it gives 1-to-1 the same results as the `mistral_common` reference implementation are very welcome! --- The Mistral-7B-Instruct-v0.2 Large Language Model (LLM) is an instruct fine-tuned version of the Mistral-7B-v0.2. Mistral-7B-v0.2 has the following changes compared to Mistral-7B-v0.1 - 32k context window (vs 8k context in v0.1) - Rope-theta = 1e6 - No Sliding-Window Attention For full details of this model please read our [paper](https://arxiv.org/abs/2310.06825) and [release blog post](https://mistral.ai/news/la-plateforme/). ## Instruction format In order to leverage instruction fine-tuning, your prompt should be surrounded by `[INST]` and `[/INST]` tokens. The very first instruction should begin with a begin of sentence id. The next instructions should not. The assistant generation will be ended by the end-of-sentence token id. E.g. ``` text = "<s>[INST] What is your favourite condiment? [/INST]" "Well, I'm quite partial to a good squeeze of fresh lemon juice. It adds just the right amount of zesty flavour to whatever I'm cooking up in the kitchen!</s> " "[INST] Do you have mayonnaise recipes? [/INST]" ``` This format is available as a [chat template](https://huggingface.co/docs/transformers/main/chat_templating) via the `apply_chat_template()` method: ```python from transformers import AutoModelForCausalLM, AutoTokenizer device = "cuda" # the device to load the model onto model = AutoModelForCausalLM.from_pretrained("mistralai/Mistral-7B-Instruct-v0.2") tokenizer = AutoTokenizer.from_pretrained("mistralai/Mistral-7B-Instruct-v0.2") messages = [ {"role": "user", "content": "What is your favourite condiment?"}, {"role": "assistant", "content": "Well, I'm quite partial to a good squeeze of fresh lemon juice. It adds just the right amount of zesty flavour to whatever I'm cooking up in the kitchen!"}, {"role": "user", "content": "Do you have mayonnaise recipes?"} ] encodeds = tokenizer.apply_chat_template(messages, return_tensors="pt") model_inputs = encodeds.to(device) model.to(device) generated_ids = model.generate(model_inputs, max_new_tokens=1000, do_sample=True) decoded = tokenizer.batch_decode(generated_ids) print(decoded[0]) ``` ## Troubleshooting - If you see the following error: ``` Traceback (most recent call last): File "", line 1, in File "/transformers/models/auto/auto_factory.py", line 482, in from_pretrained config, kwargs = AutoConfig.from_pretrained( File "/transformers/models/auto/configuration_auto.py", line 1022, in from_pretrained config_class = CONFIG_MAPPING[config_dict["model_type"]] File "/transformers/models/auto/configuration_auto.py", line 723, in getitem raise KeyError(key) KeyError: 'mistral' ``` Installing transformers from source should solve the issue pip install git+https://github.com/huggingface/transformers This should not be required after transformers-v4.33.4. ## Limitations The Mistral 7B Instruct model is a quick demonstration that the base model can be easily fine-tuned to achieve compelling performance. It does not have any moderation mechanisms. We're looking forward to engaging with the community on ways to make the model finely respect guardrails, allowing for deployment in environments requiring moderated outputs. ## The Mistral AI Team Albert Jiang, Alexandre Sablayrolles, Arthur Mensch, Blanche Savary, Chris Bamford, Devendra Singh Chaplot, Diego de las Casas, Emma Bou Hanna, Florian Bressand, Gianna Lengyel, Guillaume Bour, Guillaume Lample, Lélio Renard Lavaud, Louis Ternon, Lucile Saulnier, Marie-Anne Lachaux, Pierre Stock, Teven Le Scao, Théophile Gervet, Thibaut Lavril, Thomas Wang, Timothée Lacroix, William El Sayed.

dbmdz/bert-large-cased-finetuned-conll03-english

dbmdz

transformers

token-classification

Entry not found

prithivida/parrot_paraphraser_on_T5

prithivida

transformers

text2text-generation

# Parrot ## 1. What is Parrot? Parrot is a paraphrase based utterance augmentation framework purpose built to accelerate training NLU models. A paraphrase framework is more than just a paraphrasing model. For more details on the library and usage please refer to the [github page](https://github.com/PrithivirajDamodaran/Parrot) ### Installation ```python pip install git+https://github.com/PrithivirajDamodaran/Parrot_Paraphraser.git ``` ### Quickstart ```python from parrot import Parrot import torch import warnings warnings.filterwarnings("ignore") ''' uncomment to get reproducable paraphrase generations def random_state(seed): torch.manual_seed(seed) if torch.cuda.is_available(): torch.cuda.manual_seed_all(seed) random_state(1234) ''' #Init models (make sure you init ONLY once if you integrate this to your code) parrot = Parrot(model_tag="prithivida/parrot_paraphraser_on_T5", use_gpu=False) phrases = ["Can you recommed some upscale restaurants in Newyork?", "What are the famous places we should not miss in Russia?" ] for phrase in phrases: print("-"*100) print("Input_phrase: ", phrase) print("-"*100) para_phrases = parrot.augment(input_phrase=phrase) for para_phrase in para_phrases: print(para_phrase) ``` ``` ---------------------------------------------------------------------- Input_phrase: Can you recommed some upscale restaurants in Newyork? ---------------------------------------------------------------------- list some excellent restaurants to visit in new york city? what upscale restaurants do you recommend in new york? i want to try some upscale restaurants in new york? recommend some upscale restaurants in newyork? can you recommend some high end restaurants in newyork? can you recommend some upscale restaurants in new york? can you recommend some upscale restaurants in newyork? ---------------------------------------------------------------------- Input_phrase: What are the famous places we should not miss in Russia ---------------------------------------------------------------------- what should we not miss when visiting russia? recommend some of the best places to visit in russia? list some of the best places to visit in russia? can you list the top places to visit in russia? show the places that we should not miss in russia? list some famous places which we should not miss in russia? ``` ### Knobs ```python para_phrases = parrot.augment(input_phrase=phrase, diversity_ranker="levenshtein", do_diverse=False, max_return_phrases = 10, max_length=32, adequacy_threshold = 0.99, fluency_threshold = 0.90) ``` ## 2. Why Parrot? **Huggingface** lists [12 paraphrase models,](https://huggingface.co/models?pipeline_tag=text2text-generation&search=paraphrase) **RapidAPI** lists 7 fremium and commercial paraphrasers like [QuillBot](https://rapidapi.com/search/paraphrase?section=apis&page=1), Rasa has discussed an experimental paraphraser for augmenting text data [here](https://forum.rasa.com/t/paraphrasing-for-nlu-data-augmentation-experimental/27744), Sentence-transfomers offers a [paraphrase mining utility](https://www.sbert.net/examples/applications/paraphrase-mining/README.html) and [NLPAug](https://github.com/makcedward/nlpaug) offers word level augmentation with a [PPDB](http://paraphrase.org/#/download) (a multi-million paraphrase database). While these attempts at paraphrasing are great, there are still some gaps and paraphrasing is NOT yet a mainstream option for text augmentation in building NLU models....Parrot is a humble attempt to fill some of these gaps. **What is a good paraphrase?** Almost all conditioned text generation models are validated on 2 factors, (1) if the generated text conveys the same meaning as the original context (Adequacy) (2) if the text is fluent / grammatically correct english (Fluency). For instance Neural Machine Translation outputs are tested for Adequacy and Fluency. But [a good paraphrase](https://www.aclweb.org/anthology/D10-1090.pdf) should be adequate and fluent while being as different as possible on the surface lexical form. With respect to this definition, the **3 key metrics** that measures the quality of paraphrases are: - **Adequacy** (Is the meaning preserved adequately?) - **Fluency** (Is the paraphrase fluent English?) - **Diversity (Lexical / Phrasal / Syntactical)** (How much has the paraphrase changed the original sentence?) *Parrot offers knobs to control Adequacy, Fluency and Diversity as per your needs.* **What makes a paraphraser a good augmentor?** For training a NLU model we just don't need a lot of utterances but utterances with intents and slots/entities annotated. Typical flow would be: - Given an **input utterance + input annotations** a good augmentor spits out N **output paraphrases** while preserving the intent and slots. - The output paraphrases are then converted into annotated data using the input annotations that we got in step 1. - The annotated data created out of the output paraphrases then makes the training dataset for your NLU model. But in general being a generative model paraphrasers doesn't guarantee to preserve the slots/entities. So the ability to generate high quality paraphrases in a constrained fashion without trading off the intents and slots for lexical dissimilarity makes a paraphraser a good augmentor. *More on this in section 3 below* ## 3. Scope In the space of conversational engines, knowledge bots are to which **we ask questions** like *"when was the Berlin wall teared down?"*, transactional bots are to which **we give commands** like *"Turn on the music please"* and voice assistants are the ones which can do both answer questions and action our commands. Parrot mainly foucses on augmenting texts typed-into or spoken-to conversational interfaces for building robust NLU models. (*So usually people neither type out or yell out long paragraphs to conversational interfaces. Hence the pre-trained model is trained on text samples of maximum length of 32.*) *While Parrot predominantly aims to be a text augmentor for building good NLU models, it can also be used as a pure-play paraphraser.*

BAAI/bge-large-zh-v1.5

BAAI

sentence-transformers

feature-extraction

--- license: mit language: - zh tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers --- <h1 align="center">FlagEmbedding</h1> <h4 align="center"> <p> <a href=#model-list>Model List</a> | <a href=#frequently-asked-questions>FAQ</a> | <a href=#usage>Usage</a> | <a href="#evaluation">Evaluation</a> | <a href="#train">Train</a> | <a href="#contact">Contact</a> | <a href="#citation">Citation</a> | <a href="#license">License</a> <p> </h4> For more details please refer to our Github: [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding). If you are looking for a model that supports more languages, longer texts, and other retrieval methods, you can try using [bge-m3](https://huggingface.co/BAAI/bge-m3). [English](README.md) | [中文](https://github.com/FlagOpen/FlagEmbedding/blob/master/README_zh.md) FlagEmbedding focuses on retrieval-augmented LLMs, consisting of the following projects currently: - **Long-Context LLM**: [Activation Beacon](https://github.com/FlagOpen/FlagEmbedding/tree/master/Long_LLM/activation_beacon) - **Fine-tuning of LM** : [LM-Cocktail](https://github.com/FlagOpen/FlagEmbedding/tree/master/LM_Cocktail) - **Dense Retrieval**: [BGE-M3](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3), [LLM Embedder](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder), [BGE Embedding](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/baai_general_embedding) - **Reranker Model**: [BGE Reranker](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker) - **Benchmark**: [C-MTEB](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB) ## News - 1/30/2024: Release **BGE-M3**, a new member to BGE model series! M3 stands for **M**ulti-linguality (100+ languages), **M**ulti-granularities (input length up to 8192), **M**ulti-Functionality (unification of dense, lexical, multi-vec/colbert retrieval). It is the first embedding model which supports all three retrieval methods, achieving new SOTA on multi-lingual (MIRACL) and cross-lingual (MKQA) benchmarks. [Technical Report](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/BGE_M3/BGE_M3.pdf) and [Code](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3). :fire: - 1/9/2024: Release [Activation-Beacon](https://github.com/FlagOpen/FlagEmbedding/tree/master/Long_LLM/activation_beacon), an effective, efficient, compatible, and low-cost (training) method to extend the context length of LLM. [Technical Report](https://arxiv.org/abs/2401.03462) :fire: - 12/24/2023: Release **LLaRA**, a LLaMA-7B based dense retriever, leading to state-of-the-art performances on MS MARCO and BEIR. Model and code will be open-sourced. Please stay tuned. [Technical Report](https://arxiv.org/abs/2312.15503) :fire: - 11/23/2023: Release [LM-Cocktail](https://github.com/FlagOpen/FlagEmbedding/tree/master/LM_Cocktail), a method to maintain general capabilities during fine-tuning by merging multiple language models. [Technical Report](https://arxiv.org/abs/2311.13534) :fire: - 10/12/2023: Release [LLM-Embedder](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder), a unified embedding model to support diverse retrieval augmentation needs for LLMs. [Technical Report](https://arxiv.org/pdf/2310.07554.pdf) - 09/15/2023: The [technical report](https://arxiv.org/pdf/2309.07597.pdf) and [massive training data](https://data.baai.ac.cn/details/BAAI-MTP) of BGE has been released - 09/12/2023: New models: - **New reranker model**: release cross-encoder models `BAAI/bge-reranker-base` and `BAAI/bge-reranker-large`, which are more powerful than embedding model. We recommend to use/fine-tune them to re-rank top-k documents returned by embedding models. - **update embedding model**: release `bge-*-v1.5` embedding model to alleviate the issue of the similarity distribution, and enhance its retrieval ability without instruction. <details> <summary>More</summary> <!-- ### More --> - 09/07/2023: Update [fine-tune code](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md): Add script to mine hard negatives and support adding instruction during fine-tuning. - 08/09/2023: BGE Models are integrated into **Langchain**, you can use it like [this](#using-langchain); C-MTEB **leaderboard** is [available](https://huggingface.co/spaces/mteb/leaderboard). - 08/05/2023: Release base-scale and small-scale models, **best performance among the models of the same size 🤗** - 08/02/2023: Release `bge-large-*`(short for BAAI General Embedding) Models, **rank 1st on MTEB and C-MTEB benchmark!** :tada: :tada: - 08/01/2023: We release the [Chinese Massive Text Embedding Benchmark](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB) (**C-MTEB**), consisting of 31 test dataset. </details> ## Model List `bge` is short for `BAAI general embedding`. | Model | Language | | Description | query instruction for retrieval [1] | |:-------------------------------|:--------:| :--------:| :--------:|:--------:| | [BAAI/bge-m3](https://huggingface.co/BAAI/bge-m3) | Multilingual | [Inference](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3#usage) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3) | Multi-Functionality(dense retrieval, sparse retrieval, multi-vector(colbert)), Multi-Linguality, and Multi-Granularity(8192 tokens) | | | [BAAI/llm-embedder](https://huggingface.co/BAAI/llm-embedder) | English | [Inference](./FlagEmbedding/llm_embedder/README.md) [Fine-tune](./FlagEmbedding/llm_embedder/README.md) | a unified embedding model to support diverse retrieval augmentation needs for LLMs | See [README](./FlagEmbedding/llm_embedder/README.md) | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh-v1.5](https://huggingface.co/BAAI/bge-large-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-large-en](https://huggingface.co/BAAI/bge-large-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [MTEB](https://huggingface.co/spaces/mteb/leaderboard) leaderboard | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en](https://huggingface.co/BAAI/bge-base-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-en` | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en](https://huggingface.co/BAAI/bge-small-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) |a small-scale model but with competitive performance | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [C-MTEB](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB) benchmark | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-zh` | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a small-scale model but with competitive performance | `为这个句子生成表示以用于检索相关文章：` | [1\]: If you need to search the relevant passages to a query, we suggest to add the instruction to the query; in other cases, no instruction is needed, just use the original query directly. In all cases, **no instruction** needs to be added to passages. [2\]: Different from embedding model, reranker uses question and document as input and directly output similarity instead of embedding. To balance the accuracy and time cost, cross-encoder is widely used to re-rank top-k documents retrieved by other simple models. For examples, use bge embedding model to retrieve top 100 relevant documents, and then use bge reranker to re-rank the top 100 document to get the final top-3 results. All models have been uploaded to Huggingface Hub, and you can see them at https://huggingface.co/BAAI. If you cannot open the Huggingface Hub, you also can download the models at https://model.baai.ac.cn/models . ## Frequently asked questions <details> <summary>1. How to fine-tune bge embedding model?</summary> <!-- ### How to fine-tune bge embedding model? --> Following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) to prepare data and fine-tune your model. Some suggestions: - Mine hard negatives following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune#hard-negatives), which can improve the retrieval performance. - If you pre-train bge on your data, the pre-trained model cannot be directly used to calculate similarity, and it must be fine-tuned with contrastive learning before computing similarity. - If the accuracy of the fine-tuned model is still not high, it is recommended to use/fine-tune the cross-encoder model (bge-reranker) to re-rank top-k results. Hard negatives also are needed to fine-tune reranker. </details> <details> <summary>2. The similarity score between two dissimilar sentences is higher than 0.5</summary> <!-- ### The similarity score between two dissimilar sentences is higher than 0.5 --> **Suggest to use bge v1.5, which alleviates the issue of the similarity distribution.** Since we finetune the models by contrastive learning with a temperature of 0.01, the similarity distribution of the current BGE model is about in the interval \[0.6, 1\]. So a similarity score greater than 0.5 does not indicate that the two sentences are similar. For downstream tasks, such as passage retrieval or semantic similarity, **what matters is the relative order of the scores, not the absolute value.** If you need to filter similar sentences based on a similarity threshold, please select an appropriate similarity threshold based on the similarity distribution on your data (such as 0.8, 0.85, or even 0.9). </details> <details> <summary>3. When does the query instruction need to be used</summary> <!-- ### When does the query instruction need to be used --> For the `bge-*-v1.5`, we improve its retrieval ability when not using instruction. No instruction only has a slight degradation in retrieval performance compared with using instruction. So you can generate embedding without instruction in all cases for convenience. For a retrieval task that uses short queries to find long related documents, it is recommended to add instructions for these short queries. **The best method to decide whether to add instructions for queries is choosing the setting that achieves better performance on your task.** In all cases, the documents/passages do not need to add the instruction. </details> ## Usage ### Usage for Embedding Model Here are some examples for using `bge` models with [FlagEmbedding](#using-flagembedding), [Sentence-Transformers](#using-sentence-transformers), [Langchain](#using-langchain), or [Huggingface Transformers](#using-huggingface-transformers). #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` If it doesn't work for you, you can see [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md) for more methods to install FlagEmbedding. ```python from FlagEmbedding import FlagModel sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = FlagModel('BAAI/bge-large-zh-v1.5', query_instruction_for_retrieval="为这个句子生成表示以用于检索相关文章：", use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation embeddings_1 = model.encode(sentences_1) embeddings_2 = model.encode(sentences_2) similarity = embeddings_1 @ embeddings_2.T print(similarity) # for s2p(short query to long passage) retrieval task, suggest to use encode_queries() which will automatically add the instruction to each query # corpus in retrieval task can still use encode() or encode_corpus(), since they don't need instruction queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] q_embeddings = model.encode_queries(queries) p_embeddings = model.encode(passages) scores = q_embeddings @ p_embeddings.T ``` For the value of the argument `query_instruction_for_retrieval`, see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list). By default, FlagModel will use all available GPUs when encoding. Please set `os.environ["CUDA_VISIBLE_DEVICES"]` to select specific GPUs. You also can set `os.environ["CUDA_VISIBLE_DEVICES"]=""` to make all GPUs unavailable. #### Using Sentence-Transformers You can also use the `bge` models with [sentence-transformers](https://www.SBERT.net): ``` pip install -U sentence-transformers ``` ```python from sentence_transformers import SentenceTransformer sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = SentenceTransformer('BAAI/bge-large-zh-v1.5') embeddings_1 = model.encode(sentences_1, normalize_embeddings=True) embeddings_2 = model.encode(sentences_2, normalize_embeddings=True) similarity = embeddings_1 @ embeddings_2.T print(similarity) ``` For s2p(short query to long passage) retrieval task, each short query should start with an instruction (instructions see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list)). But the instruction is not needed for passages. ```python from sentence_transformers import SentenceTransformer queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] instruction = "为这个句子生成表示以用于检索相关文章：" model = SentenceTransformer('BAAI/bge-large-zh-v1.5') q_embeddings = model.encode([instruction+q for q in queries], normalize_embeddings=True) p_embeddings = model.encode(passages, normalize_embeddings=True) scores = q_embeddings @ p_embeddings.T ``` #### Using Langchain You can use `bge` in langchain like this: ```python from langchain.embeddings import HuggingFaceBgeEmbeddings model_name = "BAAI/bge-large-en-v1.5" model_kwargs = {'device': 'cuda'} encode_kwargs = {'normalize_embeddings': True} # set True to compute cosine similarity model = HuggingFaceBgeEmbeddings( model_name=model_name, model_kwargs=model_kwargs, encode_kwargs=encode_kwargs, query_instruction="为这个句子生成表示以用于检索相关文章：" ) model.query_instruction = "为这个句子生成表示以用于检索相关文章：" ``` #### Using HuggingFace Transformers With the transformers package, you can use the model like this: First, you pass your input through the transformer model, then you select the last hidden state of the first token (i.e., [CLS]) as the sentence embedding. ```python from transformers import AutoTokenizer, AutoModel import torch # Sentences we want sentence embeddings for sentences = ["样例数据-1", "样例数据-2"] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-large-zh-v1.5') model = AutoModel.from_pretrained('BAAI/bge-large-zh-v1.5') model.eval() # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # for s2p(short query to long passage) retrieval task, add an instruction to query (not add instruction for passages) # encoded_input = tokenizer([instruction + q for q in queries], padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, cls pooling. sentence_embeddings = model_output[0][:, 0] # normalize embeddings sentence_embeddings = torch.nn.functional.normalize(sentence_embeddings, p=2, dim=1) print("Sentence embeddings:", sentence_embeddings) ``` ### Usage for Reranker Different from embedding model, reranker uses question and document as input and directly output similarity instead of embedding. You can get a relevance score by inputting query and passage to the reranker. The reranker is optimized based cross-entropy loss, so the relevance score is not bounded to a specific range. #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` Get relevance scores (higher scores indicate more relevance): ```python from FlagEmbedding import FlagReranker reranker = FlagReranker('BAAI/bge-reranker-large', use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation score = reranker.compute_score(['query', 'passage']) print(score) scores = reranker.compute_score([['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']]) print(scores) ``` #### Using Huggingface transformers ```python import torch from transformers import AutoModelForSequenceClassification, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-reranker-large') model = AutoModelForSequenceClassification.from_pretrained('BAAI/bge-reranker-large') model.eval() pairs = [['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']] with torch.no_grad(): inputs = tokenizer(pairs, padding=True, truncation=True, return_tensors='pt', max_length=512) scores = model(**inputs, return_dict=True).logits.view(-1, ).float() print(scores) ``` ## Evaluation `baai-general-embedding` models achieve **state-of-the-art performance on both MTEB and C-MTEB leaderboard!** For more details and evaluation tools see our [scripts](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md). - **MTEB**: | Model Name | Dimension | Sequence Length | Average (56) | Retrieval (15) |Clustering (11) | Pair Classification (3) | Reranking (4) | STS (10) | Summarization (1) | Classification (12) | |:----:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:| | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | 1024 | 512 | **64.23** | **54.29** | 46.08 | 87.12 | 60.03 | 83.11 | 31.61 | 75.97 | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | 768 | 512 | 63.55 | 53.25 | 45.77 | 86.55 | 58.86 | 82.4 | 31.07 | 75.53 | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | 384 | 512 | 62.17 |51.68 | 43.82 | 84.92 | 58.36 | 81.59 | 30.12 | 74.14 | | [bge-large-en](https://huggingface.co/BAAI/bge-large-en) | 1024 | 512 | 63.98 | 53.9 | 46.98 | 85.8 | 59.48 | 81.56 | 32.06 | 76.21 | | [bge-base-en](https://huggingface.co/BAAI/bge-base-en) | 768 | 512 | 63.36 | 53.0 | 46.32 | 85.86 | 58.7 | 81.84 | 29.27 | 75.27 | | [gte-large](https://huggingface.co/thenlper/gte-large) | 1024 | 512 | 63.13 | 52.22 | 46.84 | 85.00 | 59.13 | 83.35 | 31.66 | 73.33 | | [gte-base](https://huggingface.co/thenlper/gte-base) | 768 | 512 | 62.39 | 51.14 | 46.2 | 84.57 | 58.61 | 82.3 | 31.17 | 73.01 | | [e5-large-v2](https://huggingface.co/intfloat/e5-large-v2) | 1024| 512 | 62.25 | 50.56 | 44.49 | 86.03 | 56.61 | 82.05 | 30.19 | 75.24 | | [bge-small-en](https://huggingface.co/BAAI/bge-small-en) | 384 | 512 | 62.11 | 51.82 | 44.31 | 83.78 | 57.97 | 80.72 | 30.53 | 74.37 | | [instructor-xl](https://huggingface.co/hkunlp/instructor-xl) | 768 | 512 | 61.79 | 49.26 | 44.74 | 86.62 | 57.29 | 83.06 | 32.32 | 61.79 | | [e5-base-v2](https://huggingface.co/intfloat/e5-base-v2) | 768 | 512 | 61.5 | 50.29 | 43.80 | 85.73 | 55.91 | 81.05 | 30.28 | 73.84 | | [gte-small](https://huggingface.co/thenlper/gte-small) | 384 | 512 | 61.36 | 49.46 | 44.89 | 83.54 | 57.7 | 82.07 | 30.42 | 72.31 | | [text-embedding-ada-002](https://platform.openai.com/docs/guides/embeddings) | 1536 | 8192 | 60.99 | 49.25 | 45.9 | 84.89 | 56.32 | 80.97 | 30.8 | 70.93 | | [e5-small-v2](https://huggingface.co/intfloat/e5-base-v2) | 384 | 512 | 59.93 | 49.04 | 39.92 | 84.67 | 54.32 | 80.39 | 31.16 | 72.94 | | [sentence-t5-xxl](https://huggingface.co/sentence-transformers/sentence-t5-xxl) | 768 | 512 | 59.51 | 42.24 | 43.72 | 85.06 | 56.42 | 82.63 | 30.08 | 73.42 | | [all-mpnet-base-v2](https://huggingface.co/sentence-transformers/all-mpnet-base-v2) | 768 | 514 | 57.78 | 43.81 | 43.69 | 83.04 | 59.36 | 80.28 | 27.49 | 65.07 | | [sgpt-bloom-7b1-msmarco](https://huggingface.co/bigscience/sgpt-bloom-7b1-msmarco) | 4096 | 2048 | 57.59 | 48.22 | 38.93 | 81.9 | 55.65 | 77.74 | 33.6 | 66.19 | - **C-MTEB**: We create the benchmark C-MTEB for Chinese text embedding which consists of 31 datasets from 6 tasks. Please refer to [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md) for a detailed introduction. | Model | Embedding dimension | Avg | Retrieval | STS | PairClassification | Classification | Reranking | Clustering | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | [**BAAI/bge-large-zh-v1.5**](https://huggingface.co/BAAI/bge-large-zh-v1.5) | 1024 | **64.53** | 70.46 | 56.25 | 81.6 | 69.13 | 65.84 | 48.99 | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | 768 | 63.13 | 69.49 | 53.72 | 79.75 | 68.07 | 65.39 | 47.53 | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | 512 | 57.82 | 61.77 | 49.11 | 70.41 | 63.96 | 60.92 | 44.18 | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | 1024 | 64.20 | 71.53 | 54.98 | 78.94 | 68.32 | 65.11 | 48.39 | | [bge-large-zh-noinstruct](https://huggingface.co/BAAI/bge-large-zh-noinstruct) | 1024 | 63.53 | 70.55 | 53 | 76.77 | 68.58 | 64.91 | 50.01 | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | 768 | 62.96 | 69.53 | 54.12 | 77.5 | 67.07 | 64.91 | 47.63 | | [multilingual-e5-large](https://huggingface.co/intfloat/multilingual-e5-large) | 1024 | 58.79 | 63.66 | 48.44 | 69.89 | 67.34 | 56.00 | 48.23 | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | 512 | 58.27 | 63.07 | 49.45 | 70.35 | 63.64 | 61.48 | 45.09 | | [m3e-base](https://huggingface.co/moka-ai/m3e-base) | 768 | 57.10 | 56.91 | 50.47 | 63.99 | 67.52 | 59.34 | 47.68 | | [m3e-large](https://huggingface.co/moka-ai/m3e-large) | 1024 | 57.05 | 54.75 | 50.42 | 64.3 | 68.2 | 59.66 | 48.88 | | [multilingual-e5-base](https://huggingface.co/intfloat/multilingual-e5-base) | 768 | 55.48 | 61.63 | 46.49 | 67.07 | 65.35 | 54.35 | 40.68 | | [multilingual-e5-small](https://huggingface.co/intfloat/multilingual-e5-small) | 384 | 55.38 | 59.95 | 45.27 | 66.45 | 65.85 | 53.86 | 45.26 | | [text-embedding-ada-002(OpenAI)](https://platform.openai.com/docs/guides/embeddings/what-are-embeddings) | 1536 | 53.02 | 52.0 | 43.35 | 69.56 | 64.31 | 54.28 | 45.68 | | [luotuo](https://huggingface.co/silk-road/luotuo-bert-medium) | 1024 | 49.37 | 44.4 | 42.78 | 66.62 | 61 | 49.25 | 44.39 | | [text2vec-base](https://huggingface.co/shibing624/text2vec-base-chinese) | 768 | 47.63 | 38.79 | 43.41 | 67.41 | 62.19 | 49.45 | 37.66 | | [text2vec-large](https://huggingface.co/GanymedeNil/text2vec-large-chinese) | 1024 | 47.36 | 41.94 | 44.97 | 70.86 | 60.66 | 49.16 | 30.02 | - **Reranking**: See [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/) for evaluation script. | Model | T2Reranking | T2RerankingZh2En\* | T2RerankingEn2Zh\* | MMarcoReranking | CMedQAv1 | CMedQAv2 | Avg | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | text2vec-base-multilingual | 64.66 | 62.94 | 62.51 | 14.37 | 48.46 | 48.6 | 50.26 | | multilingual-e5-small | 65.62 | 60.94 | 56.41 | 29.91 | 67.26 | 66.54 | 57.78 | | multilingual-e5-large | 64.55 | 61.61 | 54.28 | 28.6 | 67.42 | 67.92 | 57.4 | | multilingual-e5-base | 64.21 | 62.13 | 54.68 | 29.5 | 66.23 | 66.98 | 57.29 | | m3e-base | 66.03 | 62.74 | 56.07 | 17.51 | 77.05 | 76.76 | 59.36 | | m3e-large | 66.13 | 62.72 | 56.1 | 16.46 | 77.76 | 78.27 | 59.57 | | bge-base-zh-v1.5 | 66.49 | 63.25 | 57.02 | 29.74 | 80.47 | 84.88 | 63.64 | | bge-large-zh-v1.5 | 65.74 | 63.39 | 57.03 | 28.74 | 83.45 | 85.44 | 63.97 | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | 67.28 | 63.95 | 60.45 | 35.46 | 81.26 | 84.1 | 65.42 | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | 67.6 | 64.03 | 61.44 | 37.16 | 82.15 | 84.18 | 66.09 | \* : T2RerankingZh2En and T2RerankingEn2Zh are cross-language retrieval tasks ## Train ### BAAI Embedding We pre-train the models using [retromae](https://github.com/staoxiao/RetroMAE) and train them on large-scale pairs data using contrastive learning. **You can fine-tune the embedding model on your data following our [examples](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune).** We also provide a [pre-train example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/pretrain). Note that the goal of pre-training is to reconstruct the text, and the pre-trained model cannot be used for similarity calculation directly, it needs to be fine-tuned. More training details for bge see [baai_general_embedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md). ### BGE Reranker Cross-encoder will perform full-attention over the input pair, which is more accurate than embedding model (i.e., bi-encoder) but more time-consuming than embedding model. Therefore, it can be used to re-rank the top-k documents returned by embedding model. We train the cross-encoder on a multilingual pair data, The data format is the same as embedding model, so you can fine-tune it easily following our [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker). More details please refer to [./FlagEmbedding/reranker/README.md](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker) ## Contact If you have any question or suggestion related to this project, feel free to open an issue or pull request. You also can email Shitao Xiao(stxiao@baai.ac.cn) and Zheng Liu(liuzheng@baai.ac.cn). ## Citation If you find this repository useful, please consider giving a star :star: and citation ``` @misc{bge_embedding, title={C-Pack: Packaged Resources To Advance General Chinese Embedding}, author={Shitao Xiao and Zheng Liu and Peitian Zhang and Niklas Muennighoff}, year={2023}, eprint={2309.07597}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` ## License FlagEmbedding is licensed under the [MIT License](https://github.com/FlagOpen/FlagEmbedding/blob/master/LICENSE). The released models can be used for commercial purposes free of charge.

textattack/bert-base-uncased-MNLI

textattack

transformers

text-classification

Entry not found

facebook/detr-resnet-50

facebook

transformers

object-detection

--- license: apache-2.0 tags: - object-detection - vision datasets: - coco widget: - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/savanna.jpg example_title: Savanna - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/football-match.jpg example_title: Football Match - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/airport.jpg example_title: Airport --- # DETR (End-to-End Object Detection) model with ResNet-50 backbone DEtection TRansformer (DETR) model trained end-to-end on COCO 2017 object detection (118k annotated images). It was introduced in the paper [End-to-End Object Detection with Transformers](https://arxiv.org/abs/2005.12872) by Carion et al. and first released in [this repository](https://github.com/facebookresearch/detr). Disclaimer: The team releasing DETR did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description The DETR model is an encoder-decoder transformer with a convolutional backbone. Two heads are added on top of the decoder outputs in order to perform object detection: a linear layer for the class labels and a MLP (multi-layer perceptron) for the bounding boxes. The model uses so-called object queries to detect objects in an image. Each object query looks for a particular object in the image. For COCO, the number of object queries is set to 100. The model is trained using a "bipartite matching loss": one compares the predicted classes + bounding boxes of each of the N = 100 object queries to the ground truth annotations, padded up to the same length N (so if an image only contains 4 objects, 96 annotations will just have a "no object" as class and "no bounding box" as bounding box). The Hungarian matching algorithm is used to create an optimal one-to-one mapping between each of the N queries and each of the N annotations. Next, standard cross-entropy (for the classes) and a linear combination of the L1 and generalized IoU loss (for the bounding boxes) are used to optimize the parameters of the model.  ## Intended uses & limitations You can use the raw model for object detection. See the [model hub](https://huggingface.co/models?search=facebook/detr) to look for all available DETR models. ### How to use Here is how to use this model: ```python from transformers import DetrImageProcessor, DetrForObjectDetection import torch from PIL import Image import requests url = "http://images.cocodataset.org/val2017/000000039769.jpg" image = Image.open(requests.get(url, stream=True).raw) # you can specify the revision tag if you don't want the timm dependency processor = DetrImageProcessor.from_pretrained("facebook/detr-resnet-50", revision="no_timm") model = DetrForObjectDetection.from_pretrained("facebook/detr-resnet-50", revision="no_timm") inputs = processor(images=image, return_tensors="pt") outputs = model(**inputs) # convert outputs (bounding boxes and class logits) to COCO API # let's only keep detections with score > 0.9 target_sizes = torch.tensor([image.size[::-1]]) results = processor.post_process_object_detection(outputs, target_sizes=target_sizes, threshold=0.9)[0] for score, label, box in zip(results["scores"], results["labels"], results["boxes"]): box = [round(i, 2) for i in box.tolist()] print( f"Detected {model.config.id2label[label.item()]} with confidence " f"{round(score.item(), 3)} at location {box}" ) ``` This should output: ``` Detected remote with confidence 0.998 at location [40.16, 70.81, 175.55, 117.98] Detected remote with confidence 0.996 at location [333.24, 72.55, 368.33, 187.66] Detected couch with confidence 0.995 at location [-0.02, 1.15, 639.73, 473.76] Detected cat with confidence 0.999 at location [13.24, 52.05, 314.02, 470.93] Detected cat with confidence 0.999 at location [345.4, 23.85, 640.37, 368.72] ``` Currently, both the feature extractor and model support PyTorch. ## Training data The DETR model was trained on [COCO 2017 object detection](https://cocodataset.org/#download), a dataset consisting of 118k/5k annotated images for training/validation respectively. ## Training procedure ### Preprocessing The exact details of preprocessing of images during training/validation can be found [here](https://github.com/google-research/vision_transformer/blob/master/vit_jax/input_pipeline.py). Images are resized/rescaled such that the shortest side is at least 800 pixels and the largest side at most 1333 pixels, and normalized across the RGB channels with the ImageNet mean (0.485, 0.456, 0.406) and standard deviation (0.229, 0.224, 0.225). ### Training The model was trained for 300 epochs on 16 V100 GPUs. This takes 3 days, with 4 images per GPU (hence a total batch size of 64). ## Evaluation results This model achieves an AP (average precision) of **42.0** on COCO 2017 validation. For more details regarding evaluation results, we refer to table 1 of the original paper. ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-2005-12872, author = {Nicolas Carion and Francisco Massa and Gabriel Synnaeve and Nicolas Usunier and Alexander Kirillov and Sergey Zagoruyko}, title = {End-to-End Object Detection with Transformers}, journal = {CoRR}, volume = {abs/2005.12872}, year = {2020}, url = {https://arxiv.org/abs/2005.12872}, archivePrefix = {arXiv}, eprint = {2005.12872}, timestamp = {Thu, 28 May 2020 17:38:09 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2005-12872.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

jonatasgrosman/wav2vec2-large-xlsr-53-japanese

jonatasgrosman

transformers

automatic-speech-recognition

--- language: ja datasets: - common_voice metrics: - wer - cer tags: - audio - automatic-speech-recognition - speech - xlsr-fine-tuning-week license: apache-2.0 model-index: - name: XLSR Wav2Vec2 Japanese by Jonatas Grosman results: - task: name: Speech Recognition type: automatic-speech-recognition dataset: name: Common Voice ja type: common_voice args: ja metrics: - name: Test WER type: wer value: 81.80 - name: Test CER type: cer value: 20.16 --- # Fine-tuned XLSR-53 large model for speech recognition in Japanese Fine-tuned [facebook/wav2vec2-large-xlsr-53](https://huggingface.co/facebook/wav2vec2-large-xlsr-53) on Japanese using the train and validation splits of [Common Voice 6.1](https://huggingface.co/datasets/common_voice), [CSS10](https://github.com/Kyubyong/css10) and [JSUT](https://sites.google.com/site/shinnosuketakamichi/publication/jsut). When using this model, make sure that your speech input is sampled at 16kHz. This model has been fine-tuned thanks to the GPU credits generously given by the [OVHcloud](https://www.ovhcloud.com/en/public-cloud/ai-training/) :) The script used for training can be found here: https://github.com/jonatasgrosman/wav2vec2-sprint ## Usage The model can be used directly (without a language model) as follows... Using the [HuggingSound](https://github.com/jonatasgrosman/huggingsound) library: ```python from huggingsound import SpeechRecognitionModel model = SpeechRecognitionModel("jonatasgrosman/wav2vec2-large-xlsr-53-japanese") audio_paths = ["/path/to/file.mp3", "/path/to/another_file.wav"] transcriptions = model.transcribe(audio_paths) ``` Writing your own inference script: ```python import torch import librosa from datasets import load_dataset from transformers import Wav2Vec2ForCTC, Wav2Vec2Processor LANG_ID = "ja" MODEL_ID = "jonatasgrosman/wav2vec2-large-xlsr-53-japanese" SAMPLES = 10 test_dataset = load_dataset("common_voice", LANG_ID, split=f"test[:{SAMPLES}]") processor = Wav2Vec2Processor.from_pretrained(MODEL_ID) model = Wav2Vec2ForCTC.from_pretrained(MODEL_ID) # Preprocessing the datasets. # We need to read the audio files as arrays def speech_file_to_array_fn(batch): speech_array, sampling_rate = librosa.load(batch["path"], sr=16_000) batch["speech"] = speech_array batch["sentence"] = batch["sentence"].upper() return batch test_dataset = test_dataset.map(speech_file_to_array_fn) inputs = processor(test_dataset["speech"], sampling_rate=16_000, return_tensors="pt", padding=True) with torch.no_grad(): logits = model(inputs.input_values, attention_mask=inputs.attention_mask).logits predicted_ids = torch.argmax(logits, dim=-1) predicted_sentences = processor.batch_decode(predicted_ids) for i, predicted_sentence in enumerate(predicted_sentences): print("-" * 100) print("Reference:", test_dataset[i]["sentence"]) print("Prediction:", predicted_sentence) ``` | Reference | Prediction | | ------------- | ------------- | | 祖母は、おおむね機嫌よく、サイコロをころがしている。 | 人母は重にきね起くさいがしている | | 財布をなくしたので、交番へ行きます。 | 財布をなく手端ので勾番へ行きます | | 飲み屋のおやじ、旅館の主人、医者をはじめ、交際のある人にきいてまわったら、みんな、私より収入が多いはずなのに、税金は安い。 | ノ宮屋のお親じ旅館の主に医者をはじめ交際のアル人トに聞いて回ったらみんな私より収入が多いはなうに税金は安い | | 新しい靴をはいて出かけます。 | だらしい靴をはいて出かけます | | このためプラズマ中のイオンや電子の持つ平均運動エネルギーを温度で表現することがある | このためプラズマ中のイオンや電子の持つ平均運動エネルギーを温度で表弁することがある | | 松井さんはサッカーより野球のほうが上手です。 | 松井さんはサッカーより野球のほうが上手です | | 新しいお皿を使います。 | 新しいお皿を使います | | 結婚以来三年半ぶりの東京も、旧友とのお酒も、夜行列車も、駅で寝て、朝を待つのも久しぶりだ。 | 結婚ル二来三年半降りの東京も吸とのお酒も野越者も駅で寝て朝を待つの久しぶりた | | これまで、少年野球、ママさんバレーなど、地域スポーツを支え、市民に密着してきたのは、無数のボランティアだった。 | これまで少年野球<unk>三バレーなど地域スポーツを支え市民に満着してきたのは娘数のボランティアだった | | 靴を脱いで、スリッパをはきます。 | 靴を脱いでスイパーをはきます | ## Evaluation The model can be evaluated as follows on the Japanese test data of Common Voice. ```python import torch import re import librosa from datasets import load_dataset, load_metric from transformers import Wav2Vec2ForCTC, Wav2Vec2Processor LANG_ID = "ja" MODEL_ID = "jonatasgrosman/wav2vec2-large-xlsr-53-japanese" DEVICE = "cuda" CHARS_TO_IGNORE = [",", "?", "¿", ".", "!", "¡", ";", "；", ":", '""', "%", '"', "�", "ʿ", "·", "჻", "~", "՞", "؟", "،", "।", "॥", "«", "»", "„", "“", "”", "「", "」", "‘", "’", "《", "》", "(", ")", "[", "]", "{", "}", "=", "`", "_", "+", "<", ">", "…", "–", "°", "´", "ʾ", "‹", "›", "©", "®", "—", "→", "。", "、", "﹂", "﹁", "‧", "～", "﹏", "，", "｛", "｝", "（", "）", "［", "］", "【", "】", "‥", "〽", "『", "』", "〝", "〟", "⟨", "⟩", "〜", "：", "！", "？", "♪", "؛", "/", "\\", "º", "−", "^", "'", "ʻ", "ˆ"] test_dataset = load_dataset("common_voice", LANG_ID, split="test") wer = load_metric("wer.py") # https://github.com/jonatasgrosman/wav2vec2-sprint/blob/main/wer.py cer = load_metric("cer.py") # https://github.com/jonatasgrosman/wav2vec2-sprint/blob/main/cer.py chars_to_ignore_regex = f"[{re.escape(''.join(CHARS_TO_IGNORE))}]" processor = Wav2Vec2Processor.from_pretrained(MODEL_ID) model = Wav2Vec2ForCTC.from_pretrained(MODEL_ID) model.to(DEVICE) # Preprocessing the datasets. # We need to read the audio files as arrays def speech_file_to_array_fn(batch): with warnings.catch_warnings(): warnings.simplefilter("ignore") speech_array, sampling_rate = librosa.load(batch["path"], sr=16_000) batch["speech"] = speech_array batch["sentence"] = re.sub(chars_to_ignore_regex, "", batch["sentence"]).upper() return batch test_dataset = test_dataset.map(speech_file_to_array_fn) # Preprocessing the datasets. # We need to read the audio files as arrays def evaluate(batch): inputs = processor(batch["speech"], sampling_rate=16_000, return_tensors="pt", padding=True) with torch.no_grad(): logits = model(inputs.input_values.to(DEVICE), attention_mask=inputs.attention_mask.to(DEVICE)).logits pred_ids = torch.argmax(logits, dim=-1) batch["pred_strings"] = processor.batch_decode(pred_ids) return batch result = test_dataset.map(evaluate, batched=True, batch_size=8) predictions = [x.upper() for x in result["pred_strings"]] references = [x.upper() for x in result["sentence"]] print(f"WER: {wer.compute(predictions=predictions, references=references, chunk_size=1000) * 100}") print(f"CER: {cer.compute(predictions=predictions, references=references, chunk_size=1000) * 100}") ``` **Test Result**: In the table below I report the Word Error Rate (WER) and the Character Error Rate (CER) of the model. I ran the evaluation script described above on other models as well (on 2021-05-10). Note that the table below may show different results from those already reported, this may have been caused due to some specificity of the other evaluation scripts used. | Model | WER | CER | | ------------- | ------------- | ------------- | | jonatasgrosman/wav2vec2-large-xlsr-53-japanese | **81.80%** | **20.16%** | | vumichien/wav2vec2-large-xlsr-japanese | 1108.86% | 23.40% | | qqhann/w2v_hf_jsut_xlsr53 | 1012.18% | 70.77% | ## Citation If you want to cite this model you can use this: ```bibtex @misc{grosman2021xlsr53-large-japanese, title={Fine-tuned {XLSR}-53 large model for speech recognition in {J}apanese}, author={Grosman, Jonatas}, howpublished={\url{https://huggingface.co/jonatasgrosman/wav2vec2-large-xlsr-53-japanese}}, year={2021} } ```

runwayml/stable-diffusion-inpainting

runwayml

diffusers

text-to-image

--- license: creativeml-openrail-m tags: - stable-diffusion - stable-diffusion-diffusers - text-to-image inference: false library_name: diffusers extra_gated_prompt: |- One more step before getting this model. This model is open access and available to all, with a CreativeML OpenRAIL-M license further specifying rights and usage. The CreativeML OpenRAIL License specifies: 1. You can't use the model to deliberately produce nor share illegal or harmful outputs or content 2. CompVis claims no rights on the outputs you generate, you are free to use them and are accountable for their use which must not go against the provisions set in the license 3. You may re-distribute the weights and use the model commercially and/or as a service. If you do, please be aware you have to include the same use restrictions as the ones in the license and share a copy of the CreativeML OpenRAIL-M to all your users (please read the license entirely and carefully) Please read the full license here: https://huggingface.co/spaces/CompVis/stable-diffusion-license By clicking on "Access repository" below, you accept that your *contact information* (email address and username) can be shared with the model authors as well. extra_gated_fields: I have read the License and agree with its terms: checkbox --- Stable Diffusion Inpainting is a latent text-to-image diffusion model capable of generating photo-realistic images given any text input, with the extra capability of inpainting the pictures by using a mask. The **Stable-Diffusion-Inpainting** was initialized with the weights of the [Stable-Diffusion-v-1-2](https://steps/huggingface.co/CompVis/stable-diffusion-v-1-2-original). First 595k steps regular training, then 440k steps of inpainting training at resolution 512x512 on “laion-aesthetics v2 5+” and 10% dropping of the text-conditioning to improve classifier-free [classifier-free guidance sampling](https://arxiv.org/abs/2207.12598). For inpainting, the UNet has 5 additional input channels (4 for the encoded masked-image and 1 for the mask itself) whose weights were zero-initialized after restoring the non-inpainting checkpoint. During training, we generate synthetic masks and in 25% mask everything. [](https://huggingface.co/spaces/runwayml/stable-diffusion-inpainting) | [](https://colab.research.google.com/github/huggingface/notebooks/blob/main/diffusers/in_painting_with_stable_diffusion_using_diffusers.ipynb) :-------------------------:|:-------------------------:| ## Examples: You can use this both with the [🧨Diffusers library](https://github.com/huggingface/diffusers) and the [RunwayML GitHub repository](https://github.com/runwayml/stable-diffusion). ### Diffusers ```python from diffusers import StableDiffusionInpaintPipeline pipe = StableDiffusionInpaintPipeline.from_pretrained( "runwayml/stable-diffusion-inpainting", revision="fp16", torch_dtype=torch.float16, ) prompt = "Face of a yellow cat, high resolution, sitting on a park bench" #image and mask_image should be PIL images. #The mask structure is white for inpainting and black for keeping as is image = pipe(prompt=prompt, image=image, mask_image=mask_image).images[0] image.save("./yellow_cat_on_park_bench.png") ``` **How it works:** `image` | `mask_image` :-------------------------:|:-------------------------:| <img src="https://raw.githubusercontent.com/CompVis/latent-diffusion/main/data/inpainting_examples/overture-creations-5sI6fQgYIuo.png" alt="drawing" width="300"/> | <img src="https://raw.githubusercontent.com/CompVis/latent-diffusion/main/data/inpainting_examples/overture-creations-5sI6fQgYIuo_mask.png" alt="drawing" width="300"/> `prompt` | `Output` :-------------------------:|:-------------------------:| <span style="position: relative;bottom: 150px;">Face of a yellow cat, high resolution, sitting on a park bench</span> | <img src="https://huggingface.co/datasets/patrickvonplaten/images/resolve/main/test.png" alt="drawing" width="300"/> ### Original GitHub Repository 1. Download the weights [sd-v1-5-inpainting.ckpt](https://huggingface.co/runwayml/stable-diffusion-inpainting/resolve/main/sd-v1-5-inpainting.ckpt) 2. Follow instructions [here](https://github.com/runwayml/stable-diffusion#inpainting-with-stable-diffusion). ## Model Details - **Developed by:** Robin Rombach, Patrick Esser - **Model type:** Diffusion-based text-to-image generation model - **Language(s):** English - **License:** [The CreativeML OpenRAIL M license](https://huggingface.co/spaces/CompVis/stable-diffusion-license) is an [Open RAIL M license](https://www.licenses.ai/blog/2022/8/18/naming-convention-of-responsible-ai-licenses), adapted from the work that [BigScience](https://bigscience.huggingface.co/) and [the RAIL Initiative](https://www.licenses.ai/) are jointly carrying in the area of responsible AI licensing. See also [the article about the BLOOM Open RAIL license](https://bigscience.huggingface.co/blog/the-bigscience-rail-license) on which our license is based. - **Model Description:** This is a model that can be used to generate and modify images based on text prompts. It is a [Latent Diffusion Model](https://arxiv.org/abs/2112.10752) that uses a fixed, pretrained text encoder ([CLIP ViT-L/14](https://arxiv.org/abs/2103.00020)) as suggested in the [Imagen paper](https://arxiv.org/abs/2205.11487). - **Resources for more information:** [GitHub Repository](https://github.com/runwayml/stable-diffusion), [Paper](https://arxiv.org/abs/2112.10752). - **Cite as:** @InProceedings{Rombach_2022_CVPR, author = {Rombach, Robin and Blattmann, Andreas and Lorenz, Dominik and Esser, Patrick and Ommer, Bj\"orn}, title = {High-Resolution Image Synthesis With Latent Diffusion Models}, booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition (CVPR)}, month = {June}, year = {2022}, pages = {10684-10695} } # Uses ## Direct Use The model is intended for research purposes only. Possible research areas and tasks include - Safe deployment of models which have the potential to generate harmful content. - Probing and understanding the limitations and biases of generative models. - Generation of artworks and use in design and other artistic processes. - Applications in educational or creative tools. - Research on generative models. Excluded uses are described below. ### Misuse, Malicious Use, and Out-of-Scope Use _Note: This section is taken from the [DALLE-MINI model card](https://huggingface.co/dalle-mini/dalle-mini), but applies in the same way to Stable Diffusion v1_. The model should not be used to intentionally create or disseminate images that create hostile or alienating environments for people. This includes generating images that people would foreseeably find disturbing, distressing, or offensive; or content that propagates historical or current stereotypes. #### Out-of-Scope Use The model was not trained to be factual or true representations of people or events, and therefore using the model to generate such content is out-of-scope for the abilities of this model. #### Misuse and Malicious Use Using the model to generate content that is cruel to individuals is a misuse of this model. This includes, but is not limited to: - Generating demeaning, dehumanizing, or otherwise harmful representations of people or their environments, cultures, religions, etc. - Intentionally promoting or propagating discriminatory content or harmful stereotypes. - Impersonating individuals without their consent. - Sexual content without consent of the people who might see it. - Mis- and disinformation - Representations of egregious violence and gore - Sharing of copyrighted or licensed material in violation of its terms of use. - Sharing content that is an alteration of copyrighted or licensed material in violation of its terms of use. ## Limitations and Bias ### Limitations - The model does not achieve perfect photorealism - The model cannot render legible text - The model does not perform well on more difficult tasks which involve compositionality, such as rendering an image corresponding to “A red cube on top of a blue sphere” - Faces and people in general may not be generated properly. - The model was trained mainly with English captions and will not work as well in other languages. - The autoencoding part of the model is lossy - The model was trained on a large-scale dataset [LAION-5B](https://laion.ai/blog/laion-5b/) which contains adult material and is not fit for product use without additional safety mechanisms and considerations. - No additional measures were used to deduplicate the dataset. As a result, we observe some degree of memorization for images that are duplicated in the training data. The training data can be searched at [https://rom1504.github.io/clip-retrieval/](https://rom1504.github.io/clip-retrieval/) to possibly assist in the detection of memorized images. ### Bias While the capabilities of image generation models are impressive, they can also reinforce or exacerbate social biases. Stable Diffusion v1 was trained on subsets of [LAION-2B(en)](https://laion.ai/blog/laion-5b/), which consists of images that are primarily limited to English descriptions. Texts and images from communities and cultures that use other languages are likely to be insufficiently accounted for. This affects the overall output of the model, as white and western cultures are often set as the default. Further, the ability of the model to generate content with non-English prompts is significantly worse than with English-language prompts. ## Training **Training Data** The model developers used the following dataset for training the model: - LAION-2B (en) and subsets thereof (see next section) **Training Procedure** Stable Diffusion v1 is a latent diffusion model which combines an autoencoder with a diffusion model that is trained in the latent space of the autoencoder. During training, - Images are encoded through an encoder, which turns images into latent representations. The autoencoder uses a relative downsampling factor of 8 and maps images of shape H x W x 3 to latents of shape H/f x W/f x 4 - Text prompts are encoded through a ViT-L/14 text-encoder. - The non-pooled output of the text encoder is fed into the UNet backbone of the latent diffusion model via cross-attention. - The loss is a reconstruction objective between the noise that was added to the latent and the prediction made by the UNet. We currently provide six checkpoints, `sd-v1-1.ckpt`, `sd-v1-2.ckpt` and `sd-v1-3.ckpt`, `sd-v1-4.ckpt`, `sd-v1-5.ckpt` and `sd-v1-5-inpainting.ckpt` which were trained as follows, - `sd-v1-1.ckpt`: 237k steps at resolution `256x256` on [laion2B-en](https://huggingface.co/datasets/laion/laion2B-en). 194k steps at resolution `512x512` on [laion-high-resolution](https://huggingface.co/datasets/laion/laion-high-resolution) (170M examples from LAION-5B with resolution `>= 1024x1024`). - `sd-v1-2.ckpt`: Resumed from `sd-v1-1.ckpt`. 515k steps at resolution `512x512` on "laion-improved-aesthetics" (a subset of laion2B-en, filtered to images with an original size `>= 512x512`, estimated aesthetics score `> 5.0`, and an estimated watermark probability `< 0.5`. The watermark estimate is from the LAION-5B metadata, the aesthetics score is estimated using an [improved aesthetics estimator](https://github.com/christophschuhmann/improved-aesthetic-predictor)). - `sd-v1-3.ckpt`: Resumed from `sd-v1-2.ckpt`. 195k steps at resolution `512x512` on "laion-improved-aesthetics" and 10\% dropping of the text-conditioning to improve [classifier-free guidance sampling](https://arxiv.org/abs/2207.12598). - `sd-v1-4.ckpt`: Resumed from stable-diffusion-v1-2.225,000 steps at resolution 512x512 on "laion-aesthetics v2 5+" and 10 % dropping of the text-conditioning to [classifier-free guidance sampling](https://arxiv.org/abs/2207.12598). - `sd-v1-5.ckpt`: Resumed from sd-v1-2.ckpt. 595k steps at resolution 512x512 on "laion-aesthetics v2 5+" and 10% dropping of the text-conditioning to improve classifier-free guidance sampling. - `sd-v1-5-inpaint.ckpt`: Resumed from sd-v1-2.ckpt. 595k steps at resolution 512x512 on "laion-aesthetics v2 5+" and 10% dropping of the text-conditioning to improve classifier-free guidance sampling. Then 440k steps of inpainting training at resolution 512x512 on “laion-aesthetics v2 5+” and 10% dropping of the text-conditioning. For inpainting, the UNet has 5 additional input channels (4 for the encoded masked-image and 1 for the mask itself) whose weights were zero-initialized after restoring the non-inpainting checkpoint. During training, we generate synthetic masks and in 25% mask everything. - **Hardware:** 32 x 8 x A100 GPUs - **Optimizer:** AdamW - **Gradient Accumulations**: 2 - **Batch:** 32 x 8 x 2 x 4 = 2048 - **Learning rate:** warmup to 0.0001 for 10,000 steps and then kept constant ## Evaluation Results Evaluations with different classifier-free guidance scales (1.5, 2.0, 3.0, 4.0, 5.0, 6.0, 7.0, 8.0) and 50 PLMS sampling steps show the relative improvements of the checkpoints:  Evaluated using 50 PLMS steps and 10000 random prompts from the COCO2017 validation set, evaluated at 512x512 resolution. Not optimized for FID scores. ## Inpainting Evaluation To assess the performance of the inpainting model, we used the same evaluation protocol as in our [LDM paper](https://arxiv.org/abs/2112.10752). Since the Stable Diffusion Inpainting Model acccepts a text input, we simply used a fixed prompt of `photograph of a beautiful empty scene, highest quality settings`. | Model | FID | LPIPS | |-----------------------------|------|------------------| | Stable Diffusion Inpainting | 1.00 | 0.141 (+- 0.082) | | Latent Diffusion Inpainting | 1.50 | 0.137 (+- 0.080) | | CoModGAN | 1.82 | 0.15 | | LaMa | 2.21 | 0.134 (+- 0.080) | ## Environmental Impact **Stable Diffusion v1** **Estimated Emissions** Based on that information, we estimate the following CO2 emissions using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). The hardware, runtime, cloud provider, and compute region were utilized to estimate the carbon impact. - **Hardware Type:** A100 PCIe 40GB - **Hours used:** 150000 - **Cloud Provider:** AWS - **Compute Region:** US-east - **Carbon Emitted (Power consumption x Time x Carbon produced based on location of power grid):** 11250 kg CO2 eq. ## Citation ```bibtex @InProceedings{Rombach_2022_CVPR, author = {Rombach, Robin and Blattmann, Andreas and Lorenz, Dominik and Esser, Patrick and Ommer, Bj\"orn}, title = {High-Resolution Image Synthesis With Latent Diffusion Models}, booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition (CVPR)}, month = {June}, year = {2022}, pages = {10684-10695} } ``` *This model card was written by: Robin Rombach and Patrick Esser and is based on the [DALL-E Mini model card](https://huggingface.co/dalle-mini/dalle-mini).*

google/siglip-so400m-patch14-384

google

transformers

zero-shot-image-classification

--- license: apache-2.0 tags: - vision widget: - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/cat-dog-music.png candidate_labels: playing music, playing sports example_title: Cat & Dog --- # SigLIP (shape-optimized model) SigLIP model pre-trained on WebLi at resolution 384x384. It was introduced in the paper [Sigmoid Loss for Language Image Pre-Training](https://arxiv.org/abs/2303.15343) by Zhai et al. and first released in [this repository](https://github.com/google-research/big_vision). This model has the SoViT-400m architecture, which is the shape-optimized version as presented in [Getting ViT in Shape: Scaling Laws for Compute-Optimal Model Design](https://arxiv.org/abs/2305.13035) by Alabdulmohsin et al. Disclaimer: The team releasing SigLIP did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description SigLIP is [CLIP](https://huggingface.co/docs/transformers/model_doc/clip), a multimodal model, with a better loss function. The sigmoid loss operates solely on image-text pairs and does not require a global view of the pairwise similarities for normalization. This allows further scaling up the batch size, while also performing better at smaller batch sizes. A TLDR of SigLIP by one of the authors can be found [here](https://twitter.com/giffmana/status/1692641733459267713). ## Intended uses & limitations You can use the raw model for tasks like zero-shot image classification and image-text retrieval. See the [model hub](https://huggingface.co/models?search=google/siglip) to look for other versions on a task that interests you. ### How to use Here is how to use this model to perform zero-shot image classification: ```python from PIL import Image import requests from transformers import AutoProcessor, AutoModel import torch model = AutoModel.from_pretrained("google/siglip-so400m-patch14-384") processor = AutoProcessor.from_pretrained("google/siglip-so400m-patch14-384") url = "http://images.cocodataset.org/val2017/000000039769.jpg" image = Image.open(requests.get(url, stream=True).raw) texts = ["a photo of 2 cats", "a photo of 2 dogs"] inputs = processor(text=texts, images=image, padding="max_length", return_tensors="pt") with torch.no_grad(): outputs = model(**inputs) logits_per_image = outputs.logits_per_image probs = torch.sigmoid(logits_per_image) # these are the probabilities print(f"{probs[0][0]:.1%} that image 0 is '{texts[0]}'") ``` Alternatively, one can leverage the pipeline API which abstracts away the complexity for the user: ```python from transformers import pipeline from PIL import Image import requests # load pipe image_classifier = pipeline(task="zero-shot-image-classification", model="google/siglip-so400m-patch14-384") # load image url = 'http://images.cocodataset.org/val2017/000000039769.jpg' image = Image.open(requests.get(url, stream=True).raw) # inference outputs = image_classifier(image, candidate_labels=["2 cats", "a plane", "a remote"]) outputs = [{"score": round(output["score"], 4), "label": output["label"] } for output in outputs] print(outputs) ``` For more code examples, we refer to the [documentation](https://huggingface.co/transformers/main/model_doc/siglip.html#). ## Training procedure ### Training data SigLIP is pre-trained on the WebLI dataset [(Chen et al., 2023)](https://arxiv.org/abs/2209.06794). ### Preprocessing Images are resized/rescaled to the same resolution (384x384) and normalized across the RGB channels with mean (0.5, 0.5, 0.5) and standard deviation (0.5, 0.5, 0.5). Texts are tokenized and padded to the same length (64 tokens). ### Compute The model was trained on 16 TPU-v4 chips for three days. ## Evaluation results Evaluation of SigLIP compared to CLIP is shown below (taken from the paper). <img src="https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/model_doc/siglip_table.jpeg" alt="drawing" width="600"/> ### BibTeX entry and citation info ```bibtex @misc{zhai2023sigmoid, title={Sigmoid Loss for Language Image Pre-Training}, author={Xiaohua Zhai and Basil Mustafa and Alexander Kolesnikov and Lucas Beyer}, year={2023}, eprint={2303.15343}, archivePrefix={arXiv}, primaryClass={cs.CV} } ```

Qwen/Qwen2-7B-Instruct

Qwen

transformers

text-generation

--- license: apache-2.0 language: - en pipeline_tag: text-generation tags: - chat base_model: Qwen/Qwen2-7B --- # Qwen2-7B-Instruct ## Introduction Qwen2 is the new series of Qwen large language models. For Qwen2, we release a number of base language models and instruction-tuned language models ranging from 0.5 to 72 billion parameters, including a Mixture-of-Experts model. This repo contains the instruction-tuned 7B Qwen2 model. Compared with the state-of-the-art opensource language models, including the previous released Qwen1.5, Qwen2 has generally surpassed most opensource models and demonstrated competitiveness against proprietary models across a series of benchmarks targeting for language understanding, language generation, multilingual capability, coding, mathematics, reasoning, etc. Qwen2-7B-Instruct supports a context length of up to 131,072 tokens, enabling the processing of extensive inputs. Please refer to [this section](#processing-long-texts) for detailed instructions on how to deploy Qwen2 for handling long texts. For more details, please refer to our [blog](https://qwenlm.github.io/blog/qwen2/), [GitHub](https://github.com/QwenLM/Qwen2), and [Documentation](https://qwen.readthedocs.io/en/latest/). <br> ## Model Details Qwen2 is a language model series including decoder language models of different model sizes. For each size, we release the base language model and the aligned chat model. It is based on the Transformer architecture with SwiGLU activation, attention QKV bias, group query attention, etc. Additionally, we have an improved tokenizer adaptive to multiple natural languages and codes. ## Training details We pretrained the models with a large amount of data, and we post-trained the models with both supervised finetuning and direct preference optimization. ## Requirements The code of Qwen2 has been in the latest Hugging face transformers and we advise you to install `transformers>=4.37.0`, or you might encounter the following error: ``` KeyError: 'qwen2' ``` ## Quickstart Here provides a code snippet with `apply_chat_template` to show you how to load the tokenizer and model and how to generate contents. ```python from transformers import AutoModelForCausalLM, AutoTokenizer device = "cuda" # the device to load the model onto model = AutoModelForCausalLM.from_pretrained( "Qwen/Qwen2-7B-Instruct", torch_dtype="auto", device_map="auto" ) tokenizer = AutoTokenizer.from_pretrained("Qwen/Qwen2-7B-Instruct") prompt = "Give me a short introduction to large language model." messages = [ {"role": "system", "content": "You are a helpful assistant."}, {"role": "user", "content": prompt} ] text = tokenizer.apply_chat_template( messages, tokenize=False, add_generation_prompt=True ) model_inputs = tokenizer([text], return_tensors="pt").to(device) generated_ids = model.generate( model_inputs.input_ids, max_new_tokens=512 ) generated_ids = [ output_ids[len(input_ids):] for input_ids, output_ids in zip(model_inputs.input_ids, generated_ids) ] response = tokenizer.batch_decode(generated_ids, skip_special_tokens=True)[0] ``` ### Processing Long Texts To handle extensive inputs exceeding 32,768 tokens, we utilize [YARN](https://arxiv.org/abs/2309.00071), a technique for enhancing model length extrapolation, ensuring optimal performance on lengthy texts. For deployment, we recommend using vLLM. You can enable the long-context capabilities by following these steps: 1. **Install vLLM**: You can install vLLM by running the following command. ```bash pip install "vllm>=0.4.3" ``` Or you can install vLLM from [source](https://github.com/vllm-project/vllm/). 2. **Configure Model Settings**: After downloading the model weights, modify the `config.json` file by including the below snippet: ```json { "architectures": [ "Qwen2ForCausalLM" ], // ... "vocab_size": 152064, // adding the following snippets "rope_scaling": { "factor": 4.0, "original_max_position_embeddings": 32768, "type": "yarn" } } ``` This snippet enable YARN to support longer contexts. 3. **Model Deployment**: Utilize vLLM to deploy your model. For instance, you can set up an openAI-like server using the command: ```bash python -m vllm.entrypoints.openai.api_server --served-model-name Qwen2-7B-Instruct --model path/to/weights ``` Then you can access the Chat API by: ```bash curl http://localhost:8000/v1/chat/completions \ -H "Content-Type: application/json" \ -d '{ "model": "Qwen2-7B-Instruct", "messages": [ {"role": "system", "content": "You are a helpful assistant."}, {"role": "user", "content": "Your Long Input Here."} ] }' ``` For further usage instructions of vLLM, please refer to our [Github](https://github.com/QwenLM/Qwen2). **Note**: Presently, vLLM only supports static YARN, which means the scaling factor remains constant regardless of input length, **potentially impacting performance on shorter texts**. We advise adding the `rope_scaling` configuration only when processing long contexts is required. ## Evaluation We briefly compare Qwen2-7B-Instruct with similar-sized instruction-tuned LLMs, including Qwen1.5-7B-Chat. The results are shown below: | Datasets | Llama-3-8B-Instruct | Yi-1.5-9B-Chat | GLM-4-9B-Chat | Qwen1.5-7B-Chat | Qwen2-7B-Instruct | | :--- | :---: | :---: | :---: | :---: | :---: | | _**English**_ | | | | | | | MMLU | 68.4 | 69.5 | **72.4** | 59.5 | 70.5 | | MMLU-Pro | 41.0 | - | - | 29.1 | **44.1** | | GPQA | **34.2** | - | **-** | 27.8 | 25.3 | | TheroemQA | 23.0 | - | - | 14.1 | **25.3** | | MT-Bench | 8.05 | 8.20 | 8.35 | 7.60 | **8.41** | | _**Coding**_ | | | | | | | Humaneval | 62.2 | 66.5 | 71.8 | 46.3 | **79.9** | | MBPP | **67.9** | - | - | 48.9 | 67.2 | | MultiPL-E | 48.5 | - | - | 27.2 | **59.1** | | Evalplus | 60.9 | - | - | 44.8 | **70.3** | | LiveCodeBench | 17.3 | - | - | 6.0 | **26.6** | | _**Mathematics**_ | | | | | | | GSM8K | 79.6 | **84.8** | 79.6 | 60.3 | 82.3 | | MATH | 30.0 | 47.7 | **50.6** | 23.2 | 49.6 | | _**Chinese**_ | | | | | | | C-Eval | 45.9 | - | 75.6 | 67.3 | **77.2** | | AlignBench | 6.20 | 6.90 | 7.01 | 6.20 | **7.21** | ## Citation If you find our work helpful, feel free to give us a cite. ``` @article{qwen2, title={Qwen2 Technical Report}, year={2024} } ```

meta-llama/Llama-2-7b-hf

meta-llama

transformers

text-generation

--- extra_gated_heading: You need to share contact information with Meta to access this model extra_gated_prompt: >- ### LLAMA 2 COMMUNITY LICENSE AGREEMENT "Agreement" means the terms and conditions for use, reproduction, distribution and modification of the Llama Materials set forth herein. "Documentation" means the specifications, manuals and documentation accompanying Llama 2 distributed by Meta at https://ai.meta.com/resources/models-and-libraries/llama-downloads/. "Licensee" or "you" means you, or your employer or any other person or entity (if you are entering into this Agreement on such person or entity's behalf), of the age required under applicable laws, rules or regulations to provide legal consent and that has legal authority to bind your employer or such other person or entity if you are entering in this Agreement on their behalf. "Llama 2" means the foundational large language models and software and algorithms, including machine-learning model code, trained model weights, inference-enabling code, training-enabling code, fine-tuning enabling code and other elements of the foregoing distributed by Meta at ai.meta.com/resources/models-and-libraries/llama-downloads/. "Llama Materials" means, collectively, Meta's proprietary Llama 2 and documentation (and any portion thereof) made available under this Agreement. "Meta" or "we" means Meta Platforms Ireland Limited (if you are located in or, if you are an entity, your principal place of business is in the EEA or Switzerland) and Meta Platforms, Inc. (if you are located outside of the EEA or Switzerland). By clicking "I Accept" below or by using or distributing any portion or element of the Llama Materials, you agree to be bound by this Agreement. 1. License Rights and Redistribution. a. Grant of Rights. You are granted a non-exclusive, worldwide, non- transferable and royalty-free limited license under Meta's intellectual property or other rights owned by Meta embodied in the Llama Materials to use, reproduce, distribute, copy, create derivative works of, and make modifications to the Llama Materials. b. Redistribution and Use. i. If you distribute or make the Llama Materials, or any derivative works thereof, available to a third party, you shall provide a copy of this Agreement to such third party. ii. If you receive Llama Materials, or any derivative works thereof, from a Licensee as part of an integrated end user product, then Section 2 of this Agreement will not apply to you. iii. You must retain in all copies of the Llama Materials that you distribute the following attribution notice within a "Notice" text file distributed as a part of such copies: "Llama 2 is licensed under the LLAMA 2 Community License, Copyright (c) Meta Platforms, Inc. All Rights Reserved." iv. Your use of the Llama Materials must comply with applicable laws and regulations (including trade compliance laws and regulations) and adhere to the Acceptable Use Policy for the Llama Materials (available at https://ai.meta.com/llama/use-policy), which is hereby incorporated by reference into this Agreement. v. You will not use the Llama Materials or any output or results of the Llama Materials to improve any other large language model (excluding Llama 2 or derivative works thereof). 2. Additional Commercial Terms. If, on the Llama 2 version release date, the monthly active users of the products or services made available by or for Licensee, or Licensee's affiliates, is greater than 700 million monthly active users in the preceding calendar month, you must request a license from Meta, which Meta may grant to you in its sole discretion, and you are not authorized to exercise any of the rights under this Agreement unless or until Meta otherwise expressly grants you such rights. 3. Disclaimer of Warranty. UNLESS REQUIRED BY APPLICABLE LAW, THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS THEREFROM ARE PROVIDED ON AN "AS IS" BASIS, WITHOUT WARRANTIES OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING, WITHOUT LIMITATION, ANY WARRANTIES OF TITLE, NON-INFRINGEMENT, MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE. YOU ARE SOLELY RESPONSIBLE FOR DETERMINING THE APPROPRIATENESS OF USING OR REDISTRIBUTING THE LLAMA MATERIALS AND ASSUME ANY RISKS ASSOCIATED WITH YOUR USE OF THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS. 4. Limitation of Liability. IN NO EVENT WILL META OR ITS AFFILIATES BE LIABLE UNDER ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, TORT, NEGLIGENCE, PRODUCTS LIABILITY, OR OTHERWISE, ARISING OUT OF THIS AGREEMENT, FOR ANY LOST PROFITS OR ANY INDIRECT, SPECIAL, CONSEQUENTIAL, INCIDENTAL, EXEMPLARY OR PUNITIVE DAMAGES, EVEN IF META OR ITS AFFILIATES HAVE BEEN ADVISED OF THE POSSIBILITY OF ANY OF THE FOREGOING. 5. Intellectual Property. a. No trademark licenses are granted under this Agreement, and in connection with the Llama Materials, neither Meta nor Licensee may use any name or mark owned by or associated with the other or any of its affiliates, except as required for reasonable and customary use in describing and redistributing the Llama Materials. b. Subject to Meta's ownership of Llama Materials and derivatives made by or for Meta, with respect to any derivative works and modifications of the Llama Materials that are made by you, as between you and Meta, you are and will be the owner of such derivative works and modifications. c. If you institute litigation or other proceedings against Meta or any entity (including a cross-claim or counterclaim in a lawsuit) alleging that the Llama Materials or Llama 2 outputs or results, or any portion of any of the foregoing, constitutes infringement of intellectual property or other rights owned or licensable by you, then any licenses granted to you under this Agreement shall terminate as of the date such litigation or claim is filed or instituted. You will indemnify and hold harmless Meta from and against any claim by any third party arising out of or related to your use or distribution of the Llama Materials. 6. Term and Termination. The term of this Agreement will commence upon your acceptance of this Agreement or access to the Llama Materials and will continue in full force and effect until terminated in accordance with the terms and conditions herein. Meta may terminate this Agreement if you are in breach of any term or condition of this Agreement. Upon termination of this Agreement, you shall delete and cease use of the Llama Materials. Sections 3, 4 and 7 shall survive the termination of this Agreement. 7. Governing Law and Jurisdiction. This Agreement will be governed and construed under the laws of the State of California without regard to choice of law principles, and the UN Convention on Contracts for the International Sale of Goods does not apply to this Agreement. The courts of California shall have exclusive jurisdiction of any dispute arising out of this Agreement. ### Llama 2 Acceptable Use Policy Meta is committed to promoting safe and fair use of its tools and features, including Llama 2. If you access or use Llama 2, you agree to this Acceptable Use Policy (“Policy”). The most recent copy of this policy can be found at [ai.meta.com/llama/use-policy](http://ai.meta.com/llama/use-policy). #### Prohibited Uses We want everyone to use Llama 2 safely and responsibly. You agree you will not use, or allow others to use, Llama 2 to: 1. Violate the law or others’ rights, including to: 1. Engage in, promote, generate, contribute to, encourage, plan, incite, or further illegal or unlawful activity or content, such as: 1. Violence or terrorism 2. Exploitation or harm to children, including the solicitation, creation, acquisition, or dissemination of child exploitative content or failure to report Child Sexual Abuse Material 3. Human trafficking, exploitation, and sexual violence 4. The illegal distribution of information or materials to minors, including obscene materials, or failure to employ legally required age-gating in connection with such information or materials. 5. Sexual solicitation 6. Any other criminal activity 2. Engage in, promote, incite, or facilitate the harassment, abuse, threatening, or bullying of individuals or groups of individuals 3. Engage in, promote, incite, or facilitate discrimination or other unlawful or harmful conduct in the provision of employment, employment benefits, credit, housing, other economic benefits, or other essential goods and services 4. Engage in the unauthorized or unlicensed practice of any profession including, but not limited to, financial, legal, medical/health, or related professional practices 5. Collect, process, disclose, generate, or infer health, demographic, or other sensitive personal or private information about individuals without rights and consents required by applicable laws 6. Engage in or facilitate any action or generate any content that infringes, misappropriates, or otherwise violates any third-party rights, including the outputs or results of any products or services using the Llama 2 Materials 7. Create, generate, or facilitate the creation of malicious code, malware, computer viruses or do anything else that could disable, overburden, interfere with or impair the proper working, integrity, operation or appearance of a website or computer system 2. Engage in, promote, incite, facilitate, or assist in the planning or development of activities that present a risk of death or bodily harm to individuals, including use of Llama 2 related to the following: 1. Military, warfare, nuclear industries or applications, espionage, use for materials or activities that are subject to the International Traffic Arms Regulations (ITAR) maintained by the United States Department of State 2. Guns and illegal weapons (including weapon development) 3. Illegal drugs and regulated/controlled substances 4. Operation of critical infrastructure, transportation technologies, or heavy machinery 5. Self-harm or harm to others, including suicide, cutting, and eating disorders 6. Any content intended to incite or promote violence, abuse, or any infliction of bodily harm to an individual 3. Intentionally deceive or mislead others, including use of Llama 2 related to the following: 1. Generating, promoting, or furthering fraud or the creation or promotion of disinformation 2. Generating, promoting, or furthering defamatory content, including the creation of defamatory statements, images, or other content 3. Generating, promoting, or further distributing spam 4. Impersonating another individual without consent, authorization, or legal right 5. Representing that the use of Llama 2 or outputs are human-generated 6. Generating or facilitating false online engagement, including fake reviews and other means of fake online engagement 4. Fail to appropriately disclose to end users any known dangers of your AI system Please report any violation of this Policy, software “bug,” or other problems that could lead to a violation of this Policy through one of the following means: * Reporting issues with the model: [github.com/facebookresearch/llama](http://github.com/facebookresearch/llama) * Reporting risky content generated by the model: [developers.facebook.com/llama_output_feedback](http://developers.facebook.com/llama_output_feedback) * Reporting bugs and security concerns: [facebook.com/whitehat/info](http://facebook.com/whitehat/info) * Reporting violations of the Acceptable Use Policy or unlicensed uses of Llama: [LlamaUseReport@meta.com](mailto:LlamaUseReport@meta.com) extra_gated_fields: First Name: text Last Name: text Date of birth: date_picker Country: country Affiliation: text geo: ip_location By clicking Submit below I accept the terms of the license and acknowledge that the information I provide will be collected stored processed and shared in accordance with the Meta Privacy Policy: checkbox extra_gated_description: >- The information you provide will be collected, stored, processed and shared in accordance with the [Meta Privacy Policy](https://www.facebook.com/privacy/policy/). extra_gated_button_content: Submit language: - en pipeline_tag: text-generation tags: - facebook - meta - pytorch - llama - llama-2 license: llama2 --- # **Llama 2** Llama 2 is a collection of pretrained and fine-tuned generative text models ranging in scale from 7 billion to 70 billion parameters. This is the repository for the 7B pretrained model, converted for the Hugging Face Transformers format. Links to other models can be found in the index at the bottom. ## Model Details *Note: Use of this model is governed by the Meta license. In order to download the model weights and tokenizer, please visit the [website](https://ai.meta.com/resources/models-and-libraries/llama-downloads/) and accept our License before requesting access here.* Meta developed and publicly released the Llama 2 family of large language models (LLMs), a collection of pretrained and fine-tuned generative text models ranging in scale from 7 billion to 70 billion parameters. Our fine-tuned LLMs, called Llama-2-Chat, are optimized for dialogue use cases. Llama-2-Chat models outperform open-source chat models on most benchmarks we tested, and in our human evaluations for helpfulness and safety, are on par with some popular closed-source models like ChatGPT and PaLM. **Model Developers** Meta **Variations** Llama 2 comes in a range of parameter sizes — 7B, 13B, and 70B — as well as pretrained and fine-tuned variations. **Input** Models input text only. **Output** Models generate text only. **Model Architecture** Llama 2 is an auto-regressive language model that uses an optimized transformer architecture. The tuned versions use supervised fine-tuning (SFT) and reinforcement learning with human feedback (RLHF) to align to human preferences for helpfulness and safety. ||Training Data|Params|Content Length|GQA|Tokens|LR| |---|---|---|---|---|---|---| |Llama 2|*A new mix of publicly available online data*|7B|4k|&#10007;|2.0T|3.0 x 10^-4| |Llama 2|*A new mix of publicly available online data*|13B|4k|&#10007;|2.0T|3.0 x 10^-4| |Llama 2|*A new mix of publicly available online data*|70B|4k|&#10004;|2.0T|1.5 x 10^-4| *Llama 2 family of models.* Token counts refer to pretraining data only. All models are trained with a global batch-size of 4M tokens. Bigger models - 70B -- use Grouped-Query Attention (GQA) for improved inference scalability. **Model Dates** Llama 2 was trained between January 2023 and July 2023. **Status** This is a static model trained on an offline dataset. Future versions of the tuned models will be released as we improve model safety with community feedback. **License** A custom commercial license is available at: [https://ai.meta.com/resources/models-and-libraries/llama-downloads/](https://ai.meta.com/resources/models-and-libraries/llama-downloads/) **Research Paper** ["Llama-2: Open Foundation and Fine-tuned Chat Models"](arxiv.org/abs/2307.09288) ## Intended Use **Intended Use Cases** Llama 2 is intended for commercial and research use in English. Tuned models are intended for assistant-like chat, whereas pretrained models can be adapted for a variety of natural language generation tasks. To get the expected features and performance for the chat versions, a specific formatting needs to be followed, including the `INST` and `<<SYS>>` tags, `BOS` and `EOS` tokens, and the whitespaces and breaklines in between (we recommend calling `strip()` on inputs to avoid double-spaces). See our reference code in github for details: [`chat_completion`](https://github.com/facebookresearch/llama/blob/main/llama/generation.py#L212). **Out-of-scope Uses** Use in any manner that violates applicable laws or regulations (including trade compliance laws).Use in languages other than English. Use in any other way that is prohibited by the Acceptable Use Policy and Licensing Agreement for Llama 2. ## Hardware and Software **Training Factors** We used custom training libraries, Meta's Research Super Cluster, and production clusters for pretraining. Fine-tuning, annotation, and evaluation were also performed on third-party cloud compute. **Carbon Footprint** Pretraining utilized a cumulative 3.3M GPU hours of computation on hardware of type A100-80GB (TDP of 350-400W). Estimated total emissions were 539 tCO2eq, 100% of which were offset by Meta’s sustainability program. ||Time (GPU hours)|Power Consumption (W)|Carbon Emitted(tCO₂eq)| |---|---|---|---| |Llama 2 7B|184320|400|31.22| |Llama 2 13B|368640|400|62.44| |Llama 2 70B|1720320|400|291.42| |Total|3311616||539.00| **CO₂ emissions during pretraining.** Time: total GPU time required for training each model. Power Consumption: peak power capacity per GPU device for the GPUs used adjusted for power usage efficiency. 100% of the emissions are directly offset by Meta's sustainability program, and because we are openly releasing these models, the pretraining costs do not need to be incurred by others. ## Training Data **Overview** Llama 2 was pretrained on 2 trillion tokens of data from publicly available sources. The fine-tuning data includes publicly available instruction datasets, as well as over one million new human-annotated examples. Neither the pretraining nor the fine-tuning datasets include Meta user data. **Data Freshness** The pretraining data has a cutoff of September 2022, but some tuning data is more recent, up to July 2023. ## Evaluation Results In this section, we report the results for the Llama 1 and Llama 2 models on standard academic benchmarks.For all the evaluations, we use our internal evaluations library. |Model|Size|Code|Commonsense Reasoning|World Knowledge|Reading Comprehension|Math|MMLU|BBH|AGI Eval| |---|---|---|---|---|---|---|---|---|---| |Llama 1|7B|14.1|60.8|46.2|58.5|6.95|35.1|30.3|23.9| |Llama 1|13B|18.9|66.1|52.6|62.3|10.9|46.9|37.0|33.9| |Llama 1|33B|26.0|70.0|58.4|67.6|21.4|57.8|39.8|41.7| |Llama 1|65B|30.7|70.7|60.5|68.6|30.8|63.4|43.5|47.6| |Llama 2|7B|16.8|63.9|48.9|61.3|14.6|45.3|32.6|29.3| |Llama 2|13B|24.5|66.9|55.4|65.8|28.7|54.8|39.4|39.1| |Llama 2|70B|**37.5**|**71.9**|**63.6**|**69.4**|**35.2**|**68.9**|**51.2**|**54.2**| **Overall performance on grouped academic benchmarks.** *Code:* We report the average pass@1 scores of our models on HumanEval and MBPP. *Commonsense Reasoning:* We report the average of PIQA, SIQA, HellaSwag, WinoGrande, ARC easy and challenge, OpenBookQA, and CommonsenseQA. We report 7-shot results for CommonSenseQA and 0-shot results for all other benchmarks. *World Knowledge:* We evaluate the 5-shot performance on NaturalQuestions and TriviaQA and report the average. *Reading Comprehension:* For reading comprehension, we report the 0-shot average on SQuAD, QuAC, and BoolQ. *MATH:* We report the average of the GSM8K (8 shot) and MATH (4 shot) benchmarks at top 1. |||TruthfulQA|Toxigen| |---|---|---|---| |Llama 1|7B|27.42|23.00| |Llama 1|13B|41.74|23.08| |Llama 1|33B|44.19|22.57| |Llama 1|65B|48.71|21.77| |Llama 2|7B|33.29|**21.25**| |Llama 2|13B|41.86|26.10| |Llama 2|70B|**50.18**|24.60| **Evaluation of pretrained LLMs on automatic safety benchmarks.** For TruthfulQA, we present the percentage of generations that are both truthful and informative (the higher the better). For ToxiGen, we present the percentage of toxic generations (the smaller the better). |||TruthfulQA|Toxigen| |---|---|---|---| |Llama-2-Chat|7B|57.04|**0.00**| |Llama-2-Chat|13B|62.18|**0.00**| |Llama-2-Chat|70B|**64.14**|0.01| **Evaluation of fine-tuned LLMs on different safety datasets.** Same metric definitions as above. ## Ethical Considerations and Limitations Llama 2 is a new technology that carries risks with use. Testing conducted to date has been in English, and has not covered, nor could it cover all scenarios. For these reasons, as with all LLMs, Llama 2’s potential outputs cannot be predicted in advance, and the model may in some instances produce inaccurate, biased or other objectionable responses to user prompts. Therefore, before deploying any applications of Llama 2, developers should perform safety testing and tuning tailored to their specific applications of the model. Please see the Responsible Use Guide available at [https://ai.meta.com/llama/responsible-use-guide/](https://ai.meta.com/llama/responsible-use-guide) ## Reporting Issues Please report any software “bug,” or other problems with the models through one of the following means: - Reporting issues with the model: [github.com/facebookresearch/llama](http://github.com/facebookresearch/llama) - Reporting problematic content generated by the model: [developers.facebook.com/llama_output_feedback](http://developers.facebook.com/llama_output_feedback) - Reporting bugs and security concerns: [facebook.com/whitehat/info](http://facebook.com/whitehat/info) ## Llama Model Index |Model|Llama2|Llama2-hf|Llama2-chat|Llama2-chat-hf| |---|---|---|---|---| |7B| [Link](https://huggingface.co/meta-llama/Llama-2-7b) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-chat-hf)| |13B| [Link](https://huggingface.co/meta-llama/Llama-2-13b) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-chat-hf)| |70B| [Link](https://huggingface.co/meta-llama/Llama-2-70b) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-chat-hf)|

facebook/m2m100_418M

facebook

transformers

text2text-generation

--- language: - multilingual - af - am - ar - ast - az - ba - be - bg - bn - br - bs - ca - ceb - cs - cy - da - de - el - en - es - et - fa - ff - fi - fr - fy - ga - gd - gl - gu - ha - he - hi - hr - ht - hu - hy - id - ig - ilo - is - it - ja - jv - ka - kk - km - kn - ko - lb - lg - ln - lo - lt - lv - mg - mk - ml - mn - mr - ms - my - ne - nl - no - ns - oc - or - pa - pl - ps - pt - ro - ru - sd - si - sk - sl - so - sq - sr - ss - su - sv - sw - ta - th - tl - tn - tr - uk - ur - uz - vi - wo - xh - yi - yo - zh - zu license: mit --- # M2M100 418M M2M100 is a multilingual encoder-decoder (seq-to-seq) model trained for Many-to-Many multilingual translation. It was introduced in this [paper](https://arxiv.org/abs/2010.11125) and first released in [this](https://github.com/pytorch/fairseq/tree/master/examples/m2m_100) repository. The model that can directly translate between the 9,900 directions of 100 languages. To translate into a target language, the target language id is forced as the first generated token. To force the target language id as the first generated token, pass the `forced_bos_token_id` parameter to the `generate` method. *Note: `M2M100Tokenizer` depends on `sentencepiece`, so make sure to install it before running the example.* To install `sentencepiece` run `pip install sentencepiece` ```python from transformers import M2M100ForConditionalGeneration, M2M100Tokenizer hi_text = "जीवन एक चॉकलेट बॉक्स की तरह है।" chinese_text = "生活就像一盒巧克力。" model = M2M100ForConditionalGeneration.from_pretrained("facebook/m2m100_418M") tokenizer = M2M100Tokenizer.from_pretrained("facebook/m2m100_418M") # translate Hindi to French tokenizer.src_lang = "hi" encoded_hi = tokenizer(hi_text, return_tensors="pt") generated_tokens = model.generate(**encoded_hi, forced_bos_token_id=tokenizer.get_lang_id("fr")) tokenizer.batch_decode(generated_tokens, skip_special_tokens=True) # => "La vie est comme une boîte de chocolat." # translate Chinese to English tokenizer.src_lang = "zh" encoded_zh = tokenizer(chinese_text, return_tensors="pt") generated_tokens = model.generate(**encoded_zh, forced_bos_token_id=tokenizer.get_lang_id("en")) tokenizer.batch_decode(generated_tokens, skip_special_tokens=True) # => "Life is like a box of chocolate." ``` See the [model hub](https://huggingface.co/models?filter=m2m_100) to look for more fine-tuned versions. ## Languages covered Afrikaans (af), Amharic (am), Arabic (ar), Asturian (ast), Azerbaijani (az), Bashkir (ba), Belarusian (be), Bulgarian (bg), Bengali (bn), Breton (br), Bosnian (bs), Catalan; Valencian (ca), Cebuano (ceb), Czech (cs), Welsh (cy), Danish (da), German (de), Greeek (el), English (en), Spanish (es), Estonian (et), Persian (fa), Fulah (ff), Finnish (fi), French (fr), Western Frisian (fy), Irish (ga), Gaelic; Scottish Gaelic (gd), Galician (gl), Gujarati (gu), Hausa (ha), Hebrew (he), Hindi (hi), Croatian (hr), Haitian; Haitian Creole (ht), Hungarian (hu), Armenian (hy), Indonesian (id), Igbo (ig), Iloko (ilo), Icelandic (is), Italian (it), Japanese (ja), Javanese (jv), Georgian (ka), Kazakh (kk), Central Khmer (km), Kannada (kn), Korean (ko), Luxembourgish; Letzeburgesch (lb), Ganda (lg), Lingala (ln), Lao (lo), Lithuanian (lt), Latvian (lv), Malagasy (mg), Macedonian (mk), Malayalam (ml), Mongolian (mn), Marathi (mr), Malay (ms), Burmese (my), Nepali (ne), Dutch; Flemish (nl), Norwegian (no), Northern Sotho (ns), Occitan (post 1500) (oc), Oriya (or), Panjabi; Punjabi (pa), Polish (pl), Pushto; Pashto (ps), Portuguese (pt), Romanian; Moldavian; Moldovan (ro), Russian (ru), Sindhi (sd), Sinhala; Sinhalese (si), Slovak (sk), Slovenian (sl), Somali (so), Albanian (sq), Serbian (sr), Swati (ss), Sundanese (su), Swedish (sv), Swahili (sw), Tamil (ta), Thai (th), Tagalog (tl), Tswana (tn), Turkish (tr), Ukrainian (uk), Urdu (ur), Uzbek (uz), Vietnamese (vi), Wolof (wo), Xhosa (xh), Yiddish (yi), Yoruba (yo), Chinese (zh), Zulu (zu) ## BibTeX entry and citation info ``` @misc{fan2020englishcentric, title={Beyond English-Centric Multilingual Machine Translation}, author={Angela Fan and Shruti Bhosale and Holger Schwenk and Zhiyi Ma and Ahmed El-Kishky and Siddharth Goyal and Mandeep Baines and Onur Celebi and Guillaume Wenzek and Vishrav Chaudhary and Naman Goyal and Tom Birch and Vitaliy Liptchinsky and Sergey Edunov and Edouard Grave and Michael Auli and Armand Joulin}, year={2020}, eprint={2010.11125}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

microsoft/biogpt

microsoft

transformers

text-generation

--- language: en license: mit widget: - text: "COVID-19 is" --- ## BioGPT Pre-trained language models have attracted increasing attention in the biomedical domain, inspired by their great success in the general natural language domain. Among the two main branches of pre-trained language models in the general language domain, i.e. BERT (and its variants) and GPT (and its variants), the first one has been extensively studied in the biomedical domain, such as BioBERT and PubMedBERT. While they have achieved great success on a variety of discriminative downstream biomedical tasks, the lack of generation ability constrains their application scope. In this paper, we propose BioGPT, a domain-specific generative Transformer language model pre-trained on large-scale biomedical literature. We evaluate BioGPT on six biomedical natural language processing tasks and demonstrate that our model outperforms previous models on most tasks. Especially, we get 44.98%, 38.42% and 40.76% F1 score on BC5CDR, KD-DTI and DDI end-to-end relation extraction tasks, respectively, and 78.2% accuracy on PubMedQA, creating a new record. Our case study on text generation further demonstrates the advantage of BioGPT on biomedical literature to generate fluent descriptions for biomedical terms. You can use this model directly with a pipeline for text generation. Since the generation relies on some randomness, we set a seed for reproducibility: ```python >>> from transformers import pipeline, set_seed >>> from transformers import BioGptTokenizer, BioGptForCausalLM >>> model = BioGptForCausalLM.from_pretrained("microsoft/biogpt") >>> tokenizer = BioGptTokenizer.from_pretrained("microsoft/biogpt") >>> generator = pipeline('text-generation', model=model, tokenizer=tokenizer) >>> set_seed(42) >>> generator("COVID-19 is", max_length=20, num_return_sequences=5, do_sample=True) [{'generated_text': 'COVID-19 is a disease that spreads worldwide and is currently found in a growing proportion of the population'}, {'generated_text': 'COVID-19 is one of the largest viral epidemics in the world.'}, {'generated_text': 'COVID-19 is a common condition affecting an estimated 1.1 million people in the United States alone.'}, {'generated_text': 'COVID-19 is a pandemic, the incidence has been increased in a manner similar to that in other'}, {'generated_text': 'COVID-19 is transmitted via droplets, air-borne, or airborne transmission.'}] ``` Here is how to use this model to get the features of a given text in PyTorch: ```python from transformers import BioGptTokenizer, BioGptForCausalLM tokenizer = BioGptTokenizer.from_pretrained("microsoft/biogpt") model = BioGptForCausalLM.from_pretrained("microsoft/biogpt") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='pt') output = model(**encoded_input) ``` Beam-search decoding: ```python import torch from transformers import BioGptTokenizer, BioGptForCausalLM, set_seed tokenizer = BioGptTokenizer.from_pretrained("microsoft/biogpt") model = BioGptForCausalLM.from_pretrained("microsoft/biogpt") sentence = "COVID-19 is" inputs = tokenizer(sentence, return_tensors="pt") set_seed(42) with torch.no_grad(): beam_output = model.generate(**inputs, min_length=100, max_length=1024, num_beams=5, early_stopping=True ) tokenizer.decode(beam_output[0], skip_special_tokens=True) 'COVID-19 is a global pandemic caused by severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the causative agent of coronavirus disease 2019 (COVID-19), which has spread to more than 200 countries and territories, including the United States (US), Canada, Australia, New Zealand, the United Kingdom (UK), and the United States of America (USA), as of March 11, 2020, with more than 800,000 confirmed cases and more than 800,000 deaths.' ``` ## Citation If you find BioGPT useful in your research, please cite the following paper: ```latex @article{10.1093/bib/bbac409, author = {Luo, Renqian and Sun, Liai and Xia, Yingce and Qin, Tao and Zhang, Sheng and Poon, Hoifung and Liu, Tie-Yan}, title = "{BioGPT: generative pre-trained transformer for biomedical text generation and mining}", journal = {Briefings in Bioinformatics}, volume = {23}, number = {6}, year = {2022}, month = {09}, abstract = "{Pre-trained language models have attracted increasing attention in the biomedical domain, inspired by their great success in the general natural language domain. Among the two main branches of pre-trained language models in the general language domain, i.e. BERT (and its variants) and GPT (and its variants), the first one has been extensively studied in the biomedical domain, such as BioBERT and PubMedBERT. While they have achieved great success on a variety of discriminative downstream biomedical tasks, the lack of generation ability constrains their application scope. In this paper, we propose BioGPT, a domain-specific generative Transformer language model pre-trained on large-scale biomedical literature. We evaluate BioGPT on six biomedical natural language processing tasks and demonstrate that our model outperforms previous models on most tasks. Especially, we get 44.98\%, 38.42\% and 40.76\% F1 score on BC5CDR, KD-DTI and DDI end-to-end relation extraction tasks, respectively, and 78.2\% accuracy on PubMedQA, creating a new record. Our case study on text generation further demonstrates the advantage of BioGPT on biomedical literature to generate fluent descriptions for biomedical terms.}", issn = {1477-4054}, doi = {10.1093/bib/bbac409}, url = {https://doi.org/10.1093/bib/bbac409}, note = {bbac409}, eprint = {https://academic.oup.com/bib/article-pdf/23/6/bbac409/47144271/bbac409.pdf}, } ```

Salesforce/blip-image-captioning-large

Salesforce

transformers

image-to-text

--- pipeline_tag: image-to-text tags: - image-captioning languages: - en license: bsd-3-clause --- # BLIP: Bootstrapping Language-Image Pre-training for Unified Vision-Language Understanding and Generation Model card for image captioning pretrained on COCO dataset - base architecture (with ViT large backbone). |  | |:--:| | <b> Pull figure from BLIP official repo | Image source: https://github.com/salesforce/BLIP </b>| ## TL;DR Authors from the [paper](https://arxiv.org/abs/2201.12086) write in the abstract: *Vision-Language Pre-training (VLP) has advanced the performance for many vision-language tasks. However, most existing pre-trained models only excel in either understanding-based tasks or generation-based tasks. Furthermore, performance improvement has been largely achieved by scaling up the dataset with noisy image-text pairs collected from the web, which is a suboptimal source of supervision. In this paper, we propose BLIP, a new VLP framework which transfers flexibly to both vision-language understanding and generation tasks. BLIP effectively utilizes the noisy web data by bootstrapping the captions, where a captioner generates synthetic captions and a filter removes the noisy ones. We achieve state-of-the-art results on a wide range of vision-language tasks, such as image-text retrieval (+2.7% in average recall@1), image captioning (+2.8% in CIDEr), and VQA (+1.6% in VQA score). BLIP also demonstrates strong generalization ability when directly transferred to videolanguage tasks in a zero-shot manner. Code, models, and datasets are released.* ## Usage You can use this model for conditional and un-conditional image captioning ### Using the Pytorch model #### Running the model on CPU <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import BlipProcessor, BlipForConditionalGeneration processor = BlipProcessor.from_pretrained("Salesforce/blip-image-captioning-large") model = BlipForConditionalGeneration.from_pretrained("Salesforce/blip-image-captioning-large") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') # conditional image captioning text = "a photography of" inputs = processor(raw_image, text, return_tensors="pt") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) # unconditional image captioning inputs = processor(raw_image, return_tensors="pt") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) ``` </details> #### Running the model on GPU ##### In full precision <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import BlipProcessor, BlipForConditionalGeneration processor = BlipProcessor.from_pretrained("Salesforce/blip-image-captioning-large") model = BlipForConditionalGeneration.from_pretrained("Salesforce/blip-image-captioning-large").to("cuda") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') # conditional image captioning text = "a photography of" inputs = processor(raw_image, text, return_tensors="pt").to("cuda") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) # unconditional image captioning inputs = processor(raw_image, return_tensors="pt").to("cuda") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) ``` </details> ##### In half precision (`float16`) <details> <summary> Click to expand </summary> ```python import torch import requests from PIL import Image from transformers import BlipProcessor, BlipForConditionalGeneration processor = BlipProcessor.from_pretrained("Salesforce/blip-image-captioning-large") model = BlipForConditionalGeneration.from_pretrained("Salesforce/blip-image-captioning-large", torch_dtype=torch.float16).to("cuda") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') # conditional image captioning text = "a photography of" inputs = processor(raw_image, text, return_tensors="pt").to("cuda", torch.float16) out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) # >>> a photography of a woman and her dog # unconditional image captioning inputs = processor(raw_image, return_tensors="pt").to("cuda", torch.float16) out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) >>> a woman sitting on the beach with her dog ``` </details> ## BibTex and citation info ``` @misc{https://doi.org/10.48550/arxiv.2201.12086, doi = {10.48550/ARXIV.2201.12086}, url = {https://arxiv.org/abs/2201.12086}, author = {Li, Junnan and Li, Dongxu and Xiong, Caiming and Hoi, Steven}, keywords = {Computer Vision and Pattern Recognition (cs.CV), FOS: Computer and information sciences, FOS: Computer and information sciences}, title = {BLIP: Bootstrapping Language-Image Pre-training for Unified Vision-Language Understanding and Generation}, publisher = {arXiv}, year = {2022}, copyright = {Creative Commons Attribution 4.0 International} } ```

EmergentMethods/gliner_medium_news-v2.1

EmergentMethods

gliner

token-classification

--- license: apache-2.0 datasets: - EmergentMethods/AskNews-NER-v0 tags: - gliner language: - en pipeline_tag: token-classification --- # Model Card for gliner_medium_news-v2.1 This model is a fine-tune of [GLiNER](https://huggingface.co/urchade/gliner_medium-v2.1) aimed at improving accuracy across a broad range of topics, especially with respect to long-context news entity extraction. As shown in the table below, these fine-tunes improved upon the base GLiNER model zero-shot accuracy by up to 7.5% across 18 benchmark datasets.  The underlying dataset, [AskNews-NER-v0](https://huggingface.co/datasets/EmergentMethods/AskNews-NER-v0) was engineered with the objective of diversifying global perspectives by enforcing country/language/topic/temporal diversity. All data used to fine-tune this model was synthetically generated. WizardLM 13B v1.2 was used for translation/summarization of open-web news articles, while Llama3 70b instruct was used for entity extraction. Both the diversification and fine-tuning methods are presented in a our paper on [ArXiv](https://arxiv.org/abs/2406.10258). # Usage ```python from gliner import GLiNER model = GLiNER.from_pretrained("EmergentMethods/gliner_medium_news-v2.1") text = """ The Chihuahua State Public Security Secretariat (SSPE) arrested 35-year-old Salomón C. T. in Ciudad Juárez, found in possession of a stolen vehicle, a white GMC Yukon, which was reported stolen in the city's streets. The arrest was made by intelligence and police analysis personnel during an investigation in the border city. The arrest is related to a previous detention on February 6, which involved armed men in a private vehicle. The detainee and the vehicle were turned over to the Chihuahua State Attorney General's Office for further investigation into the case. """ labels = ["person", "location", "date", "event", "facility", "vehicle", "number", "organization"] entities = model.predict_entities(text, labels) for entity in entities: print(entity["text"], "=>", entity["label"]) ``` Output: ``` Chihuahua State Public Security Secretariat => organization SSPE => organization 35-year-old => number Salomón C. T. => person Ciudad Juárez => location GMC Yukon => vehicle February 6 => date Chihuahua State Attorney General's Office => organization ``` ## Model Details ### Model Description <!-- Provide a longer summary of what this model is. --> The synthetic data underlying this news fine-tune was pulled from the [AskNews API](https://docs.asknews.app). We enforced diveristy across country/language/topic/time. Countries:  Entity types:  Topics:  - **Developed by:** [Emergent Methods](https://emergentmethods.ai/) - **Funded by:** [Emergent Methods](https://emergentmethods.ai/) - **Shared by:** [Emergent Methods](https://emergentmethods.ai/) - **Model type:** microsoft/deberta - **Language(s) (NLP):** English (en) (English texts and translations from Spanish (es), Portuguese (pt), German (de), Russian (ru), French (fr), Arabic (ar), Italian (it), Ukrainian (uk), Norwegian (no), Swedish (sv), Danish (da)). - **License:** Apache 2.0 - **Finetuned from model:** [GLiNER](https://huggingface.co/urchade/gliner_medium-v2.1) ### Model Sources [optional] <!-- Provide the basic links for the model. --> - **Repository:** To be added - **Paper:** To be added - **Demo:** To be added ## Uses <!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. --> ### Direct Use <!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. --> As the name suggests, this model is aimed at generalist entity extraction. Although we used news to fine-tune this model, it improved accuracy across 18 benchmark datasets by up to 7.5%. This means that the broad and diversified underlying dataset has helped it to recognize and extract more entity types. This model is shockingly compact, and can be used for high-throughput production usecases. This is another reason we have licensed this as Apache 2.0. Currently, [AskNews](https://asknews.app) is using this fine-tune for entity extraction in their system. ## Bias, Risks, and Limitations <!-- This section is meant to convey both technical and sociotechnical limitations. --> Although the goal of the dataset is to reduce bias, and improve diversity, it is still biased to western languages and countries. This limitation originates from the abilities of Llama2 for the translation and summary generations. Further, any bias originating in Llama2 training data will also be present in this dataset, since Llama2 was used to summarize the open-web articles. Further, any biases present in Llama3 will be present in the present dataaset since Llama3 was used to extract entities from the summaries.  ## How to Get Started with the Model Use the code below to get started with the model. ## Training Details <!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. --> The training dataset is [AskNews-NER-v0](https://huggingface.co/datasets/EmergentMethods/AskNews-NER-v0). Other training details can be found in the [companion paper](https://linktoarxiv.org). ## Environmental Impact <!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly --> - **Hardware Type:** 1xA4500 - **Hours used:** 10 - **Carbon Emitted:** 0.6 kg (According to [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute)) ## Citation <!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. --> **BibTeX:** To be added **APA:** To be added ## Model Authors Elin Törnquist, Emergent Methods elin at emergentmethods.ai Robert Caulk, Emergent Methods rob at emergentmethods.ai ## Model Contact Elin Törnquist, Emergent Methods elin at emergentmethods.ai Robert Caulk, Emergent Methods rob at emergentmethods.ai

facebook/sam-vit-base

facebook

transformers

mask-generation

--- license: apache-2.0 tags: - vision --- # Model Card for Segment Anything Model (SAM) - ViT Base (ViT-B) version <p> <img src="https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/model_doc/sam-architecture.png" alt="Model architecture"> <em> Detailed architecture of Segment Anything Model (SAM).</em> </p> # Table of Contents 0. [TL;DR](#TL;DR) 1. [Model Details](#model-details) 2. [Usage](#usage) 3. [Citation](#citation) # TL;DR [Link to original repository](https://github.com/facebookresearch/segment-anything) | <img src="https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/model_doc/sam-beancans.png" alt="Snow" width="600" height="600"> | <img src="https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/model_doc/sam-dog-masks.png" alt="Forest" width="600" height="600"> | <img src="https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/model_doc/sam-car-seg.png" alt="Mountains" width="600" height="600"> | |---------------------------------------------------------------------------------------------------------------------------------------|--------------------------------------------------------------------------------------------------------------------------------|--------------------------------------------------------------------------------------------------------------------------------------------------| The **Segment Anything Model (SAM)** produces high quality object masks from input prompts such as points or boxes, and it can be used to generate masks for all objects in an image. It has been trained on a [dataset](https://segment-anything.com/dataset/index.html) of 11 million images and 1.1 billion masks, and has strong zero-shot performance on a variety of segmentation tasks. The abstract of the paper states: > We introduce the Segment Anything (SA) project: a new task, model, and dataset for image segmentation. Using our efficient model in a data collection loop, we built the largest segmentation dataset to date (by far), with over 1 billion masks on 11M licensed and privacy respecting images. The model is designed and trained to be promptable, so it can transfer zero-shot to new image distributions and tasks. We evaluate its capabilities on numerous tasks and find that its zero-shot performance is impressive -- often competitive with or even superior to prior fully supervised results. We are releasing the Segment Anything Model (SAM) and corresponding dataset (SA-1B) of 1B masks and 11M images at [https://segment-anything.com](https://segment-anything.com) to foster research into foundation models for computer vision. **Disclaimer**: Content from **this** model card has been written by the Hugging Face team, and parts of it were copy pasted from the original [SAM model card](https://github.com/facebookresearch/segment-anything). # Model Details The SAM model is made up of 3 modules: - The `VisionEncoder`: a VIT based image encoder. It computes the image embeddings using attention on patches of the image. Relative Positional Embedding is used. - The `PromptEncoder`: generates embeddings for points and bounding boxes - The `MaskDecoder`: a two-ways transformer which performs cross attention between the image embedding and the point embeddings (->) and between the point embeddings and the image embeddings. The outputs are fed - The `Neck`: predicts the output masks based on the contextualized masks produced by the `MaskDecoder`. # Usage ## Prompted-Mask-Generation ```python from PIL import Image import requests from transformers import SamModel, SamProcessor model = SamModel.from_pretrained("facebook/sam-vit-base") processor = SamProcessor.from_pretrained("facebook/sam-vit-base") img_url = "https://huggingface.co/ybelkada/segment-anything/resolve/main/assets/car.png" raw_image = Image.open(requests.get(img_url, stream=True).raw).convert("RGB") input_points = [[[450, 600]]] # 2D localization of a window ``` ```python inputs = processor(raw_image, input_points=input_points, return_tensors="pt").to("cuda") outputs = model(**inputs) masks = processor.image_processor.post_process_masks(outputs.pred_masks.cpu(), inputs["original_sizes"].cpu(), inputs["reshaped_input_sizes"].cpu()) scores = outputs.iou_scores ``` Among other arguments to generate masks, you can pass 2D locations on the approximate position of your object of interest, a bounding box wrapping the object of interest (the format should be x, y coordinate of the top right and bottom left point of the bounding box), a segmentation mask. At this time of writing, passing a text as input is not supported by the official model according to [the official repository](https://github.com/facebookresearch/segment-anything/issues/4#issuecomment-1497626844). For more details, refer to this notebook, which shows a walk throught of how to use the model, with a visual example! ## Automatic-Mask-Generation The model can be used for generating segmentation masks in a "zero-shot" fashion, given an input image. The model is automatically prompt with a grid of `1024` points which are all fed to the model. The pipeline is made for automatic mask generation. The following snippet demonstrates how easy you can run it (on any device! Simply feed the appropriate `points_per_batch` argument) ```python from transformers import pipeline generator = pipeline("mask-generation", device = 0, points_per_batch = 256) image_url = "https://huggingface.co/ybelkada/segment-anything/resolve/main/assets/car.png" outputs = generator(image_url, points_per_batch = 256) ``` Now to display the image: ```python import matplotlib.pyplot as plt from PIL import Image import numpy as np def show_mask(mask, ax, random_color=False): if random_color: color = np.concatenate([np.random.random(3), np.array([0.6])], axis=0) else: color = np.array([30 / 255, 144 / 255, 255 / 255, 0.6]) h, w = mask.shape[-2:] mask_image = mask.reshape(h, w, 1) * color.reshape(1, 1, -1) ax.imshow(mask_image) plt.imshow(np.array(raw_image)) ax = plt.gca() for mask in outputs["masks"]: show_mask(mask, ax=ax, random_color=True) plt.axis("off") plt.show() ``` # Citation If you use this model, please use the following BibTeX entry. ``` @article{kirillov2023segany, title={Segment Anything}, author={Kirillov, Alexander and Mintun, Eric and Ravi, Nikhila and Mao, Hanzi and Rolland, Chloe and Gustafson, Laura and Xiao, Tete and Whitehead, Spencer and Berg, Alexander C. and Lo, Wan-Yen and Doll{\'a}r, Piotr and Girshick, Ross}, journal={arXiv:2304.02643}, year={2023} } ```

Qwen/Qwen2-0.5B

Qwen

transformers

text-generation

--- language: - en pipeline_tag: text-generation tags: - pretrained license: apache-2.0 --- # Qwen2-0.5B ## Introduction Qwen2 is the new series of Qwen large language models. For Qwen2, we release a number of base language models and instruction-tuned language models ranging from 0.5 to 72 billion parameters, including a Mixture-of-Experts model. This repo contains the 0.5B Qwen2 base language model. Compared with the state-of-the-art opensource language models, including the previous released Qwen1.5, Qwen2 has generally surpassed most opensource models and demonstrated competitiveness against proprietary models across a series of benchmarks targeting for language understanding, language generation, multilingual capability, coding, mathematics, reasoning, etc. For more details, please refer to our [blog](https://qwenlm.github.io/blog/qwen2/), [GitHub](https://github.com/QwenLM/Qwen2), and [Documentation](https://qwen.readthedocs.io/en/latest/). <br> ## Model Details Qwen2 is a language model series including decoder language models of different model sizes. For each size, we release the base language model and the aligned chat model. It is based on the Transformer architecture with SwiGLU activation, attention QKV bias, group query attention, etc. Additionally, we have an improved tokenizer adaptive to multiple natural languages and codes. ## Requirements The code of Qwen2 has been in the latest Hugging face transformers and we advise you to install `transformers>=4.37.0`, or you might encounter the following error: ``` KeyError: 'qwen2' ``` ## Usage We do not advise you to use base language models for text generation. Instead, you can apply post-training, e.g., SFT, RLHF, continued pretraining, etc., on this model. ## Performance The evaluation of base models mainly focuses on the model performance of natural language understanding, general question answering, coding, mathematics, scientific knowledge, reasoning, multilingual capability, etc. The datasets for evaluation include: **English Tasks**: MMLU (5-shot), MMLU-Pro (5-shot), GPQA (5shot), Theorem QA (5-shot), BBH (3-shot), HellaSwag (10-shot), Winogrande (5-shot), TruthfulQA (0-shot), ARC-C (25-shot) **Coding Tasks**: EvalPlus (0-shot) (HumanEval, MBPP, HumanEval+, MBPP+), MultiPL-E (0-shot) (Python, C++, JAVA, PHP, TypeScript, C#, Bash, JavaScript) **Math Tasks**: GSM8K (4-shot), MATH (4-shot) **Chinese Tasks**: C-Eval(5-shot), CMMLU (5-shot) **Multilingual Tasks**: Multi-Exam (M3Exam 5-shot, IndoMMLU 3-shot, ruMMLU 5-shot, mMMLU 5-shot), Multi-Understanding (BELEBELE 5-shot, XCOPA 5-shot, XWinograd 5-shot, XStoryCloze 0-shot, PAWS-X 5-shot), Multi-Mathematics (MGSM 8-shot), Multi-Translation (Flores-101 5-shot) #### Qwen2-0.5B & Qwen2-1.5B performances | Datasets | Phi-2 | Gemma-2B | MiniCPM | Qwen1.5-1.8B | Qwen2-0.5B | Qwen2-1.5B | | :--------| :---------: | :------------: | :------------: |:------------: | :------------: | :------------: | |#Non-Emb Params | 2.5B | 2.0B | 2.4B | 1.3B | 0.35B | 1.3B | |MMLU | 52.7 | 42.3 | 53.5 | 46.8 | 45.4 | **56.5** | |MMLU-Pro | - | 15.9 | - | - | 14.7 | 21.8 | |Theorem QA | - | - | - |- | 8.9 | **15.0** | |HumanEval | 47.6 | 22.0 |**50.0**| 20.1 | 22.0 | 31.1 | |MBPP | **55.0** | 29.2 | 47.3 | 18.0 | 22.0 | 37.4 | |GSM8K | 57.2 | 17.7 | 53.8 | 38.4 | 36.5 | **58.5** | |MATH | 3.5 | 11.8 | 10.2 | 10.1 | 10.7 | **21.7** | |BBH | **43.4** | 35.2 | 36.9 | 24.2 | 28.4 | 37.2 | |HellaSwag | **73.1** | 71.4 | 68.3 | 61.4 | 49.3 | 66.6 | |Winogrande | **74.4** | 66.8 | -| 60.3 | 56.8 | 66.2 | |ARC-C | **61.1** | 48.5 | -| 37.9 | 31.5 | 43.9 | |TruthfulQA | 44.5 | 33.1 | -| 39.4 | 39.7 | **45.9** | |C-Eval | 23.4 | 28.0 | 51.1| 59.7 | 58.2 | **70.6** | |CMMLU | 24.2 | - | 51.1 | 57.8 | 55.1 | **70.3** | ## Citation If you find our work helpful, feel free to give us a cite. ``` @article{qwen2, title={Qwen2 Technical Report}, year={2024} } ```

cross-encoder/ms-marco-MiniLM-L-12-v2

cross-encoder

transformers

text-classification

--- license: apache-2.0 --- # Cross-Encoder for MS Marco This model was trained on the [MS Marco Passage Ranking](https://github.com/microsoft/MSMARCO-Passage-Ranking) task. The model can be used for Information Retrieval: Given a query, encode the query will all possible passages (e.g. retrieved with ElasticSearch). Then sort the passages in a decreasing order. See [SBERT.net Retrieve & Re-rank](https://www.sbert.net/examples/applications/retrieve_rerank/README.html) for more details. The training code is available here: [SBERT.net Training MS Marco](https://github.com/UKPLab/sentence-transformers/tree/master/examples/training/ms_marco) ## Usage with Transformers ```python from transformers import AutoTokenizer, AutoModelForSequenceClassification import torch model = AutoModelForSequenceClassification.from_pretrained('model_name') tokenizer = AutoTokenizer.from_pretrained('model_name') features = tokenizer(['How many people live in Berlin?', 'How many people live in Berlin?'], ['Berlin has a population of 3,520,031 registered inhabitants in an area of 891.82 square kilometers.', 'New York City is famous for the Metropolitan Museum of Art.'], padding=True, truncation=True, return_tensors="pt") model.eval() with torch.no_grad(): scores = model(**features).logits print(scores) ``` ## Usage with SentenceTransformers The usage becomes easier when you have [SentenceTransformers](https://www.sbert.net/) installed. Then, you can use the pre-trained models like this: ```python from sentence_transformers import CrossEncoder model = CrossEncoder('model_name', max_length=512) scores = model.predict([('Query', 'Paragraph1'), ('Query', 'Paragraph2') , ('Query', 'Paragraph3')]) ``` ## Performance In the following table, we provide various pre-trained Cross-Encoders together with their performance on the [TREC Deep Learning 2019](https://microsoft.github.io/TREC-2019-Deep-Learning/) and the [MS Marco Passage Reranking](https://github.com/microsoft/MSMARCO-Passage-Ranking/) dataset. | Model-Name | NDCG@10 (TREC DL 19) | MRR@10 (MS Marco Dev) | Docs / Sec | | ------------- |:-------------| -----| --- | | **Version 2 models** | | | | cross-encoder/ms-marco-TinyBERT-L-2-v2 | 69.84 | 32.56 | 9000 | cross-encoder/ms-marco-MiniLM-L-2-v2 | 71.01 | 34.85 | 4100 | cross-encoder/ms-marco-MiniLM-L-4-v2 | 73.04 | 37.70 | 2500 | cross-encoder/ms-marco-MiniLM-L-6-v2 | 74.30 | 39.01 | 1800 | cross-encoder/ms-marco-MiniLM-L-12-v2 | 74.31 | 39.02 | 960 | **Version 1 models** | | | | cross-encoder/ms-marco-TinyBERT-L-2 | 67.43 | 30.15 | 9000 | cross-encoder/ms-marco-TinyBERT-L-4 | 68.09 | 34.50 | 2900 | cross-encoder/ms-marco-TinyBERT-L-6 | 69.57 | 36.13 | 680 | cross-encoder/ms-marco-electra-base | 71.99 | 36.41 | 340 | **Other models** | | | | nboost/pt-tinybert-msmarco | 63.63 | 28.80 | 2900 | nboost/pt-bert-base-uncased-msmarco | 70.94 | 34.75 | 340 | nboost/pt-bert-large-msmarco | 73.36 | 36.48 | 100 | Capreolus/electra-base-msmarco | 71.23 | 36.89 | 340 | amberoad/bert-multilingual-passage-reranking-msmarco | 68.40 | 35.54 | 330 | sebastian-hofstaetter/distilbert-cat-margin_mse-T2-msmarco | 72.82 | 37.88 | 720 Note: Runtime was computed on a V100 GPU.

trpakov/vit-face-expression

trpakov

transformers

image-classification

--- {} --- # Vision Transformer (ViT) for Facial Expression Recognition Model Card ## Model Overview - **Model Name:** [trpakov/vit-face-expression](https://huggingface.co/trpakov/vit-face-expression) - **Task:** Facial Expression/Emotion Recognition - **Dataset:** [FER2013](https://www.kaggle.com/datasets/msambare/fer2013) - **Model Architecture:** [Vision Transformer (ViT)](https://huggingface.co/docs/transformers/model_doc/vit) - **Finetuned from model:** [vit-base-patch16-224-in21k](https://huggingface.co/google/vit-base-patch16-224-in21k) ## Model Description The vit-face-expression model is a Vision Transformer fine-tuned for the task of facial emotion recognition. It is trained on the FER2013 dataset, which consists of facial images categorized into seven different emotions: - Angry - Disgust - Fear - Happy - Sad - Surprise - Neutral ## Data Preprocessing The input images are preprocessed before being fed into the model. The preprocessing steps include: - **Resizing:** Images are resized to the specified input size. - **Normalization:** Pixel values are normalized to a specific range. - **Data Augmentation:** Random transformations such as rotations, flips, and zooms are applied to augment the training dataset. ## Evaluation Metrics - **Validation set accuracy:** 0.7113 - **Test set accuracy:** 0.7116 ## Limitations - **Data Bias:** The model's performance may be influenced by biases present in the training data. - **Generalization:** The model's ability to generalize to unseen data is subject to the diversity of the training dataset.

AIDA-UPM/star

AIDA-UPM

transformers

feature-extraction

--- pipeline_tag: feature-extraction --- # Style Transformer for Authorship Representations - STAR This is the repository for the [Style Transformer for Authorship Representations (STAR)](https://arxiv.org/abs/2310.11081) model. We present the weights of our model here. Also check out our [github repo for STAR](https://github.com/jahuerta92/star) for replication. ## Feature extraction ```python tokenizer = AutoTokenizer.from_pretrained('roberta-large') model = AutoModel.from_pretrained('AIDA-UPM/star') examples = ['My text 1', 'This is another text'] def extract_embeddings(texts): encoded_texts = tokenizer(texts) with torch.no_grad(): style_embeddings = model(encoded_texts.input_ids, attention_mask=encoded_texts.attention_mask).pooler_output return style_embeddings print(extract_embeddings(examples)) ``` ## Citation ``` @article{Huertas-Tato2023Oct, author = {Huertas-Tato, Javier and Martin, Alejandro and Camacho, David}, title = {{Understanding writing style in social media with a supervised contrastively pre-trained transformer}}, journal = {arXiv}, year = {2023}, month = oct, eprint = {2310.11081}, doi = {10.48550/arXiv.2310.11081} } ```

NbAiLab/nb-wav2vec2-300m-nynorsk

NbAiLab

transformers

automatic-speech-recognition

--- license: apache-2.0 tags: - automatic-speech-recognition datasets: - NbAiLab/NPSC language: - nn model-index: - name: nb-wav2vec2-300m-nynorsk results: - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: NPSC type: NbAiLab/NPSC args: 16K_mp3_nynorsk metrics: - name: Test (Nynorsk) WER type: wer value: 0.1222 - name: Test (Nynorsk) CER type: cer value: 0.0419 --- # Norwegian Wav2Vec2 Model - 300M - VoxRex - Nynorsk This model is finetuned on top of feature extractor [VoxRex-model](https://huggingface.co/KBLab/wav2vec2-large-voxrex) from the National Library of Sweden. The finetuned model achieves the following results on the test set with a 5-gram KenLM. The numbers in parentheses are the results without the language model: - **WER: 0.1222** (0.1537) - **CER: 0.0419** (0.0468) ## Model description This is one of several Wav2Vec-models our team created during the 🤗 hosted [Robust Speech Event](https://discuss.huggingface.co/t/open-to-the-community-robust-speech-recognition-challenge/13614?s=09). This is the complete list of our models and their final scores: | Model | Final WER | | |:--------------|:------------|:------------:| | [NbAiLab/nb-wav2vec2-1b-bokmaal](https://huggingface.co/NbAiLab/nb-wav2vec2-1b-bokmaal) | 6.33 | | | [NbAiLab/nb-wav2vec2-300m-bokmaal](https://huggingface.co/NbAiLab/nb-wav2vec2-300m-bokmaal) | 7.03 | | | [NbAiLab/nb-wav2vec2-1b-nynorsk](https://huggingface.co/NbAiLab/nb-wav2vec2-1b-nynorsk) | 11.32 | | | NbAiLab/nb-wav2vec2-300m-nynorsk (this model) | 12.22 | | ### Dataset In parallel with the event, the team also converted the [Norwegian Parliamentary Speech Corpus (NPSC)](https://www.nb.no/sprakbanken/en/resource-catalogue/oai-nb-no-sbr-58/) to the [NbAiLab/NPSC](https://huggingface.co/datasets/NbAiLab/NPSC) in 🤗 Dataset format and used that as the main source for training. ## Code We have released all the code developed during the event so that the Norwegian NLP community can build upon it when developing even better Norwegian ASR models. The finetuning of these models is not very computationally demanding. After following the instructions here, you should be able to train your own automatic speech recognition system in less than a day with an average GPU. ## Team The following people contributed to building this model: Rolv-Arild Braaten, Per Egil Kummervold, Andre Kåsen, Javier de la Rosa, Per Erik Solberg, and Freddy Wetjen. ## Training procedure To reproduce these results, we strongly recommend that you follow the [instructions from 🤗](https://github.com/huggingface/transformers/tree/master/examples/research_projects/robust-speech-event#talks) to train a simple Swedish model. When you have verified that you are able to do this, create a fresh new repo. You can then start by copying the files ```run.sh``` and ```run_speech_recognition_ctc.py``` from our repo. Running these will create all the other necessary files, and should let you reproduce our results. With some tweaks to the hyperparameters, you might even be able to build an even better ASR. Good luck! ### Language Model As the scores indicate, adding even a simple 5-gram language will improve the results. 🤗 has provided another [very nice blog](https://huggingface.co/blog/wav2vec2-with-ngram) explaining how to add a 5-gram language model to improve the ASR model. You can build this from your own corpus, for instance by extracting some suitable text from the [Norwegian Colossal Corpus](https://huggingface.co/datasets/NbAiLab/NCC). You can also skip some of the steps in the guide, and copy the [5-gram model from this repo](https://huggingface.co/NbAiLab/XLSR-300M-bokmaal/tree/main/language_model). ### Parameters The final model was run using these parameters: ``` --dataset_name="NbAiLab/NPSC" --model_name_or_path="KBLab/wav2vec2-large-voxrex" --dataset_config_name="16K_mp3_nynorsk" --output_dir="./" --overwrite_output_dir --num_train_epochs="80" --per_device_train_batch_size="16" --per_device_eval_batch_size="16" --gradient_accumulation_steps="2" --learning_rate="1e-4" --warmup_steps="2000" --length_column_name="input_length" --evaluation_strategy="steps" --text_column_name="text" --save_steps="500" --eval_steps="500" --logging_steps="100" --layerdrop="0.041" --attention_dropout="0.094" --activation_dropout="0.055" --hidden_dropout="0.047" --save_total_limit="3" --freeze_feature_encoder --feat_proj_dropout="0.04" --mask_time_prob="0.082" --mask_time_length="10" --mask_feature_prob="0.25" --mask_feature_length="64" --gradient_checkpointing --min_duration_in_seconds="0.5" --max_duration_in_seconds="30.0" --use_auth_token --seed="42" --fp16 --group_by_length --do_train --do_eval --push_to_hub --preprocessing_num_workers="32" ``` Using these settings, the training might take 3-4 days on an average GPU. You can, however, get a decent model and faster results by tweaking these parameters. | Parameter| Comment | |:-------------|:-----| | per_device_train_batch_size | Adjust this to the maximum of available memory. 16 or 24 might be good settings depending on your system | |gradient_accumulation_steps |Can be adjusted even further up to increase batch size and speed up training without running into memory issues | | learning_rate|Can be increased, maybe as high as 1e-4. Speeds up training but might add instability | | epochs| Can be decreased significantly. This is a huge dataset and you might get a decent result already after a couple of epochs| ## Citation ```bibtex @inproceedings{de-la-rosa-etal-2023-boosting, title = "Boosting {N}orwegian Automatic Speech Recognition", author = "De La Rosa, Javier and Braaten, Rolv-Arild and Kummervold, Per and Wetjen, Freddy", booktitle = "Proceedings of the 24th Nordic Conference on Computational Linguistics (NoDaLiDa)", month = may, year = "2023", address = "T{\'o}rshavn, Faroe Islands", publisher = "University of Tartu Library", url = "https://aclanthology.org/2023.nodalida-1.55", pages = "555--564", abstract = "In this paper, we present several baselines for automatic speech recognition (ASR) models for the two official written languages in Norway: Bokm{\aa}l and Nynorsk. We compare the performance of models of varying sizes and pre-training approaches on multiple Norwegian speech datasets. Additionally, we measure the performance of these models against previous state-of-the-art ASR models, as well as on out-of-domain datasets. We improve the state of the art on the Norwegian Parliamentary Speech Corpus (NPSC) from a word error rate (WER) of 17.10{\%} to 7.60{\%}, with models achieving 5.81{\%} for Bokm{\aa}l and 11.54{\%} for Nynorsk. We also discuss the challenges and potential solutions for further improving ASR models for Norwegian.", } ``` See https://arxiv.org/abs/2307.01672

MoritzLaurer/DeBERTa-v3-base-mnli-fever-anli

MoritzLaurer

transformers

zero-shot-classification

--- language: - en license: mit tags: - text-classification - zero-shot-classification datasets: - multi_nli - facebook/anli - fever metrics: - accuracy pipeline_tag: zero-shot-classification model-index: - name: MoritzLaurer/DeBERTa-v3-base-mnli-fever-anli results: - task: type: natural-language-inference name: Natural Language Inference dataset: name: anli type: anli config: plain_text split: test_r3 metrics: - type: accuracy value: 0.495 name: Accuracy verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiYWViYjQ5YTZlYjU4NjQyN2NhOTVhNjFjNGQyMmFiNmQyZjRkOTdhNzJmNjc3NGU4MmY0MjYyMzY5MjZhYzE0YiIsInZlcnNpb24iOjF9.S8pIQ7gEGokd_wKXMi6Bc3B2DThIP3cvVkTFErZ-2JxXTSCy1TBuulY3dzGfaiP7kTHbL52OuBhG_-wb7Ue9DQ - type: precision value: 0.4984740618243923 name: Precision Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiOTllZDU3NmVmYjk4ZmYzNjAwNzExMGZjNDMzOWRkZjRjMTRhNzhlZmI0ZmNlM2E0Mzk4OWE5NTM5MTYyYWU5NCIsInZlcnNpb24iOjF9.WHz_TUJgPVn-rU-9vBCDdmSMOuWzADwr09rJY6ktqRM46zytbyWs7Vcm7jqDrTkfU-rp0_7IyoNv_xEsKhJbBA - type: precision value: 0.495 name: Precision Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiZjllODE3ZjUxZDhiMTI0MzZmYjY5OTUwYWI2OTc4ZjJhNTVjMjY2ODdkMmJlZjQ5YWQ1Mjk2ZThmYjJlM2RlYSIsInZlcnNpb24iOjF9.a9V06-O7l9S0Bv4vj0aard8128SAP61DZdXl_3XqdmNgt_C6KAoDBVueF2M2kF_kT6lRfEz6YW0ACIfJNXDYAA - type: precision value: 0.4984357572868885 name: Precision Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNjhiMzYzY2JiMmYwN2YxYzEwZTQ3NGI1NzFmMzliNjJkMDE2YzI5Njg1ZjEzMGIxODdiMDNmYmI4Y2Y2MmJkMiIsInZlcnNpb24iOjF9.xvZZaUMogw9MJjb3ls6h5liDlTqHMmNgqk6KbyDqQWfCcD255brCU3Xo6nECwaChS4te0dQu_iWGBqR_o2kYAA - type: recall value: 0.49461028192371476 name: Recall Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiZDVjYTEzOTI0ZjVhOTk3ZTkzZmZhNTk5ODcxMWJhYWU4ZTRjYWVhNzcwOWY5YmI2NGFlYWE4NjM5MDY5NTExOSIsInZlcnNpb24iOjF9.xgHCB2rbCQBzHzUokw4u8JyOdhtF4yvPv1t8t7YiEkaAuM5MAPsVuCZ1VtlLapHS_IWetlocizsVl6akjh3cAQ - type: recall value: 0.495 name: Recall Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiYTEyYmM0ZDQ0M2RiMDNhNjIxNzQ4OWZiNTBiOTAwZDFkNjNmYjBhNjA4NmQ0NjFkNmNiZTljNDkxNDg3NzIyYSIsInZlcnNpb24iOjF9.3FJPwNtwgFNvMjVxVAayaVXXR1sWlr0sqAYmXzmMzMxl7IJh6RS77dGPwFaqD3jamLVBiqPn9wsfz5lFK5yTAA - type: recall value: 0.495 name: Recall Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNmY1MjZlZTQ4OTg5YzdlYmFhZDMzMmNlNjNkYmIyZGI4M2NjZjQ1ZDVkNmZkMTUxNjI3M2UwZmI1MDM1NDYwOSIsInZlcnNpb24iOjF9.cnbM6xjTLRa9z0wEDGd_Q4lTXVLRKIQ6_YLGLjf-t7Nto4lzxAeWF-RrwA0Mq9OPITlJq2Jk1Eg_0Utb13d9Dg - type: f1 value: 0.4942810999491704 name: F1 Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiN2U3NGM1MDM4YTM4NzQxMGM4ZTIyZDM2YTQ1MGNlZWM1MzEzM2MxN2ZmZmRmYTM0OWJmZGJjYjM5OWEzMmZjNSIsInZlcnNpb24iOjF9.vMtge1F-tmMn9D3aVUuwcNEXjqpNgEyHAl9f5UDSoTYcOgTwi2vi5yRGRCl8y6Fx7BtgaCwMyoZVNbP5-GRtCA - type: f1 value: 0.495 name: F1 Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNjBjMTQ5MmQ5OGE5OWJjZGMyNzg4N2RmNDUzMzQ5Zjc4ZTc4N2JlMTk0MTc2M2RjZTgzOTNlYWQzODAwNDI0NCIsInZlcnNpb24iOjF9.yxXG0CNWW8__xJC14BjbTY9QkXD75x6uCIXR51oKDemkP0b_xGyd-A2wPIuwNJN1EYkQevPY0bhVpRWBKyO9Bg - type: f1 value: 0.4944671868893595 name: F1 Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMzczNjQzY2FmMmY4NTAwYjNkYjJlN2I2NjI2Yjc0ZmQ3NjZiN2U5YWEwYjk4OTUyOTMzZTYyZjYzOTMzZGU2YiIsInZlcnNpb24iOjF9.mLOnst2ScPX7ZQwaUF12W2nv7-w9lX9-BxHl3-0T0gkSWnmtBSwYcL5faTX0_I5q33Fjz5tfkjpCJuxP5JYIBQ - type: loss value: 1.8788293600082397 name: loss verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMzRlOTYwYjU1Y2Y4ZGM0NDBjYTE2MmEzNWIwN2NiMWVkOWZlNzA2ZmQ3YjZjNzI4MjQwYWZhODIwMzU3ODAyZiIsInZlcnNpb24iOjF9._Xs9bl48MSavvp5eyamrP2iNlFWv35QZCrmWjJXLkUdIBx0ElCjEdxBb3dxPGnUxdpDzGMmOoKCPI44ZPXrtDw - task: type: natural-language-inference name: Natural Language Inference dataset: name: anli type: anli config: plain_text split: test_r1 metrics: - type: accuracy value: 0.712 name: Accuracy verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiYWYxMGY0ZWU0YTEyY2I3NmQwZmQ3YmFmNzQxNGU5OGNjN2ViN2I0ZjdkYWUzM2RmYzkzMDg3ZjVmNGYwNGZkZCIsInZlcnNpb24iOjF9.snWBusAeo1rrQqWk--vTxb-CBcFqM298YCtwTQGBZiFegKGSTSKzj-SM6HMNsmoQWmMuv7UfYPqYlnzEthOSAg - type: precision value: 0.7134839439315348 name: Precision Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNjMxMjg1Y2QwNzMwM2ZkNGM3ZTJhOGJmY2FkNGI1ZTFhOGQ3ODViNTJmZTYwMWJkZDYyYWRjMzFmZDI1NTM5YSIsInZlcnNpb24iOjF9.ZJnY6zYOBn-YEtN7uKzQ-VKXPwlIO1zq19Yuo37vBJNSs1dGDd8f1jgfdZuA19e_wA3Nc5nQKe9VXRwPHPgwAQ - type: precision value: 0.712 name: Precision Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiZWM4YWQyODBlYTIwMWQxZDA1NmY1M2M2ODgwNDJiY2RhMDVhYTlkMDUzZTJkMThkYzRmNDg2YTdjMjczNGUwOCIsInZlcnNpb24iOjF9.SogsKHdbdlEs05IBYwXvlnaC_esg-DXAPc2KPRyHaVC5ItVHbxa63NpybSpao4baOoMlLG9aRe7TjG4gtB2dAQ - type: precision value: 0.7134676028447461 name: Precision Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiODdjMzFkM2IwNWZiM2I4ZWViMmQ4NWM5MDY5ZWQxZjc1MGRmNjhmNzJhYWFmOWEwMjg3ZjhiZWM3YjlhOTIxNSIsInZlcnNpb24iOjF9._0JNIbiqLuDZrp_vrCljBe28xexZJPmigLyhkcO8AtH2VcNxWshwCpZuRF4bqvpMvnApJeuGMf3vXjCj0MC1Bw - type: recall value: 0.7119814425203647 name: Recall Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiYjU4MWEyMzkyYzg1ZTIxMTc0M2NhMTgzOGEyZmY5OTg3M2Q1ZmMwNmU3ZmU1ZjA1MDk0OGZkMzM5NDVlZjBlNSIsInZlcnNpb24iOjF9.sZ3GTcmGGthpTLL7_Zovq8aBmE3Dp_PZi5v8ZI9yG9N6B_GjWvBuPC8ENXK1NwmwiHLsSvtKTG5JmAum-su0Dg - type: recall value: 0.712 name: Recall Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiZDg3NGViZTlmMWM2ZDNhMzIzZGZkYWZhODQxNzg2MjNiNjQ0Zjg0NjQ1OWZkY2I5ODdiY2Y3Y2JjNzRmYjJkMiIsInZlcnNpb24iOjF9.bCZUzJamsozKWehnNph6E5coww5zZTrJdbWevWrSyfT0PyXc_wkZ-NKdyBAoqprBz3_8L3i5hPM6Qsy56b4BDA - type: recall value: 0.712 name: Recall Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMDk1MDJiOGUzZThlZjJjMzY4NjMzODFiZjUzZmIwMjIxY2UwNzBiN2IxMWEwMGJjZTkxODA0YzUxZDE3ODRhOCIsInZlcnNpb24iOjF9.z0dqvB3aBVYt3xRIb_M4svWebfQc0QaDFVFzHnlA5QGEHkHOW3OecGhHE4EzBqTDI3DASWZTGMjrMDDt0uOMBw - type: f1 value: 0.7119226991285647 name: F1 Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiM2U0YjMwNzhmOTEyNDZhODU3MTU0YTM4MmQ0NzEzNWI1YjY0ZWQ3MWRiMTdiNTUzNWRkZThjMWE4M2NkZmI0MiIsInZlcnNpb24iOjF9.hhj1BXkuWi9wXrCjT9NwqaPETtOoYNiyqYsJEw-ufA8A4hVThKA6ZBtma1Q_M65-DZFfPEBDBNASLZ7EPSbmDw - type: f1 value: 0.712 name: F1 Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiODk0Y2EyMzc5M2ZlNWFlNDg2Zjc1OTQxNGY3YjA5YjUxYTYzZjRlZmU4ODYxNjA3ZjkxNGUzYjBmNmMxMzY5YiIsInZlcnNpb24iOjF9.DvKk-3hNh2LhN2ug5e0FgUntL3Ozdfl06Kz7jvmB-deOJH6INi2a2ZySXoEePoo8t2nR6ENFYu9QjMA2ojnpCA - type: f1 value: 0.7119242267218338 name: F1 Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiN2MxOWFlMmI2NGRiMjkwN2Q5MWZhNDFlYzQxNWNmNzQ3OWYxZThmNDU2OWU1MTE5OGY2MWRlYWUyNDM3OTkzZCIsInZlcnNpb24iOjF9.QrTD1gE8_wRok9u59W-Mx0cX89K-h2Ad6qa8J5rmP8lc_rkG0ft2n5_GqH1CBZBJwMFYv91Pn6TuE3eGxJuUDA - type: loss value: 1.0105403661727905 name: loss verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMmUwMTg4NjM3ZTBiZTIyODcyNDNmNTE5ZDZhMzNkMDMyNjcwOGQ5NmY0NTlhMjgyNmIzZjRiNDFiNjA3M2RkZSIsInZlcnNpb24iOjF9.sjBDVJV-jnygwcppmByAXpoo-Wzz178bBzozJEuYEiJaHSbk_xEevfJS1PmLUuplYslKb1iyEctnjI-5bl-XDw - task: type: natural-language-inference name: Natural Language Inference dataset: name: multi_nli type: multi_nli config: default split: validation_mismatched metrics: - type: accuracy value: 0.902766476810415 name: Accuracy verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMjExZWM3YzA3ZDNlNjEwMmViNWEwZTE3MjJjNjEyNDhjOTQxNGFmMzBjZTk0ODUwYTc2OGNiZjYyMTBmNWZjZSIsInZlcnNpb24iOjF9.zbFAGrv2flpmweqS7Poxib7qHFLdW8eUTzshdOm2B9H-KWpIZCWC-P4p8TLMdNJnUcZJZ03Okil4qjIMqqIRCA - type: precision value: 0.9023816542652491 name: Precision Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiN2U2MGViNmJjNWQxNzRjOTkxNDIxZjZjNmM5YzE4ZjU5NTE5NjFlNmEzZWRlOGYxN2E3NTAwMTEwYjNhNzE0YSIsInZlcnNpb24iOjF9.WJjDJf56FROvf7Y5ShWnnxMvK_ZpQ2PibAOtSFhSiYJ7bt4TGOzMwaZ5RSTf_mcfXgRfWbXmy1jCwNhDb-5EAw - type: precision value: 0.902766476810415 name: Precision Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiYzRhZTExOTc5NDczZjI1YmMzOGYyOTU2MDU1OGE5ZTczMDE0MmU0NzZhY2YzMDI1ZGQ3MGM5MmJiODFkNzUzZiIsInZlcnNpb24iOjF9.aRYcGEI1Y8-a0d8XOoXhBgsFyj9LWNwEjoIPc594y7kJn91wXIsXoR0-_0iy3uz41mWaTTlwJx7lI-kipFDvDQ - type: precision value: 0.9034597464719761 name: Precision Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMWQyMTZiZDA2OTUwZjRmNTFiMWRlZTNmOTliZmI2MWFmMjdjYzEyYTgwNzkyOTQzOTBmNTUyYjMwNTUxMTFkNiIsInZlcnNpb24iOjF9.hUtAMTl0THHUkaLcgk1Vy9IhjqJAXCJ_5STJ5A7k7s_SO9DHp3b6qusgwPmcGLYyPy1-j1dB2AIstxK4tHfmDA - type: recall value: 0.9024304801555488 name: Recall Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMzAxZGJhNGI3ZDNlMjg2ZDIxNTgwMDY5MTFjM2ExZmIxMDBmZjUyNTliNWNkOGI0OTY3NTYyNWU3OWFlYTA3YiIsInZlcnNpb24iOjF9.1o_GNq8zmXa_50MUF_K63IDc2aUKNeUkNQ5fT592-SAo8WgiaP9Dh6bOEu2OqrpRQ57P4qm7OdJt7UKsrosMDA - type: recall value: 0.902766476810415 name: Recall Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiZjhiMWE4Yjk0ODFkZjlkYjRlMjU1OTJmMjA2Njg1N2M4MzQ0OWE3N2FlYjY4NDgxZThjMmExYWQ5OGNmYmI1NSIsInZlcnNpb24iOjF9.Gmm5lf_qpxjXWWrycDze7LHR-6WGQc62WZTmcoc5uxWd0tivEUqCAFzFdbEU1jVKxQBIyDX77CPuBm7mUA4sCg - type: recall value: 0.902766476810415 name: Recall Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiY2EzZWYwNjNkYWE1YTcyZGZjNTNhMmNlNzgzYjk5MGJjOWJmZmE5NmYwM2U2NTA5ZDY3ZjFiMmRmZmQwY2QwYiIsInZlcnNpb24iOjF9.yA68rslg3e9kUR3rFTNJJTAad6Usr4uFmJvE_a7G2IvSKqLxG_pqsHszsWfg5mFBQLjWEAyCtdQYMdVayuYMBA - type: f1 value: 0.9023086094638595 name: F1 Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMzMyMzZhNjI5MWRmZWJhMjkzN2E0MjM4ZTM5YzZmNTk5YTZmYzU4NDRiYjczZGQ4MDdhNjJiMGU0MjE3NDEwNyIsInZlcnNpb24iOjF9.RCMqH_xUMN97Vos54pTFfAMbLstXUMdFTs-eNaypbDb_Fc-MW8NLmJ6dzJsp9sSvhXyYjugjRMUpMpnQseKXDA - type: f1 value: 0.902766476810415 name: F1 Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiZTYxZTZhZGM0NThlNTAzNmYwMTA4NDNkN2FiNzhhN2RlYThlYjcxMjE5MjBkMzhiOGYxZGRmMjE0NGM2ZWQ5ZSIsInZlcnNpb24iOjF9.wRfllNw2Gibmi1keU7d_GjkyO0F9HESCgJlJ9PHGZQRRT414nnB-DyRvulHjCNnaNjXqMi0LJimC3iBrNawwAw - type: f1 value: 0.9030161011457231 name: F1 Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNDA0YjAxMWU5MjI4MWEzNTNjMzJlNjM3ZDMxOTE0ZTZhYmZlNmUyNDViNTU2NmMyMmM3MjAxZWVjNWJmZjI4MCIsInZlcnNpb24iOjF9.vJ8aUjfTbFMc1BgNUVpoVDuYwQJYQjwZQxblkUdvSoGtkW_AzQJ_KJ8Njc7IBA3ADgj8iZHjRQNIZkFCf-xICw - type: loss value: 0.3283354640007019 name: loss verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiODdmYzYzNTUzZDNmOWIxM2E0ZmUyOWUzM2Y2NGRmZDNiYjg3ZTMzYTUyNzg3OWEzNzYyN2IyNmExOGRlMWUxYSIsInZlcnNpb24iOjF9.Qv0FzFZPkcBs9aHGf4TEREX4jdkc40NazdMlP2M_-w2wHwyjoAjvhk611RLXHcbicozNelZJLnsOMdEMnPLEDg - task: type: natural-language-inference name: Natural Language Inference dataset: name: anli type: anli config: plain_text split: dev_r1 metrics: - type: accuracy value: 0.737 name: Accuracy verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMTQ1ZGVkOTVmNTlhYjhkMjVlNTNhMjNmZWFjZWZjZjcxZmRhMDVlOWI0YTdkOTMwYjVjNWFlOGY4OTc1MmRhNiIsInZlcnNpb24iOjF9.wGLgKA1E46ljbLokdPeip_UCr1gqK8iSSbsJKX2vgKuuhDdUWWiECrUFN-bv_78JWKoKW5T0GF_hb-RVDzA0AQ - type: precision value: 0.737681071614645 name: Precision Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiYmFkMGUwMjNhN2E3NzMxNTc5NDM0MjY1MGU5ODllM2Q2YzA1MDI3OGI1ZmI4YTcxN2E4ZDk5OWY2OGNiN2I0MCIsInZlcnNpb24iOjF9.6G5qhccjheaNfasgRyrkKBTaQPRzuPMZZ0hrLxTNzAydMDgx09FkFP3hni7WLRMWp0IpwzkEeBlxV-mPyQBtBw - type: precision value: 0.737 name: Precision Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiN2QzYjQ4ZDZjOGU5YzI3YmFlMThlYTRkYTUyYWIyNzc4NDkwNzM1OWFiMTgyMzA0NDZmMGI3YTQxODBjM2EwMCIsInZlcnNpb24iOjF9.bvNWyzfct1CLJFx_EuD2GeKieVtyGJy0cwUBP2qJE1ey2i9SVn6n1Dr0AALTGBkxQ6n5-fJ61QFNufpdr2KvCA - type: precision value: 0.7376755842752241 name: Precision Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiN2VmYWYzZWQwZmMzMDk0NTdlY2Y3NDkzYWY5ZTdmOGU0ZTUzZWE4YWFhZjVmODhkZmE1Njg4NjA5YjJmYWVhOSIsInZlcnNpb24iOjF9.50FQR2aoBpORLgYa7482ZTrRhT-KfIgv5ltBEHndUBMmqGF9Ru0LHENSGwyD_tO89sGPfiW32TxpbrNWiBdIBA - type: recall value: 0.7369675064285843 name: Recall Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiZTM4OTAyNDYwNjY4Zjc5NDljNjBmNTg2Mzk4YjYxM2MyYTA0MDllYTMyNzEwOGI1ZTEwYWE3ZmU0NDZmZDg2NiIsInZlcnNpb24iOjF9.UvWBxuApNV3vd4hpgwqd6XPHCbkA_bB_Cw24ooquiOf0dstvjP3JvpGoDp5SniOzIOg3i2aYbcvFCLJqEXMZCQ - type: recall value: 0.737 name: Recall Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiYmQ4MjMzNzRmNTI5NjIzNGQ0ZDFmZTA1MDU3OTk0MzYyMGI0NTMzZTZlMTQ1MDc1MzBkMGMzYjcxZjU1NDNjOSIsInZlcnNpb24iOjF9.kpbdXOpDG3CUB-kUEXsgFT3HWWIbu70wwzs2TNf0rhIuRrzdZz3dXXvwqu1BcLJTsOxl8G6NTiYXgnv-ul8lDg - type: recall value: 0.737 name: Recall Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNmU1ZWJkNWE0NjczY2NiZWYyNzYyMzllNzZmZTIxNWRkYTEyZDgxN2E0NTNmM2ExMTc1ZWVjMzBiYjg0ZmM1MiIsInZlcnNpb24iOjF9.S6HHWCWnut_LJqXbEA_Z8ZOTtyq6V51ZeiA0qbwzr0hapDYZOZHrN4prvSLvoNv-GiYDYKatwIsAZxCZc5fmCA - type: f1 value: 0.7366853496239583 name: F1 Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNzkxYmY2NTcyOTE0ZDdjNGY2ZmE4MzQwMGIxZTA2MDg1NzI5YTQ0MTdkZjdkNzNkMDM2NTk2MTNiNjU4ODMwZCIsInZlcnNpb24iOjF9.ECVaCBqGd0pnQT3xJF7yWrgecIb-5TMiVWpEO0MQGhYy43snkI6Qs-2FOXzvfwIWqG-Q6XIIhGbWZh5TFEGKCA - type: f1 value: 0.737 name: F1 Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNDMwMWZiNzQyNWEzNmMzMDJjOTAxYzAxNzc0MTNlYzRkZjllYmNjZmU0OTgzZDFkNWM1ZWI5OTA2NzE5Y2YxOSIsInZlcnNpb24iOjF9.8yZFol_Gcj9n3w9Yk5wx48yql7p3wriDecv-6VSTAB6Q_MWLQAWsCEGRRhgGJ3zvhoRehJZdb35ozk36VOinDQ - type: f1 value: 0.7366990292378379 name: F1 Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMjhhN2ZkMjc5ZGQ3ZGM1Nzk3ZTgwY2E1N2NjYjdhNjZlOTdhYmRlNGVjN2EwNTIzN2UyYTY2ODVlODhmY2Q4ZCIsInZlcnNpb24iOjF9.Cz7ClDAfCGpqdRTYd5v3dPjXFq8lZLXx8AX_rqmF-Jb8KocqVDsHWeZScW5I2oy951UrdMpiUOLieBuJLOmCCQ - type: loss value: 0.9349392056465149 name: loss verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNmI4MTI5MDM1NjBmMzgzMzc2NjM5MzZhOGUyNTgyY2RlZTEyYTIzYzY2ZGJmODcxY2Q5OTVjOWU3OTQ2MzM1NSIsInZlcnNpb24iOjF9.bSOFnYC4Y2y2pW1AR-bgPUHKafR-0OHf8PvexK8eQLsS323Xy9-rYkKUaP09KY6_fk9GqAawv5eqj72B_uyeCA --- # DeBERTa-v3-base-mnli-fever-anli ## Model description This model was trained on the MultiNLI, Fever-NLI and Adversarial-NLI (ANLI) datasets, which comprise 763 913 NLI hypothesis-premise pairs. This base model outperforms almost all large models on the [ANLI benchmark](https://github.com/facebookresearch/anli). The base model is [DeBERTa-v3-base from Microsoft](https://huggingface.co/microsoft/deberta-v3-base). The v3 variant of DeBERTa substantially outperforms previous versions of the model by including a different pre-training objective, see annex 11 of the original [DeBERTa paper](https://arxiv.org/pdf/2006.03654.pdf). For highest performance (but less speed), I recommend using https://huggingface.co/MoritzLaurer/DeBERTa-v3-large-mnli-fever-anli-ling-wanli. ### How to use the model #### Simple zero-shot classification pipeline ```python #!pip install transformers[sentencepiece] from transformers import pipeline classifier = pipeline("zero-shot-classification", model="MoritzLaurer/DeBERTa-v3-base-mnli-fever-anli") sequence_to_classify = "Angela Merkel is a politician in Germany and leader of the CDU" candidate_labels = ["politics", "economy", "entertainment", "environment"] output = classifier(sequence_to_classify, candidate_labels, multi_label=False) print(output) ``` #### NLI use-case ```python from transformers import AutoTokenizer, AutoModelForSequenceClassification import torch device = torch.device("cuda") if torch.cuda.is_available() else torch.device("cpu") model_name = "MoritzLaurer/DeBERTa-v3-base-mnli-fever-anli" tokenizer = AutoTokenizer.from_pretrained(model_name) model = AutoModelForSequenceClassification.from_pretrained(model_name) premise = "I first thought that I liked the movie, but upon second thought it was actually disappointing." hypothesis = "The movie was good." input = tokenizer(premise, hypothesis, truncation=True, return_tensors="pt") output = model(input["input_ids"].to(device)) # device = "cuda:0" or "cpu" prediction = torch.softmax(output["logits"][0], -1).tolist() label_names = ["entailment", "neutral", "contradiction"] prediction = {name: round(float(pred) * 100, 1) for pred, name in zip(prediction, label_names)} print(prediction) ``` ### Training data DeBERTa-v3-base-mnli-fever-anli was trained on the MultiNLI, Fever-NLI and Adversarial-NLI (ANLI) datasets, which comprise 763 913 NLI hypothesis-premise pairs. ### Training procedure DeBERTa-v3-base-mnli-fever-anli was trained using the Hugging Face trainer with the following hyperparameters. ``` training_args = TrainingArguments( num_train_epochs=3, # total number of training epochs learning_rate=2e-05, per_device_train_batch_size=32, # batch size per device during training per_device_eval_batch_size=32, # batch size for evaluation warmup_ratio=0.1, # number of warmup steps for learning rate scheduler weight_decay=0.06, # strength of weight decay fp16=True # mixed precision training ) ``` ### Eval results The model was evaluated using the test sets for MultiNLI and ANLI and the dev set for Fever-NLI. The metric used is accuracy. mnli-m | mnli-mm | fever-nli | anli-all | anli-r3 ---------|----------|---------|----------|---------- 0.903 | 0.903 | 0.777 | 0.579 | 0.495 ## Limitations and bias Please consult the original DeBERTa paper and literature on different NLI datasets for potential biases. ## Citation If you use this model, please cite: Laurer, Moritz, Wouter van Atteveldt, Andreu Salleras Casas, and Kasper Welbers. 2022. ‘Less Annotating, More Classifying – Addressing the Data Scarcity Issue of Supervised Machine Learning with Deep Transfer Learning and BERT - NLI’. Preprint, June. Open Science Framework. https://osf.io/74b8k. ### Ideas for cooperation or questions? If you have questions or ideas for cooperation, contact me at m{dot}laurer{at}vu{dot}nl or [LinkedIn](https://www.linkedin.com/in/moritz-laurer/) ### Debugging and issues Note that DeBERTa-v3 was released on 06.12.21 and older versions of HF Transformers seem to have issues running the model (e.g. resulting in an issue with the tokenizer). Using Transformers>=4.13 might solve some issues. Also make sure to install sentencepiece to avoid tokenizer errors. Run: `pip install transformers[sentencepiece]` or `pip install sentencepiece` ## Model Recycling [Evaluation on 36 datasets](https://ibm.github.io/model-recycling/model_gain_chart?avg=0.65&mnli_lp=nan&20_newsgroup=-0.61&ag_news=-0.01&amazon_reviews_multi=0.46&anli=0.84&boolq=2.12&cb=16.07&cola=-0.76&copa=8.60&dbpedia=-0.40&esnli=-0.29&financial_phrasebank=-1.98&imdb=-0.47&isear=-0.22&mnli=-0.21&mrpc=0.50&multirc=1.91&poem_sentiment=1.73&qnli=0.07&qqp=-0.37&rotten_tomatoes=-0.74&rte=3.94&sst2=-0.45&sst_5bins=0.07&stsb=1.27&trec_coarse=-0.16&trec_fine=0.18&tweet_ev_emoji=-0.93&tweet_ev_emotion=-1.33&tweet_ev_hate=-1.67&tweet_ev_irony=-5.46&tweet_ev_offensive=-0.17&tweet_ev_sentiment=-0.11&wic=-0.21&wnli=-1.20&wsc=4.18&yahoo_answers=-0.70&model_name=MoritzLaurer%2FDeBERTa-v3-base-mnli-fever-anli&base_name=microsoft%2Fdeberta-v3-base) using MoritzLaurer/DeBERTa-v3-base-mnli-fever-anli as a base model yields average score of 79.69 in comparison to 79.04 by microsoft/deberta-v3-base. The model is ranked 2nd among all tested models for the microsoft/deberta-v3-base architecture as of 09/01/2023. Results: | 20_newsgroup | ag_news | amazon_reviews_multi | anli | boolq | cb | cola | copa | dbpedia | esnli | financial_phrasebank | imdb | isear | mnli | mrpc | multirc | poem_sentiment | qnli | qqp | rotten_tomatoes | rte | sst2 | sst_5bins | stsb | trec_coarse | trec_fine | tweet_ev_emoji | tweet_ev_emotion | tweet_ev_hate | tweet_ev_irony | tweet_ev_offensive | tweet_ev_sentiment | wic | wnli | wsc | yahoo_answers | |---------------:|----------:|-----------------------:|-------:|--------:|--------:|--------:|-------:|----------:|--------:|-----------------------:|-------:|--------:|--------:|--------:|----------:|-----------------:|-------:|--------:|------------------:|--------:|--------:|------------:|--------:|--------------:|------------:|-----------------:|-------------------:|----------------:|-----------------:|---------------------:|---------------------:|--------:|--------:|--------:|----------------:| | 85.8072 | 90.4333 | 67.32 | 59.625 | 85.107 | 91.0714 | 85.8102 | 67 | 79.0333 | 91.6327 | 82.5 | 94.02 | 71.6428 | 89.5749 | 89.7059 | 64.1708 | 88.4615 | 93.575 | 91.4148 | 89.6811 | 86.2816 | 94.6101 | 57.0588 | 91.5508 | 97.6 | 91.2 | 45.264 | 82.6179 | 54.5455 | 74.3622 | 84.8837 | 71.6949 | 71.0031 | 69.0141 | 68.2692 | 71.3333 | For more information, see: [Model Recycling](https://ibm.github.io/model-recycling/)

intfloat/multilingual-e5-large

intfloat

sentence-transformers

feature-extraction

--- tags: - mteb - Sentence Transformers - sentence-similarity - feature-extraction - sentence-transformers model-index: - name: multilingual-e5-large results: - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en) config: en split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 79.05970149253731 - type: ap value: 43.486574390835635 - type: f1 value: 73.32700092140148 - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (de) config: de split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 71.22055674518201 - type: ap value: 81.55756710830498 - type: f1 value: 69.28271787752661 - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en-ext) config: en-ext split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 80.41979010494754 - type: ap value: 29.34879922376344 - type: f1 value: 67.62475449011278 - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (ja) config: ja split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 77.8372591006424 - type: ap value: 26.557560591210738 - type: f1 value: 64.96619417368707 - task: type: Classification dataset: type: mteb/amazon_polarity name: MTEB AmazonPolarityClassification config: default split: test revision: e2d317d38cd51312af73b3d32a06d1a08b442046 metrics: - type: accuracy value: 93.489875 - type: ap value: 90.98758636917603 - type: f1 value: 93.48554819717332 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (en) config: en split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 47.564 - type: f1 value: 46.75122173518047 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (de) config: de split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 45.400000000000006 - type: f1 value: 44.17195682400632 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (es) config: es split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 43.068 - type: f1 value: 42.38155696855596 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (fr) config: fr split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 41.89 - type: f1 value: 40.84407321682663 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (ja) config: ja split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 40.120000000000005 - type: f1 value: 39.522976223819114 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (zh) config: zh split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 38.832 - type: f1 value: 38.0392533394713 - task: type: Retrieval dataset: type: arguana name: MTEB ArguAna config: default split: test revision: None metrics: - type: map_at_1 value: 30.725 - type: map_at_10 value: 46.055 - type: map_at_100 value: 46.900999999999996 - type: map_at_1000 value: 46.911 - type: map_at_3 value: 41.548 - type: map_at_5 value: 44.297 - type: mrr_at_1 value: 31.152 - type: mrr_at_10 value: 46.231 - type: mrr_at_100 value: 47.07 - type: mrr_at_1000 value: 47.08 - type: mrr_at_3 value: 41.738 - type: mrr_at_5 value: 44.468999999999994 - type: ndcg_at_1 value: 30.725 - type: ndcg_at_10 value: 54.379999999999995 - type: ndcg_at_100 value: 58.138 - type: ndcg_at_1000 value: 58.389 - type: ndcg_at_3 value: 45.156 - type: ndcg_at_5 value: 50.123 - type: precision_at_1 value: 30.725 - type: precision_at_10 value: 8.087 - type: precision_at_100 value: 0.9769999999999999 - type: precision_at_1000 value: 0.1 - type: precision_at_3 value: 18.54 - type: precision_at_5 value: 13.542000000000002 - type: recall_at_1 value: 30.725 - type: recall_at_10 value: 80.868 - type: recall_at_100 value: 97.653 - type: recall_at_1000 value: 99.57300000000001 - type: recall_at_3 value: 55.619 - type: recall_at_5 value: 67.71000000000001 - task: type: Clustering dataset: type: mteb/arxiv-clustering-p2p name: MTEB ArxivClusteringP2P config: default split: test revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d metrics: - type: v_measure value: 44.30960650674069 - task: type: Clustering dataset: type: mteb/arxiv-clustering-s2s name: MTEB ArxivClusteringS2S config: default split: test revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 metrics: - type: v_measure value: 38.427074197498996 - task: type: Reranking dataset: type: mteb/askubuntudupquestions-reranking name: MTEB AskUbuntuDupQuestions config: default split: test revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 metrics: - type: map value: 60.28270056031872 - type: mrr value: 74.38332673789738 - task: type: STS dataset: type: mteb/biosses-sts name: MTEB BIOSSES config: default split: test revision: d3fb88f8f02e40887cd149695127462bbcf29b4a metrics: - type: cos_sim_pearson value: 84.05942144105269 - type: cos_sim_spearman value: 82.51212105850809 - type: euclidean_pearson value: 81.95639829909122 - type: euclidean_spearman value: 82.3717564144213 - type: manhattan_pearson value: 81.79273425468256 - type: manhattan_spearman value: 82.20066817871039 - task: type: BitextMining dataset: type: mteb/bucc-bitext-mining name: MTEB BUCC (de-en) config: de-en split: test revision: d51519689f32196a32af33b075a01d0e7c51e252 metrics: - type: accuracy value: 99.46764091858039 - type: f1 value: 99.37717466945023 - type: precision value: 99.33194154488518 - type: recall value: 99.46764091858039 - task: type: BitextMining dataset: type: mteb/bucc-bitext-mining name: MTEB BUCC (fr-en) config: fr-en split: test revision: d51519689f32196a32af33b075a01d0e7c51e252 metrics: - type: accuracy value: 98.29407880255337 - type: f1 value: 98.11248073959938 - type: precision value: 98.02443319392472 - type: recall value: 98.29407880255337 - task: type: BitextMining dataset: type: mteb/bucc-bitext-mining name: MTEB BUCC (ru-en) config: ru-en split: test revision: d51519689f32196a32af33b075a01d0e7c51e252 metrics: - type: accuracy value: 97.79009352268791 - type: f1 value: 97.5176076665512 - type: precision value: 97.38136473848286 - type: recall value: 97.79009352268791 - task: type: BitextMining dataset: type: mteb/bucc-bitext-mining name: MTEB BUCC (zh-en) config: zh-en split: test revision: d51519689f32196a32af33b075a01d0e7c51e252 metrics: - type: accuracy value: 99.26276987888363 - type: f1 value: 99.20133403545726 - type: precision value: 99.17500438827453 - type: recall value: 99.26276987888363 - task: type: Classification dataset: type: mteb/banking77 name: MTEB Banking77Classification config: default split: test revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 metrics: - type: accuracy value: 84.72727272727273 - type: f1 value: 84.67672206031433 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-p2p name: MTEB BiorxivClusteringP2P config: default split: test revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 metrics: - type: v_measure value: 35.34220182511161 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-s2s name: MTEB BiorxivClusteringS2S config: default split: test revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 metrics: - type: v_measure value: 33.4987096128766 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 25.558249999999997 - type: map_at_10 value: 34.44425000000001 - type: map_at_100 value: 35.59833333333333 - type: map_at_1000 value: 35.706916666666665 - type: map_at_3 value: 31.691749999999995 - type: map_at_5 value: 33.252916666666664 - type: mrr_at_1 value: 30.252666666666666 - type: mrr_at_10 value: 38.60675 - type: mrr_at_100 value: 39.42666666666666 - type: mrr_at_1000 value: 39.48408333333334 - type: mrr_at_3 value: 36.17441666666665 - type: mrr_at_5 value: 37.56275 - type: ndcg_at_1 value: 30.252666666666666 - type: ndcg_at_10 value: 39.683 - type: ndcg_at_100 value: 44.68541666666667 - type: ndcg_at_1000 value: 46.94316666666668 - type: ndcg_at_3 value: 34.961749999999995 - type: ndcg_at_5 value: 37.215666666666664 - type: precision_at_1 value: 30.252666666666666 - type: precision_at_10 value: 6.904166666666667 - type: precision_at_100 value: 1.0989999999999995 - type: precision_at_1000 value: 0.14733333333333334 - type: precision_at_3 value: 16.037666666666667 - type: precision_at_5 value: 11.413583333333333 - type: recall_at_1 value: 25.558249999999997 - type: recall_at_10 value: 51.13341666666666 - type: recall_at_100 value: 73.08366666666667 - type: recall_at_1000 value: 88.79483333333334 - type: recall_at_3 value: 37.989083333333326 - type: recall_at_5 value: 43.787833333333325 - task: type: Retrieval dataset: type: climate-fever name: MTEB ClimateFEVER config: default split: test revision: None metrics: - type: map_at_1 value: 10.338 - type: map_at_10 value: 18.360000000000003 - type: map_at_100 value: 19.942 - type: map_at_1000 value: 20.134 - type: map_at_3 value: 15.174000000000001 - type: map_at_5 value: 16.830000000000002 - type: mrr_at_1 value: 23.257 - type: mrr_at_10 value: 33.768 - type: mrr_at_100 value: 34.707 - type: mrr_at_1000 value: 34.766000000000005 - type: mrr_at_3 value: 30.977 - type: mrr_at_5 value: 32.528 - type: ndcg_at_1 value: 23.257 - type: ndcg_at_10 value: 25.733 - type: ndcg_at_100 value: 32.288 - type: ndcg_at_1000 value: 35.992000000000004 - type: ndcg_at_3 value: 20.866 - type: ndcg_at_5 value: 22.612 - type: precision_at_1 value: 23.257 - type: precision_at_10 value: 8.124 - type: precision_at_100 value: 1.518 - type: precision_at_1000 value: 0.219 - type: precision_at_3 value: 15.679000000000002 - type: precision_at_5 value: 12.117 - type: recall_at_1 value: 10.338 - type: recall_at_10 value: 31.154 - type: recall_at_100 value: 54.161 - type: recall_at_1000 value: 75.21900000000001 - type: recall_at_3 value: 19.427 - type: recall_at_5 value: 24.214 - task: type: Retrieval dataset: type: dbpedia-entity name: MTEB DBPedia config: default split: test revision: None metrics: - type: map_at_1 value: 8.498 - type: map_at_10 value: 19.103 - type: map_at_100 value: 27.375 - type: map_at_1000 value: 28.981 - type: map_at_3 value: 13.764999999999999 - type: map_at_5 value: 15.950000000000001 - type: mrr_at_1 value: 65.5 - type: mrr_at_10 value: 74.53800000000001 - type: mrr_at_100 value: 74.71799999999999 - type: mrr_at_1000 value: 74.725 - type: mrr_at_3 value: 72.792 - type: mrr_at_5 value: 73.554 - type: ndcg_at_1 value: 53.37499999999999 - type: ndcg_at_10 value: 41.286 - type: ndcg_at_100 value: 45.972 - type: ndcg_at_1000 value: 53.123 - type: ndcg_at_3 value: 46.172999999999995 - type: ndcg_at_5 value: 43.033 - type: precision_at_1 value: 65.5 - type: precision_at_10 value: 32.725 - type: precision_at_100 value: 10.683 - type: precision_at_1000 value: 1.978 - type: precision_at_3 value: 50 - type: precision_at_5 value: 41.349999999999994 - type: recall_at_1 value: 8.498 - type: recall_at_10 value: 25.070999999999998 - type: recall_at_100 value: 52.383 - type: recall_at_1000 value: 74.91499999999999 - type: recall_at_3 value: 15.207999999999998 - type: recall_at_5 value: 18.563 - task: type: Classification dataset: type: mteb/emotion name: MTEB EmotionClassification config: default split: test revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 metrics: - type: accuracy value: 46.5 - type: f1 value: 41.93833713984145 - task: type: Retrieval dataset: type: fever name: MTEB FEVER config: default split: test revision: None metrics: - type: map_at_1 value: 67.914 - type: map_at_10 value: 78.10000000000001 - type: map_at_100 value: 78.333 - type: map_at_1000 value: 78.346 - type: map_at_3 value: 76.626 - type: map_at_5 value: 77.627 - type: mrr_at_1 value: 72.74199999999999 - type: mrr_at_10 value: 82.414 - type: mrr_at_100 value: 82.511 - type: mrr_at_1000 value: 82.513 - type: mrr_at_3 value: 81.231 - type: mrr_at_5 value: 82.065 - type: ndcg_at_1 value: 72.74199999999999 - type: ndcg_at_10 value: 82.806 - type: ndcg_at_100 value: 83.677 - type: ndcg_at_1000 value: 83.917 - type: ndcg_at_3 value: 80.305 - type: ndcg_at_5 value: 81.843 - type: precision_at_1 value: 72.74199999999999 - type: precision_at_10 value: 10.24 - type: precision_at_100 value: 1.089 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 31.268 - type: precision_at_5 value: 19.706000000000003 - type: recall_at_1 value: 67.914 - type: recall_at_10 value: 92.889 - type: recall_at_100 value: 96.42699999999999 - type: recall_at_1000 value: 97.92 - type: recall_at_3 value: 86.21 - type: recall_at_5 value: 90.036 - task: type: Retrieval dataset: type: fiqa name: MTEB FiQA2018 config: default split: test revision: None metrics: - type: map_at_1 value: 22.166 - type: map_at_10 value: 35.57 - type: map_at_100 value: 37.405 - type: map_at_1000 value: 37.564 - type: map_at_3 value: 30.379 - type: map_at_5 value: 33.324 - type: mrr_at_1 value: 43.519000000000005 - type: mrr_at_10 value: 51.556000000000004 - type: mrr_at_100 value: 52.344 - type: mrr_at_1000 value: 52.373999999999995 - type: mrr_at_3 value: 48.868 - type: mrr_at_5 value: 50.319 - type: ndcg_at_1 value: 43.519000000000005 - type: ndcg_at_10 value: 43.803 - type: ndcg_at_100 value: 50.468999999999994 - type: ndcg_at_1000 value: 53.111 - type: ndcg_at_3 value: 38.893 - type: ndcg_at_5 value: 40.653 - type: precision_at_1 value: 43.519000000000005 - type: precision_at_10 value: 12.253 - type: precision_at_100 value: 1.931 - type: precision_at_1000 value: 0.242 - type: precision_at_3 value: 25.617 - type: precision_at_5 value: 19.383 - type: recall_at_1 value: 22.166 - type: recall_at_10 value: 51.6 - type: recall_at_100 value: 76.574 - type: recall_at_1000 value: 92.192 - type: recall_at_3 value: 34.477999999999994 - type: recall_at_5 value: 41.835 - task: type: Retrieval dataset: type: hotpotqa name: MTEB HotpotQA config: default split: test revision: None metrics: - type: map_at_1 value: 39.041 - type: map_at_10 value: 62.961999999999996 - type: map_at_100 value: 63.79899999999999 - type: map_at_1000 value: 63.854 - type: map_at_3 value: 59.399 - type: map_at_5 value: 61.669 - type: mrr_at_1 value: 78.082 - type: mrr_at_10 value: 84.321 - type: mrr_at_100 value: 84.49600000000001 - type: mrr_at_1000 value: 84.502 - type: mrr_at_3 value: 83.421 - type: mrr_at_5 value: 83.977 - type: ndcg_at_1 value: 78.082 - type: ndcg_at_10 value: 71.229 - type: ndcg_at_100 value: 74.10900000000001 - type: ndcg_at_1000 value: 75.169 - type: ndcg_at_3 value: 66.28699999999999 - type: ndcg_at_5 value: 69.084 - type: precision_at_1 value: 78.082 - type: precision_at_10 value: 14.993 - type: precision_at_100 value: 1.7239999999999998 - type: precision_at_1000 value: 0.186 - type: precision_at_3 value: 42.737 - type: precision_at_5 value: 27.843 - type: recall_at_1 value: 39.041 - type: recall_at_10 value: 74.96300000000001 - type: recall_at_100 value: 86.199 - type: recall_at_1000 value: 93.228 - type: recall_at_3 value: 64.105 - type: recall_at_5 value: 69.608 - task: type: Classification dataset: type: mteb/imdb name: MTEB ImdbClassification config: default split: test revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 metrics: - type: accuracy value: 90.23160000000001 - type: ap value: 85.5674856808308 - type: f1 value: 90.18033354786317 - task: type: Retrieval dataset: type: msmarco name: MTEB MSMARCO config: default split: dev revision: None metrics: - type: map_at_1 value: 24.091 - type: map_at_10 value: 36.753 - type: map_at_100 value: 37.913000000000004 - type: map_at_1000 value: 37.958999999999996 - type: map_at_3 value: 32.818999999999996 - type: map_at_5 value: 35.171 - type: mrr_at_1 value: 24.742 - type: mrr_at_10 value: 37.285000000000004 - type: mrr_at_100 value: 38.391999999999996 - type: mrr_at_1000 value: 38.431 - type: mrr_at_3 value: 33.440999999999995 - type: mrr_at_5 value: 35.75 - type: ndcg_at_1 value: 24.742 - type: ndcg_at_10 value: 43.698 - type: ndcg_at_100 value: 49.145 - type: ndcg_at_1000 value: 50.23800000000001 - type: ndcg_at_3 value: 35.769 - type: ndcg_at_5 value: 39.961999999999996 - type: precision_at_1 value: 24.742 - type: precision_at_10 value: 6.7989999999999995 - type: precision_at_100 value: 0.95 - type: precision_at_1000 value: 0.104 - type: precision_at_3 value: 15.096000000000002 - type: precision_at_5 value: 11.183 - type: recall_at_1 value: 24.091 - type: recall_at_10 value: 65.068 - type: recall_at_100 value: 89.899 - type: recall_at_1000 value: 98.16 - type: recall_at_3 value: 43.68 - type: recall_at_5 value: 53.754999999999995 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (en) config: en split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 93.66621067031465 - type: f1 value: 93.49622853272142 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (de) config: de split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 91.94702733164272 - type: f1 value: 91.17043441745282 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (es) config: es split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 92.20146764509674 - type: f1 value: 91.98359080555608 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (fr) config: fr split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 88.99780770435328 - type: f1 value: 89.19746342724068 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (hi) config: hi split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 89.78486912871998 - type: f1 value: 89.24578823628642 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (th) config: th split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 88.74502712477394 - type: f1 value: 89.00297573881542 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (en) config: en split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 77.9046967624259 - type: f1 value: 59.36787125785957 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (de) config: de split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 74.5280360664976 - type: f1 value: 57.17723440888718 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (es) config: es split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 75.44029352901934 - type: f1 value: 54.052855531072964 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (fr) config: fr split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 70.5606013153774 - type: f1 value: 52.62215934386531 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (hi) config: hi split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 73.11581211903908 - type: f1 value: 52.341291845645465 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (th) config: th split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 74.28933092224233 - type: f1 value: 57.07918745504911 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (af) config: af split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 62.38063214525892 - type: f1 value: 59.46463723443009 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (am) config: am split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 56.06926698049766 - type: f1 value: 52.49084283283562 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ar) config: ar split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 60.74983187626093 - type: f1 value: 56.960640620165904 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (az) config: az split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 64.86550100874243 - type: f1 value: 62.47370548140688 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (bn) config: bn split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 63.971082716879636 - type: f1 value: 61.03812421957381 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (cy) config: cy split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 54.98318762609282 - type: f1 value: 51.51207916008392 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (da) config: da split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.45527908540686 - type: f1 value: 66.16631905400318 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (de) config: de split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.32750504371216 - type: f1 value: 66.16755288646591 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (el) config: el split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.09213180901143 - type: f1 value: 66.95654394661507 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (en) config: en split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 73.75588433086752 - type: f1 value: 71.79973779656923 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (es) config: es split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.49428379287154 - type: f1 value: 68.37494379215734 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (fa) config: fa split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.90921318090115 - type: f1 value: 66.79517376481645 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (fi) config: fi split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.12104909213181 - type: f1 value: 67.29448842879584 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (fr) config: fr split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.34095494283793 - type: f1 value: 67.01134288992947 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (he) config: he split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 67.61264290517822 - type: f1 value: 64.68730512660757 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (hi) config: hi split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 67.79757901815738 - type: f1 value: 65.24938539425598 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (hu) config: hu split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.68728984532616 - type: f1 value: 67.0487169762553 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (hy) config: hy split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 62.07464694014795 - type: f1 value: 59.183532276789286 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (id) config: id split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.04707464694015 - type: f1 value: 67.66829629003848 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (is) config: is split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 62.42434431741762 - type: f1 value: 59.01617226544757 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (it) config: it split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.53127101546738 - type: f1 value: 68.10033760906255 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ja) config: ja split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 72.50504371217215 - type: f1 value: 69.74931103158923 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (jv) config: jv split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 57.91190316072628 - type: f1 value: 54.05551136648796 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ka) config: ka split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 51.78211163416275 - type: f1 value: 49.874888544058535 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (km) config: km split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 47.017484868863484 - type: f1 value: 44.53364263352014 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (kn) config: kn split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 62.16207128446537 - type: f1 value: 59.01185692320829 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ko) config: ko split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.42501681237391 - type: f1 value: 67.13169450166086 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (lv) config: lv split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 67.0780094149294 - type: f1 value: 64.41720167850707 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ml) config: ml split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 65.57162071284466 - type: f1 value: 62.414138683804424 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (mn) config: mn split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 61.71149966375252 - type: f1 value: 58.594805125087234 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ms) config: ms split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 66.03900470746471 - type: f1 value: 63.87937257883887 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (my) config: my split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 60.8776059179556 - type: f1 value: 57.48587618059131 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (nb) config: nb split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.87895090786819 - type: f1 value: 66.8141299430347 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (nl) config: nl split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.45057162071285 - type: f1 value: 67.46444039673516 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (pl) config: pl split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 71.546738399462 - type: f1 value: 68.63640876702655 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (pt) config: pt split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.72965702757229 - type: f1 value: 68.54119560379115 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ro) config: ro split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 68.35574983187625 - type: f1 value: 65.88844917691927 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ru) config: ru split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 71.70477471418964 - type: f1 value: 69.19665697061978 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (sl) config: sl split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 67.0880968392737 - type: f1 value: 64.76962317666086 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (sq) config: sq split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 65.18493611297916 - type: f1 value: 62.49984559035371 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (sv) config: sv split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 71.75857431069265 - type: f1 value: 69.20053687623418 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (sw) config: sw split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 58.500336247478145 - type: f1 value: 55.2972398687929 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ta) config: ta split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 62.68997982515132 - type: f1 value: 59.36848202755348 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (te) config: te split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 63.01950235373235 - type: f1 value: 60.09351954625423 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (th) config: th split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 68.29186281102892 - type: f1 value: 67.57860496703447 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (tl) config: tl split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 64.77471418964357 - type: f1 value: 61.913983147713836 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (tr) config: tr split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.87222595830532 - type: f1 value: 66.03679033708141 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ur) config: ur split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 64.04505716207127 - type: f1 value: 61.28569169817908 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (vi) config: vi split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.38466711499663 - type: f1 value: 67.20532357036844 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (zh-CN) config: zh-CN split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 71.12306657700067 - type: f1 value: 68.91251226588182 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (zh-TW) config: zh-TW split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 66.20040349697378 - type: f1 value: 66.02657347714175 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (af) config: af split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 68.73907195696032 - type: f1 value: 66.98484521791418 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (am) config: am split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 60.58843308675185 - type: f1 value: 58.95591723092005 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ar) config: ar split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 66.22730329522528 - type: f1 value: 66.0894499712115 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (az) config: az split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 66.48285137861465 - type: f1 value: 65.21963176785157 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (bn) config: bn split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 67.74714189643578 - type: f1 value: 66.8212192745412 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (cy) config: cy split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 59.09213180901143 - type: f1 value: 56.70735546356339 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (da) config: da split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 75.05716207128448 - type: f1 value: 74.8413712365364 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (de) config: de split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.69737726967047 - type: f1 value: 74.7664341963 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (el) config: el split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.90383322125084 - type: f1 value: 73.59201554448323 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (en) config: en split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 77.51176866173503 - type: f1 value: 77.46104434577758 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (es) config: es split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.31069266980496 - type: f1 value: 74.61048660675635 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (fa) config: fa split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 72.95225285810356 - type: f1 value: 72.33160006574627 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (fi) config: fi split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.12373907195696 - type: f1 value: 73.20921012557481 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (fr) config: fr split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.86684599865501 - type: f1 value: 73.82348774610831 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (he) config: he split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 71.40215198386012 - type: f1 value: 71.11945183971858 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (hi) config: hi split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 72.12844653665098 - type: f1 value: 71.34450495911766 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (hu) config: hu split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.52252858103566 - type: f1 value: 73.98878711342999 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (hy) config: hy split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 64.93611297915265 - type: f1 value: 63.723200467653385 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (id) config: id split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.11903160726295 - type: f1 value: 73.82138439467096 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (is) config: is split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 67.15198386012105 - type: f1 value: 66.02172193802167 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (it) config: it split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.32414256893072 - type: f1 value: 74.30943421170574 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ja) config: ja split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 77.46805648957633 - type: f1 value: 77.62808409298209 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (jv) config: jv split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 63.318762609280434 - type: f1 value: 62.094284066075076 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ka) config: ka split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 58.34902488231338 - type: f1 value: 57.12893860987984 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (km) config: km split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 50.88433086751849 - type: f1 value: 48.2272350802058 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (kn) config: kn split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 66.4425016812374 - type: f1 value: 64.61463095996173 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ko) config: ko split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 75.04707464694015 - type: f1 value: 75.05099199098998 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (lv) config: lv split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 70.50437121721586 - type: f1 value: 69.83397721096314 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ml) config: ml split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 69.94283792871553 - type: f1 value: 68.8704663703913 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (mn) config: mn split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 64.79488903833222 - type: f1 value: 63.615424063345436 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ms) config: ms split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 69.88231338264963 - type: f1 value: 68.57892302593237 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (my) config: my split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 63.248150638870214 - type: f1 value: 61.06680605338809 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (nb) config: nb split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.84196368527236 - type: f1 value: 74.52566464968763 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (nl) config: nl split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.8285137861466 - type: f1 value: 74.8853197608802 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (pl) config: pl split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.13248150638869 - type: f1 value: 74.3982040999179 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (pt) config: pt split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.49024882313383 - type: f1 value: 73.82153848368573 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ro) config: ro split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 71.72158708809684 - type: f1 value: 71.85049433180541 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ru) config: ru split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 75.137861466039 - type: f1 value: 75.37628348188467 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (sl) config: sl split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 71.86953597848016 - type: f1 value: 71.87537624521661 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (sq) config: sq split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 70.27572293207801 - type: f1 value: 68.80017302344231 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (sv) config: sv split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 76.09952925353059 - type: f1 value: 76.07992707688408 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (sw) config: sw split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 63.140551445864155 - type: f1 value: 61.73855010331415 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ta) config: ta split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 66.27774041694687 - type: f1 value: 64.83664868894539 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (te) config: te split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 66.69468728984533 - type: f1 value: 64.76239666920868 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (th) config: th split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.44653665097512 - type: f1 value: 73.14646052013873 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (tl) config: tl split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 67.71351714862139 - type: f1 value: 66.67212180163382 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (tr) config: tr split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.9946200403497 - type: f1 value: 73.87348793725525 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ur) config: ur split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 68.15400134498992 - type: f1 value: 67.09433241421094 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (vi) config: vi split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.11365164761264 - type: f1 value: 73.59502539433753 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (zh-CN) config: zh-CN split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 76.82582380632145 - type: f1 value: 76.89992945316313 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (zh-TW) config: zh-TW split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 71.81237390719569 - type: f1 value: 72.36499770986265 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-p2p name: MTEB MedrxivClusteringP2P config: default split: test revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 metrics: - type: v_measure value: 31.480506569594695 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-s2s name: MTEB MedrxivClusteringS2S config: default split: test revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 metrics: - type: v_measure value: 29.71252128004552 - task: type: Reranking dataset: type: mteb/mind_small name: MTEB MindSmallReranking config: default split: test revision: 3bdac13927fdc888b903db93b2ffdbd90b295a69 metrics: - type: map value: 31.421396787056548 - type: mrr value: 32.48155274872267 - task: type: Retrieval dataset: type: nfcorpus name: MTEB NFCorpus config: default split: test revision: None metrics: - type: map_at_1 value: 5.595 - type: map_at_10 value: 12.642000000000001 - type: map_at_100 value: 15.726 - type: map_at_1000 value: 17.061999999999998 - type: map_at_3 value: 9.125 - type: map_at_5 value: 10.866000000000001 - type: mrr_at_1 value: 43.344 - type: mrr_at_10 value: 52.227999999999994 - type: mrr_at_100 value: 52.898999999999994 - type: mrr_at_1000 value: 52.944 - type: mrr_at_3 value: 49.845 - type: mrr_at_5 value: 51.115 - type: ndcg_at_1 value: 41.949999999999996 - type: ndcg_at_10 value: 33.995 - type: ndcg_at_100 value: 30.869999999999997 - type: ndcg_at_1000 value: 39.487 - type: ndcg_at_3 value: 38.903999999999996 - type: ndcg_at_5 value: 37.236999999999995 - type: precision_at_1 value: 43.344 - type: precision_at_10 value: 25.480000000000004 - type: precision_at_100 value: 7.672 - type: precision_at_1000 value: 2.028 - type: precision_at_3 value: 36.636 - type: precision_at_5 value: 32.632 - type: recall_at_1 value: 5.595 - type: recall_at_10 value: 16.466 - type: recall_at_100 value: 31.226 - type: recall_at_1000 value: 62.778999999999996 - type: recall_at_3 value: 9.931 - type: recall_at_5 value: 12.884 - task: type: Retrieval dataset: type: nq name: MTEB NQ config: default split: test revision: None metrics: - type: map_at_1 value: 40.414 - type: map_at_10 value: 56.754000000000005 - type: map_at_100 value: 57.457 - type: map_at_1000 value: 57.477999999999994 - type: map_at_3 value: 52.873999999999995 - type: map_at_5 value: 55.175 - type: mrr_at_1 value: 45.278 - type: mrr_at_10 value: 59.192 - type: mrr_at_100 value: 59.650000000000006 - type: mrr_at_1000 value: 59.665 - type: mrr_at_3 value: 56.141 - type: mrr_at_5 value: 57.998000000000005 - type: ndcg_at_1 value: 45.278 - type: ndcg_at_10 value: 64.056 - type: ndcg_at_100 value: 66.89 - type: ndcg_at_1000 value: 67.364 - type: ndcg_at_3 value: 56.97 - type: ndcg_at_5 value: 60.719 - type: precision_at_1 value: 45.278 - type: precision_at_10 value: 9.994 - type: precision_at_100 value: 1.165 - type: precision_at_1000 value: 0.121 - type: precision_at_3 value: 25.512 - type: precision_at_5 value: 17.509 - type: recall_at_1 value: 40.414 - type: recall_at_10 value: 83.596 - type: recall_at_100 value: 95.72 - type: recall_at_1000 value: 99.24 - type: recall_at_3 value: 65.472 - type: recall_at_5 value: 74.039 - task: type: Retrieval dataset: type: quora name: MTEB QuoraRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 70.352 - type: map_at_10 value: 84.369 - type: map_at_100 value: 85.02499999999999 - type: map_at_1000 value: 85.04 - type: map_at_3 value: 81.42399999999999 - type: map_at_5 value: 83.279 - type: mrr_at_1 value: 81.05 - type: mrr_at_10 value: 87.401 - type: mrr_at_100 value: 87.504 - type: mrr_at_1000 value: 87.505 - type: mrr_at_3 value: 86.443 - type: mrr_at_5 value: 87.10799999999999 - type: ndcg_at_1 value: 81.04 - type: ndcg_at_10 value: 88.181 - type: ndcg_at_100 value: 89.411 - type: ndcg_at_1000 value: 89.507 - type: ndcg_at_3 value: 85.28099999999999 - type: ndcg_at_5 value: 86.888 - type: precision_at_1 value: 81.04 - type: precision_at_10 value: 13.406 - type: precision_at_100 value: 1.5350000000000001 - type: precision_at_1000 value: 0.157 - type: precision_at_3 value: 37.31 - type: precision_at_5 value: 24.54 - type: recall_at_1 value: 70.352 - type: recall_at_10 value: 95.358 - type: recall_at_100 value: 99.541 - type: recall_at_1000 value: 99.984 - type: recall_at_3 value: 87.111 - type: recall_at_5 value: 91.643 - task: type: Clustering dataset: type: mteb/reddit-clustering name: MTEB RedditClustering config: default split: test revision: 24640382cdbf8abc73003fb0fa6d111a705499eb metrics: - type: v_measure value: 46.54068723291946 - task: type: Clustering dataset: type: mteb/reddit-clustering-p2p name: MTEB RedditClusteringP2P config: default split: test revision: 282350215ef01743dc01b456c7f5241fa8937f16 metrics: - type: v_measure value: 63.216287629895994 - task: type: Retrieval dataset: type: scidocs name: MTEB SCIDOCS config: default split: test revision: None metrics: - type: map_at_1 value: 4.023000000000001 - type: map_at_10 value: 10.071 - type: map_at_100 value: 11.892 - type: map_at_1000 value: 12.196 - type: map_at_3 value: 7.234 - type: map_at_5 value: 8.613999999999999 - type: mrr_at_1 value: 19.900000000000002 - type: mrr_at_10 value: 30.516 - type: mrr_at_100 value: 31.656000000000002 - type: mrr_at_1000 value: 31.723000000000003 - type: mrr_at_3 value: 27.400000000000002 - type: mrr_at_5 value: 29.270000000000003 - type: ndcg_at_1 value: 19.900000000000002 - type: ndcg_at_10 value: 17.474 - type: ndcg_at_100 value: 25.020999999999997 - type: ndcg_at_1000 value: 30.728 - type: ndcg_at_3 value: 16.588 - type: ndcg_at_5 value: 14.498 - type: precision_at_1 value: 19.900000000000002 - type: precision_at_10 value: 9.139999999999999 - type: precision_at_100 value: 2.011 - type: precision_at_1000 value: 0.33899999999999997 - type: precision_at_3 value: 15.667 - type: precision_at_5 value: 12.839999999999998 - type: recall_at_1 value: 4.023000000000001 - type: recall_at_10 value: 18.497 - type: recall_at_100 value: 40.8 - type: recall_at_1000 value: 68.812 - type: recall_at_3 value: 9.508 - type: recall_at_5 value: 12.983 - task: type: STS dataset: type: mteb/sickr-sts name: MTEB SICK-R config: default split: test revision: a6ea5a8cab320b040a23452cc28066d9beae2cee metrics: - type: cos_sim_pearson value: 83.967008785134 - type: cos_sim_spearman value: 80.23142141101837 - type: euclidean_pearson value: 81.20166064704539 - type: euclidean_spearman value: 80.18961335654585 - type: manhattan_pearson value: 81.13925443187625 - type: manhattan_spearman value: 80.07948723044424 - task: type: STS dataset: type: mteb/sts12-sts name: MTEB STS12 config: default split: test revision: a0d554a64d88156834ff5ae9920b964011b16384 metrics: - type: cos_sim_pearson value: 86.94262461316023 - type: cos_sim_spearman value: 80.01596278563865 - type: euclidean_pearson value: 83.80799622922581 - type: euclidean_spearman value: 79.94984954947103 - type: manhattan_pearson value: 83.68473841756281 - type: manhattan_spearman value: 79.84990707951822 - task: type: STS dataset: type: mteb/sts13-sts name: MTEB STS13 config: default split: test revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca metrics: - type: cos_sim_pearson value: 80.57346443146068 - type: cos_sim_spearman value: 81.54689837570866 - type: euclidean_pearson value: 81.10909881516007 - type: euclidean_spearman value: 81.56746243261762 - type: manhattan_pearson value: 80.87076036186582 - type: manhattan_spearman value: 81.33074987964402 - task: type: STS dataset: type: mteb/sts14-sts name: MTEB STS14 config: default split: test revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 metrics: - type: cos_sim_pearson value: 79.54733787179849 - type: cos_sim_spearman value: 77.72202105610411 - type: euclidean_pearson value: 78.9043595478849 - type: euclidean_spearman value: 77.93422804309435 - type: manhattan_pearson value: 78.58115121621368 - type: manhattan_spearman value: 77.62508135122033 - task: type: STS dataset: type: mteb/sts15-sts name: MTEB STS15 config: default split: test revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 metrics: - type: cos_sim_pearson value: 88.59880017237558 - type: cos_sim_spearman value: 89.31088630824758 - type: euclidean_pearson value: 88.47069261564656 - type: euclidean_spearman value: 89.33581971465233 - type: manhattan_pearson value: 88.40774264100956 - type: manhattan_spearman value: 89.28657485627835 - task: type: STS dataset: type: mteb/sts16-sts name: MTEB STS16 config: default split: test revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 metrics: - type: cos_sim_pearson value: 84.08055117917084 - type: cos_sim_spearman value: 85.78491813080304 - type: euclidean_pearson value: 84.99329155500392 - type: euclidean_spearman value: 85.76728064677287 - type: manhattan_pearson value: 84.87947428989587 - type: manhattan_spearman value: 85.62429454917464 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (ko-ko) config: ko-ko split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 82.14190939287384 - type: cos_sim_spearman value: 82.27331573306041 - type: euclidean_pearson value: 81.891896953716 - type: euclidean_spearman value: 82.37695542955998 - type: manhattan_pearson value: 81.73123869460504 - type: manhattan_spearman value: 82.19989168441421 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (ar-ar) config: ar-ar split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 76.84695301843362 - type: cos_sim_spearman value: 77.87790986014461 - type: euclidean_pearson value: 76.91981583106315 - type: euclidean_spearman value: 77.88154772749589 - type: manhattan_pearson value: 76.94953277451093 - type: manhattan_spearman value: 77.80499230728604 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-ar) config: en-ar split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 75.44657840482016 - type: cos_sim_spearman value: 75.05531095119674 - type: euclidean_pearson value: 75.88161755829299 - type: euclidean_spearman value: 74.73176238219332 - type: manhattan_pearson value: 75.63984765635362 - type: manhattan_spearman value: 74.86476440770737 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-de) config: en-de split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 85.64700140524133 - type: cos_sim_spearman value: 86.16014210425672 - type: euclidean_pearson value: 86.49086860843221 - type: euclidean_spearman value: 86.09729326815614 - type: manhattan_pearson value: 86.43406265125513 - type: manhattan_spearman value: 86.17740150939994 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-en) config: en-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 87.91170098764921 - type: cos_sim_spearman value: 88.12437004058931 - type: euclidean_pearson value: 88.81828254494437 - type: euclidean_spearman value: 88.14831794572122 - type: manhattan_pearson value: 88.93442183448961 - type: manhattan_spearman value: 88.15254630778304 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-tr) config: en-tr split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 72.91390577997292 - type: cos_sim_spearman value: 71.22979457536074 - type: euclidean_pearson value: 74.40314008106749 - type: euclidean_spearman value: 72.54972136083246 - type: manhattan_pearson value: 73.85687539530218 - type: manhattan_spearman value: 72.09500771742637 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (es-en) config: es-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 80.9301067983089 - type: cos_sim_spearman value: 80.74989828346473 - type: euclidean_pearson value: 81.36781301814257 - type: euclidean_spearman value: 80.9448819964426 - type: manhattan_pearson value: 81.0351322685609 - type: manhattan_spearman value: 80.70192121844177 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (es-es) config: es-es split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 87.13820465980005 - type: cos_sim_spearman value: 86.73532498758757 - type: euclidean_pearson value: 87.21329451846637 - type: euclidean_spearman value: 86.57863198601002 - type: manhattan_pearson value: 87.06973713818554 - type: manhattan_spearman value: 86.47534918791499 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (fr-en) config: fr-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 85.48720108904415 - type: cos_sim_spearman value: 85.62221757068387 - type: euclidean_pearson value: 86.1010129512749 - type: euclidean_spearman value: 85.86580966509942 - type: manhattan_pearson value: 86.26800938808971 - type: manhattan_spearman value: 85.88902721678429 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (it-en) config: it-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 83.98021347333516 - type: cos_sim_spearman value: 84.53806553803501 - type: euclidean_pearson value: 84.61483347248364 - type: euclidean_spearman value: 85.14191408011702 - type: manhattan_pearson value: 84.75297588825967 - type: manhattan_spearman value: 85.33176753669242 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (nl-en) config: nl-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 84.51856644893233 - type: cos_sim_spearman value: 85.27510748506413 - type: euclidean_pearson value: 85.09886861540977 - type: euclidean_spearman value: 85.62579245860887 - type: manhattan_pearson value: 84.93017860464607 - type: manhattan_spearman value: 85.5063988898453 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (en) config: en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 62.581573200584195 - type: cos_sim_spearman value: 63.05503590247928 - type: euclidean_pearson value: 63.652564812602094 - type: euclidean_spearman value: 62.64811520876156 - type: manhattan_pearson value: 63.506842893061076 - type: manhattan_spearman value: 62.51289573046917 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (de) config: de split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 48.2248801729127 - type: cos_sim_spearman value: 56.5936604678561 - type: euclidean_pearson value: 43.98149464089 - type: euclidean_spearman value: 56.108561882423615 - type: manhattan_pearson value: 43.86880305903564 - type: manhattan_spearman value: 56.04671150510166 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (es) config: es split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 55.17564527009831 - type: cos_sim_spearman value: 64.57978560979488 - type: euclidean_pearson value: 58.8818330154583 - type: euclidean_spearman value: 64.99214839071281 - type: manhattan_pearson value: 58.72671436121381 - type: manhattan_spearman value: 65.10713416616109 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (pl) config: pl split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 26.772131864023297 - type: cos_sim_spearman value: 34.68200792408681 - type: euclidean_pearson value: 16.68082419005441 - type: euclidean_spearman value: 34.83099932652166 - type: manhattan_pearson value: 16.52605949659529 - type: manhattan_spearman value: 34.82075801399475 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (tr) config: tr split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 54.42415189043831 - type: cos_sim_spearman value: 63.54594264576758 - type: euclidean_pearson value: 57.36577498297745 - type: euclidean_spearman value: 63.111466379158074 - type: manhattan_pearson value: 57.584543715873885 - type: manhattan_spearman value: 63.22361054139183 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (ar) config: ar split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 47.55216762405518 - type: cos_sim_spearman value: 56.98670142896412 - type: euclidean_pearson value: 50.15318757562699 - type: euclidean_spearman value: 56.524941926541906 - type: manhattan_pearson value: 49.955618528674904 - type: manhattan_spearman value: 56.37102209240117 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (ru) config: ru split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 49.20540980338571 - type: cos_sim_spearman value: 59.9009453504406 - type: euclidean_pearson value: 49.557749853620535 - type: euclidean_spearman value: 59.76631621172456 - type: manhattan_pearson value: 49.62340591181147 - type: manhattan_spearman value: 59.94224880322436 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (zh) config: zh split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 51.508169956576985 - type: cos_sim_spearman value: 66.82461565306046 - type: euclidean_pearson value: 56.2274426480083 - type: euclidean_spearman value: 66.6775323848333 - type: manhattan_pearson value: 55.98277796300661 - type: manhattan_spearman value: 66.63669848497175 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (fr) config: fr split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 72.86478788045507 - type: cos_sim_spearman value: 76.7946552053193 - type: euclidean_pearson value: 75.01598530490269 - type: euclidean_spearman value: 76.83618917858281 - type: manhattan_pearson value: 74.68337628304332 - type: manhattan_spearman value: 76.57480204017773 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (de-en) config: de-en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 55.922619099401984 - type: cos_sim_spearman value: 56.599362477240774 - type: euclidean_pearson value: 56.68307052369783 - type: euclidean_spearman value: 54.28760436777401 - type: manhattan_pearson value: 56.67763566500681 - type: manhattan_spearman value: 53.94619541711359 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (es-en) config: es-en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 66.74357206710913 - type: cos_sim_spearman value: 72.5208244925311 - type: euclidean_pearson value: 67.49254562186032 - type: euclidean_spearman value: 72.02469076238683 - type: manhattan_pearson value: 67.45251772238085 - type: manhattan_spearman value: 72.05538819984538 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (it) config: it split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 71.25734330033191 - type: cos_sim_spearman value: 76.98349083946823 - type: euclidean_pearson value: 73.71642838667736 - type: euclidean_spearman value: 77.01715504651384 - type: manhattan_pearson value: 73.61712711868105 - type: manhattan_spearman value: 77.01392571153896 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (pl-en) config: pl-en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 63.18215462781212 - type: cos_sim_spearman value: 65.54373266117607 - type: euclidean_pearson value: 64.54126095439005 - type: euclidean_spearman value: 65.30410369102711 - type: manhattan_pearson value: 63.50332221148234 - type: manhattan_spearman value: 64.3455878104313 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (zh-en) config: zh-en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 62.30509221440029 - type: cos_sim_spearman value: 65.99582704642478 - type: euclidean_pearson value: 63.43818859884195 - type: euclidean_spearman value: 66.83172582815764 - type: manhattan_pearson value: 63.055779168508764 - type: manhattan_spearman value: 65.49585020501449 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (es-it) config: es-it split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 59.587830825340404 - type: cos_sim_spearman value: 68.93467614588089 - type: euclidean_pearson value: 62.3073527367404 - type: euclidean_spearman value: 69.69758171553175 - type: manhattan_pearson value: 61.9074580815789 - type: manhattan_spearman value: 69.57696375597865 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (de-fr) config: de-fr split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 57.143220125577066 - type: cos_sim_spearman value: 67.78857859159226 - type: euclidean_pearson value: 55.58225107923733 - type: euclidean_spearman value: 67.80662907184563 - type: manhattan_pearson value: 56.24953502726514 - type: manhattan_spearman value: 67.98262125431616 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (de-pl) config: de-pl split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 21.826928900322066 - type: cos_sim_spearman value: 49.578506634400405 - type: euclidean_pearson value: 27.939890138843214 - type: euclidean_spearman value: 52.71950519136242 - type: manhattan_pearson value: 26.39878683847546 - type: manhattan_spearman value: 47.54609580342499 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (fr-pl) config: fr-pl split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 57.27603854632001 - type: cos_sim_spearman value: 50.709255283710995 - type: euclidean_pearson value: 59.5419024445929 - type: euclidean_spearman value: 50.709255283710995 - type: manhattan_pearson value: 59.03256832438492 - type: manhattan_spearman value: 61.97797868009122 - task: type: STS dataset: type: mteb/stsbenchmark-sts name: MTEB STSBenchmark config: default split: test revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 metrics: - type: cos_sim_pearson value: 85.00757054859712 - type: cos_sim_spearman value: 87.29283629622222 - type: euclidean_pearson value: 86.54824171775536 - type: euclidean_spearman value: 87.24364730491402 - type: manhattan_pearson value: 86.5062156915074 - type: manhattan_spearman value: 87.15052170378574 - task: type: Reranking dataset: type: mteb/scidocs-reranking name: MTEB SciDocsRR config: default split: test revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab metrics: - type: map value: 82.03549357197389 - type: mrr value: 95.05437645143527 - task: type: Retrieval dataset: type: scifact name: MTEB SciFact config: default split: test revision: None metrics: - type: map_at_1 value: 57.260999999999996 - type: map_at_10 value: 66.259 - type: map_at_100 value: 66.884 - type: map_at_1000 value: 66.912 - type: map_at_3 value: 63.685 - type: map_at_5 value: 65.35499999999999 - type: mrr_at_1 value: 60.333000000000006 - type: mrr_at_10 value: 67.5 - type: mrr_at_100 value: 68.013 - type: mrr_at_1000 value: 68.038 - type: mrr_at_3 value: 65.61099999999999 - type: mrr_at_5 value: 66.861 - type: ndcg_at_1 value: 60.333000000000006 - type: ndcg_at_10 value: 70.41 - type: ndcg_at_100 value: 73.10600000000001 - type: ndcg_at_1000 value: 73.846 - type: ndcg_at_3 value: 66.133 - type: ndcg_at_5 value: 68.499 - type: precision_at_1 value: 60.333000000000006 - type: precision_at_10 value: 9.232999999999999 - type: precision_at_100 value: 1.0630000000000002 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 25.667 - type: precision_at_5 value: 17.067 - type: recall_at_1 value: 57.260999999999996 - type: recall_at_10 value: 81.94399999999999 - type: recall_at_100 value: 93.867 - type: recall_at_1000 value: 99.667 - type: recall_at_3 value: 70.339 - type: recall_at_5 value: 76.25 - task: type: PairClassification dataset: type: mteb/sprintduplicatequestions-pairclassification name: MTEB SprintDuplicateQuestions config: default split: test revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 metrics: - type: cos_sim_accuracy value: 99.74356435643564 - type: cos_sim_ap value: 93.13411948212683 - type: cos_sim_f1 value: 86.80521991300147 - type: cos_sim_precision value: 84.00374181478017 - type: cos_sim_recall value: 89.8 - type: dot_accuracy value: 99.67920792079208 - type: dot_ap value: 89.27277565444479 - type: dot_f1 value: 83.9276990718124 - type: dot_precision value: 82.04393505253104 - type: dot_recall value: 85.9 - type: euclidean_accuracy value: 99.74257425742574 - type: euclidean_ap value: 93.17993008259062 - type: euclidean_f1 value: 86.69396110542476 - type: euclidean_precision value: 88.78406708595388 - type: euclidean_recall value: 84.7 - type: manhattan_accuracy value: 99.74257425742574 - type: manhattan_ap value: 93.14413755550099 - type: manhattan_f1 value: 86.82483594144371 - type: manhattan_precision value: 87.66564729867483 - type: manhattan_recall value: 86 - type: max_accuracy value: 99.74356435643564 - type: max_ap value: 93.17993008259062 - type: max_f1 value: 86.82483594144371 - task: type: Clustering dataset: type: mteb/stackexchange-clustering name: MTEB StackExchangeClustering config: default split: test revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 metrics: - type: v_measure value: 57.525863806168566 - task: type: Clustering dataset: type: mteb/stackexchange-clustering-p2p name: MTEB StackExchangeClusteringP2P config: default split: test revision: 815ca46b2622cec33ccafc3735d572c266efdb44 metrics: - type: v_measure value: 32.68850574423839 - task: type: Reranking dataset: type: mteb/stackoverflowdupquestions-reranking name: MTEB StackOverflowDupQuestions config: default split: test revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 metrics: - type: map value: 49.71580650644033 - type: mrr value: 50.50971903913081 - task: type: Summarization dataset: type: mteb/summeval name: MTEB SummEval config: default split: test revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c metrics: - type: cos_sim_pearson value: 29.152190498799484 - type: cos_sim_spearman value: 29.686180371952727 - type: dot_pearson value: 27.248664793816342 - type: dot_spearman value: 28.37748983721745 - task: type: Retrieval dataset: type: trec-covid name: MTEB TRECCOVID config: default split: test revision: None metrics: - type: map_at_1 value: 0.20400000000000001 - type: map_at_10 value: 1.6209999999999998 - type: map_at_100 value: 9.690999999999999 - type: map_at_1000 value: 23.733 - type: map_at_3 value: 0.575 - type: map_at_5 value: 0.885 - type: mrr_at_1 value: 78 - type: mrr_at_10 value: 86.56700000000001 - type: mrr_at_100 value: 86.56700000000001 - type: mrr_at_1000 value: 86.56700000000001 - type: mrr_at_3 value: 85.667 - type: mrr_at_5 value: 86.56700000000001 - type: ndcg_at_1 value: 76 - type: ndcg_at_10 value: 71.326 - type: ndcg_at_100 value: 54.208999999999996 - type: ndcg_at_1000 value: 49.252 - type: ndcg_at_3 value: 74.235 - type: ndcg_at_5 value: 73.833 - type: precision_at_1 value: 78 - type: precision_at_10 value: 74.8 - type: precision_at_100 value: 55.50000000000001 - type: precision_at_1000 value: 21.836 - type: precision_at_3 value: 78 - type: precision_at_5 value: 78 - type: recall_at_1 value: 0.20400000000000001 - type: recall_at_10 value: 1.894 - type: recall_at_100 value: 13.245999999999999 - type: recall_at_1000 value: 46.373 - type: recall_at_3 value: 0.613 - type: recall_at_5 value: 0.991 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (sqi-eng) config: sqi-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95.89999999999999 - type: f1 value: 94.69999999999999 - type: precision value: 94.11666666666667 - type: recall value: 95.89999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (fry-eng) config: fry-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 68.20809248554913 - type: f1 value: 63.431048720066066 - type: precision value: 61.69143958161298 - type: recall value: 68.20809248554913 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kur-eng) config: kur-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 71.21951219512195 - type: f1 value: 66.82926829268293 - type: precision value: 65.1260162601626 - type: recall value: 71.21951219512195 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tur-eng) config: tur-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.2 - type: f1 value: 96.26666666666667 - type: precision value: 95.8 - type: recall value: 97.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (deu-eng) config: deu-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 99.3 - type: f1 value: 99.06666666666666 - type: precision value: 98.95 - type: recall value: 99.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (nld-eng) config: nld-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.39999999999999 - type: f1 value: 96.63333333333333 - type: precision value: 96.26666666666668 - type: recall value: 97.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ron-eng) config: ron-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96 - type: f1 value: 94.86666666666666 - type: precision value: 94.31666666666668 - type: recall value: 96 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ang-eng) config: ang-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 47.01492537313433 - type: f1 value: 40.178867566927266 - type: precision value: 38.179295828549556 - type: recall value: 47.01492537313433 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ido-eng) config: ido-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 86.5 - type: f1 value: 83.62537480063796 - type: precision value: 82.44555555555554 - type: recall value: 86.5 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (jav-eng) config: jav-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 80.48780487804879 - type: f1 value: 75.45644599303138 - type: precision value: 73.37398373983739 - type: recall value: 80.48780487804879 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (isl-eng) config: isl-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.7 - type: f1 value: 91.95666666666666 - type: precision value: 91.125 - type: recall value: 93.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (slv-eng) config: slv-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 91.73754556500607 - type: f1 value: 89.65168084244632 - type: precision value: 88.73025516403402 - type: recall value: 91.73754556500607 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cym-eng) config: cym-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 81.04347826086956 - type: f1 value: 76.2128364389234 - type: precision value: 74.2 - type: recall value: 81.04347826086956 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kaz-eng) config: kaz-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 83.65217391304348 - type: f1 value: 79.4376811594203 - type: precision value: 77.65797101449274 - type: recall value: 83.65217391304348 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (est-eng) config: est-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 87.5 - type: f1 value: 85.02690476190476 - type: precision value: 83.96261904761904 - type: recall value: 87.5 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (heb-eng) config: heb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 89.3 - type: f1 value: 86.52333333333333 - type: precision value: 85.22833333333332 - type: recall value: 89.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (gla-eng) config: gla-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 65.01809408926418 - type: f1 value: 59.00594446432805 - type: precision value: 56.827215807915444 - type: recall value: 65.01809408926418 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (mar-eng) config: mar-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 91.2 - type: f1 value: 88.58 - type: precision value: 87.33333333333334 - type: recall value: 91.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (lat-eng) config: lat-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 59.199999999999996 - type: f1 value: 53.299166276284915 - type: precision value: 51.3383908045977 - type: recall value: 59.199999999999996 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (bel-eng) config: bel-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.2 - type: f1 value: 91.2 - type: precision value: 90.25 - type: recall value: 93.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (pms-eng) config: pms-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 64.76190476190476 - type: f1 value: 59.867110667110666 - type: precision value: 58.07390192653351 - type: recall value: 64.76190476190476 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (gle-eng) config: gle-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 76.2 - type: f1 value: 71.48147546897547 - type: precision value: 69.65409090909091 - type: recall value: 76.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (pes-eng) config: pes-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.8 - type: f1 value: 92.14 - type: precision value: 91.35833333333333 - type: recall value: 93.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (nob-eng) config: nob-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.89999999999999 - type: f1 value: 97.2 - type: precision value: 96.85000000000001 - type: recall value: 97.89999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (bul-eng) config: bul-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.6 - type: f1 value: 92.93333333333334 - type: precision value: 92.13333333333333 - type: recall value: 94.6 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cbk-eng) config: cbk-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 74.1 - type: f1 value: 69.14817460317461 - type: precision value: 67.2515873015873 - type: recall value: 74.1 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (hun-eng) config: hun-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95.19999999999999 - type: f1 value: 94.01333333333335 - type: precision value: 93.46666666666667 - type: recall value: 95.19999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (uig-eng) config: uig-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 76.9 - type: f1 value: 72.07523809523809 - type: precision value: 70.19777777777779 - type: recall value: 76.9 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (rus-eng) config: rus-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.1 - type: f1 value: 92.31666666666666 - type: precision value: 91.43333333333332 - type: recall value: 94.1 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (spa-eng) config: spa-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.8 - type: f1 value: 97.1 - type: precision value: 96.76666666666668 - type: recall value: 97.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (hye-eng) config: hye-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 92.85714285714286 - type: f1 value: 90.92093441150045 - type: precision value: 90.00449236298293 - type: recall value: 92.85714285714286 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tel-eng) config: tel-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.16239316239316 - type: f1 value: 91.33903133903132 - type: precision value: 90.56267806267806 - type: recall value: 93.16239316239316 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (afr-eng) config: afr-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 92.4 - type: f1 value: 90.25666666666666 - type: precision value: 89.25833333333334 - type: recall value: 92.4 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (mon-eng) config: mon-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 90.22727272727272 - type: f1 value: 87.53030303030303 - type: precision value: 86.37121212121211 - type: recall value: 90.22727272727272 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (arz-eng) config: arz-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 79.03563941299791 - type: f1 value: 74.7349505840072 - type: precision value: 72.9035639412998 - type: recall value: 79.03563941299791 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (hrv-eng) config: hrv-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97 - type: f1 value: 96.15 - type: precision value: 95.76666666666668 - type: recall value: 97 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (nov-eng) config: nov-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 76.26459143968872 - type: f1 value: 71.55642023346303 - type: precision value: 69.7544932369835 - type: recall value: 76.26459143968872 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (gsw-eng) config: gsw-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 58.119658119658126 - type: f1 value: 51.65242165242165 - type: precision value: 49.41768108434775 - type: recall value: 58.119658119658126 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (nds-eng) config: nds-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 74.3 - type: f1 value: 69.52055555555555 - type: precision value: 67.7574938949939 - type: recall value: 74.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ukr-eng) config: ukr-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.8 - type: f1 value: 93.31666666666666 - type: precision value: 92.60000000000001 - type: recall value: 94.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (uzb-eng) config: uzb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 76.63551401869158 - type: f1 value: 72.35202492211837 - type: precision value: 70.60358255451713 - type: recall value: 76.63551401869158 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (lit-eng) config: lit-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 90.4 - type: f1 value: 88.4811111111111 - type: precision value: 87.7452380952381 - type: recall value: 90.4 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ina-eng) config: ina-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95 - type: f1 value: 93.60666666666667 - type: precision value: 92.975 - type: recall value: 95 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (lfn-eng) config: lfn-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 67.2 - type: f1 value: 63.01595782872099 - type: precision value: 61.596587301587306 - type: recall value: 67.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (zsm-eng) config: zsm-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95.7 - type: f1 value: 94.52999999999999 - type: precision value: 94 - type: recall value: 95.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ita-eng) config: ita-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.6 - type: f1 value: 93.28999999999999 - type: precision value: 92.675 - type: recall value: 94.6 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cmn-eng) config: cmn-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.39999999999999 - type: f1 value: 95.28333333333333 - type: precision value: 94.75 - type: recall value: 96.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (lvs-eng) config: lvs-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 91.9 - type: f1 value: 89.83 - type: precision value: 88.92 - type: recall value: 91.9 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (glg-eng) config: glg-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.69999999999999 - type: f1 value: 93.34222222222223 - type: precision value: 92.75416666666668 - type: recall value: 94.69999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ceb-eng) config: ceb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 60.333333333333336 - type: f1 value: 55.31203703703703 - type: precision value: 53.39971108326371 - type: recall value: 60.333333333333336 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (bre-eng) config: bre-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 12.9 - type: f1 value: 11.099861903031458 - type: precision value: 10.589187932631877 - type: recall value: 12.9 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ben-eng) config: ben-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 86.7 - type: f1 value: 83.0152380952381 - type: precision value: 81.37833333333333 - type: recall value: 86.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (swg-eng) config: swg-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 63.39285714285714 - type: f1 value: 56.832482993197274 - type: precision value: 54.56845238095237 - type: recall value: 63.39285714285714 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (arq-eng) config: arq-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 48.73765093304062 - type: f1 value: 41.555736920720456 - type: precision value: 39.06874531737319 - type: recall value: 48.73765093304062 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kab-eng) config: kab-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 41.099999999999994 - type: f1 value: 36.540165945165946 - type: precision value: 35.05175685425686 - type: recall value: 41.099999999999994 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (fra-eng) config: fra-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.89999999999999 - type: f1 value: 93.42333333333333 - type: precision value: 92.75833333333333 - type: recall value: 94.89999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (por-eng) config: por-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.89999999999999 - type: f1 value: 93.63333333333334 - type: precision value: 93.01666666666665 - type: recall value: 94.89999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tat-eng) config: tat-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 77.9 - type: f1 value: 73.64833333333334 - type: precision value: 71.90282106782105 - type: recall value: 77.9 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (oci-eng) config: oci-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 59.4 - type: f1 value: 54.90521367521367 - type: precision value: 53.432840025471606 - type: recall value: 59.4 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (pol-eng) config: pol-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.39999999999999 - type: f1 value: 96.6 - type: precision value: 96.2 - type: recall value: 97.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (war-eng) config: war-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 67.2 - type: f1 value: 62.25926129426129 - type: precision value: 60.408376623376626 - type: recall value: 67.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (aze-eng) config: aze-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 90.2 - type: f1 value: 87.60666666666667 - type: precision value: 86.45277777777778 - type: recall value: 90.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (vie-eng) config: vie-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.7 - type: f1 value: 97 - type: precision value: 96.65 - type: recall value: 97.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (nno-eng) config: nno-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.2 - type: f1 value: 91.39746031746031 - type: precision value: 90.6125 - type: recall value: 93.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cha-eng) config: cha-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 32.11678832116788 - type: f1 value: 27.210415386260234 - type: precision value: 26.20408990846947 - type: recall value: 32.11678832116788 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (mhr-eng) config: mhr-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 8.5 - type: f1 value: 6.787319277832475 - type: precision value: 6.3452094433344435 - type: recall value: 8.5 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (dan-eng) config: dan-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.1 - type: f1 value: 95.08 - type: precision value: 94.61666666666667 - type: recall value: 96.1 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ell-eng) config: ell-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95.3 - type: f1 value: 93.88333333333333 - type: precision value: 93.18333333333332 - type: recall value: 95.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (amh-eng) config: amh-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 85.11904761904762 - type: f1 value: 80.69444444444444 - type: precision value: 78.72023809523809 - type: recall value: 85.11904761904762 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (pam-eng) config: pam-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 11.1 - type: f1 value: 9.276381801735853 - type: precision value: 8.798174603174601 - type: recall value: 11.1 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (hsb-eng) config: hsb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 63.56107660455487 - type: f1 value: 58.70433569191332 - type: precision value: 56.896926581464015 - type: recall value: 63.56107660455487 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (srp-eng) config: srp-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.69999999999999 - type: f1 value: 93.10000000000001 - type: precision value: 92.35 - type: recall value: 94.69999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (epo-eng) config: epo-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.8 - type: f1 value: 96.01222222222222 - type: precision value: 95.67083333333332 - type: recall value: 96.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kzj-eng) config: kzj-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 9.2 - type: f1 value: 7.911555250305249 - type: precision value: 7.631246556216846 - type: recall value: 9.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (awa-eng) config: awa-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 77.48917748917748 - type: f1 value: 72.27375798804371 - type: precision value: 70.14430014430013 - type: recall value: 77.48917748917748 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (fao-eng) config: fao-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 77.09923664122137 - type: f1 value: 72.61541257724463 - type: precision value: 70.8998380754106 - type: recall value: 77.09923664122137 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (mal-eng) config: mal-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 98.2532751091703 - type: f1 value: 97.69529354682193 - type: precision value: 97.42843279961184 - type: recall value: 98.2532751091703 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ile-eng) config: ile-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 82.8 - type: f1 value: 79.14672619047619 - type: precision value: 77.59489247311828 - type: recall value: 82.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (bos-eng) config: bos-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.35028248587571 - type: f1 value: 92.86252354048965 - type: precision value: 92.2080979284369 - type: recall value: 94.35028248587571 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cor-eng) config: cor-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 8.5 - type: f1 value: 6.282429263935621 - type: precision value: 5.783274240739785 - type: recall value: 8.5 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cat-eng) config: cat-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 92.7 - type: f1 value: 91.025 - type: precision value: 90.30428571428571 - type: recall value: 92.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (eus-eng) config: eus-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 81 - type: f1 value: 77.8232380952381 - type: precision value: 76.60194444444444 - type: recall value: 81 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (yue-eng) config: yue-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 91 - type: f1 value: 88.70857142857142 - type: precision value: 87.7 - type: recall value: 91 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (swe-eng) config: swe-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.39999999999999 - type: f1 value: 95.3 - type: precision value: 94.76666666666667 - type: recall value: 96.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (dtp-eng) config: dtp-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 8.1 - type: f1 value: 7.001008218834307 - type: precision value: 6.708329562594269 - type: recall value: 8.1 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kat-eng) config: kat-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 87.1313672922252 - type: f1 value: 84.09070598748882 - type: precision value: 82.79171454104429 - type: recall value: 87.1313672922252 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (jpn-eng) config: jpn-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.39999999999999 - type: f1 value: 95.28333333333333 - type: precision value: 94.73333333333332 - type: recall value: 96.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (csb-eng) config: csb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 42.29249011857708 - type: f1 value: 36.981018542283365 - type: precision value: 35.415877813576024 - type: recall value: 42.29249011857708 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (xho-eng) config: xho-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 83.80281690140845 - type: f1 value: 80.86854460093896 - type: precision value: 79.60093896713614 - type: recall value: 83.80281690140845 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (orv-eng) config: orv-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 45.26946107784431 - type: f1 value: 39.80235464678088 - type: precision value: 38.14342660001342 - type: recall value: 45.26946107784431 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ind-eng) config: ind-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.3 - type: f1 value: 92.9 - type: precision value: 92.26666666666668 - type: recall value: 94.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tuk-eng) config: tuk-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 37.93103448275862 - type: f1 value: 33.15192743764172 - type: precision value: 31.57456528146183 - type: recall value: 37.93103448275862 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (max-eng) config: max-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 69.01408450704226 - type: f1 value: 63.41549295774648 - type: precision value: 61.342778895595806 - type: recall value: 69.01408450704226 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (swh-eng) config: swh-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 76.66666666666667 - type: f1 value: 71.60705960705961 - type: precision value: 69.60683760683762 - type: recall value: 76.66666666666667 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (hin-eng) config: hin-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95.8 - type: f1 value: 94.48333333333333 - type: precision value: 93.83333333333333 - type: recall value: 95.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (dsb-eng) config: dsb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 52.81837160751566 - type: f1 value: 48.435977731384824 - type: precision value: 47.11291973845539 - type: recall value: 52.81837160751566 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ber-eng) config: ber-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 44.9 - type: f1 value: 38.88962621607783 - type: precision value: 36.95936507936508 - type: recall value: 44.9 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tam-eng) config: tam-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 90.55374592833876 - type: f1 value: 88.22553125484721 - type: precision value: 87.26927252985884 - type: recall value: 90.55374592833876 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (slk-eng) config: slk-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.6 - type: f1 value: 93.13333333333333 - type: precision value: 92.45333333333333 - type: recall value: 94.6 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tgl-eng) config: tgl-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.7 - type: f1 value: 91.99666666666667 - type: precision value: 91.26666666666668 - type: recall value: 93.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ast-eng) config: ast-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 85.03937007874016 - type: f1 value: 81.75853018372703 - type: precision value: 80.34120734908137 - type: recall value: 85.03937007874016 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (mkd-eng) config: mkd-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 88.3 - type: f1 value: 85.5 - type: precision value: 84.25833333333334 - type: recall value: 88.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (khm-eng) config: khm-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 65.51246537396122 - type: f1 value: 60.02297410192148 - type: precision value: 58.133467727289236 - type: recall value: 65.51246537396122 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ces-eng) config: ces-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96 - type: f1 value: 94.89 - type: precision value: 94.39166666666667 - type: recall value: 96 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tzl-eng) config: tzl-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 57.692307692307686 - type: f1 value: 53.162393162393165 - type: precision value: 51.70673076923077 - type: recall value: 57.692307692307686 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (urd-eng) config: urd-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 91.60000000000001 - type: f1 value: 89.21190476190475 - type: precision value: 88.08666666666667 - type: recall value: 91.60000000000001 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ara-eng) config: ara-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 88 - type: f1 value: 85.47 - type: precision value: 84.43266233766234 - type: recall value: 88 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kor-eng) config: kor-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 92.7 - type: f1 value: 90.64999999999999 - type: precision value: 89.68333333333332 - type: recall value: 92.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (yid-eng) config: yid-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 80.30660377358491 - type: f1 value: 76.33044137466307 - type: precision value: 74.78970125786164 - type: recall value: 80.30660377358491 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (fin-eng) config: fin-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.39999999999999 - type: f1 value: 95.44 - type: precision value: 94.99166666666666 - type: recall value: 96.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tha-eng) config: tha-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.53284671532847 - type: f1 value: 95.37712895377129 - type: precision value: 94.7992700729927 - type: recall value: 96.53284671532847 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (wuu-eng) config: wuu-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 89 - type: f1 value: 86.23190476190476 - type: precision value: 85.035 - type: recall value: 89 - task: type: Retrieval dataset: type: webis-touche2020 name: MTEB Touche2020 config: default split: test revision: None metrics: - type: map_at_1 value: 2.585 - type: map_at_10 value: 9.012 - type: map_at_100 value: 14.027000000000001 - type: map_at_1000 value: 15.565000000000001 - type: map_at_3 value: 5.032 - type: map_at_5 value: 6.657 - type: mrr_at_1 value: 28.571 - type: mrr_at_10 value: 45.377 - type: mrr_at_100 value: 46.119 - type: mrr_at_1000 value: 46.127 - type: mrr_at_3 value: 41.156 - type: mrr_at_5 value: 42.585 - type: ndcg_at_1 value: 27.551 - type: ndcg_at_10 value: 23.395 - type: ndcg_at_100 value: 33.342 - type: ndcg_at_1000 value: 45.523 - type: ndcg_at_3 value: 25.158 - type: ndcg_at_5 value: 23.427 - type: precision_at_1 value: 28.571 - type: precision_at_10 value: 21.429000000000002 - type: precision_at_100 value: 6.714 - type: precision_at_1000 value: 1.473 - type: precision_at_3 value: 27.211000000000002 - type: precision_at_5 value: 24.490000000000002 - type: recall_at_1 value: 2.585 - type: recall_at_10 value: 15.418999999999999 - type: recall_at_100 value: 42.485 - type: recall_at_1000 value: 79.536 - type: recall_at_3 value: 6.239999999999999 - type: recall_at_5 value: 8.996 - task: type: Classification dataset: type: mteb/toxic_conversations_50k name: MTEB ToxicConversationsClassification config: default split: test revision: d7c0de2777da35d6aae2200a62c6e0e5af397c4c metrics: - type: accuracy value: 71.3234 - type: ap value: 14.361688653847423 - type: f1 value: 54.819068624319044 - task: type: Classification dataset: type: mteb/tweet_sentiment_extraction name: MTEB TweetSentimentExtractionClassification config: default split: test revision: d604517c81ca91fe16a244d1248fc021f9ecee7a metrics: - type: accuracy value: 61.97792869269949 - type: f1 value: 62.28965628513728 - task: type: Clustering dataset: type: mteb/twentynewsgroups-clustering name: MTEB TwentyNewsgroupsClustering config: default split: test revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 metrics: - type: v_measure value: 38.90540145385218 - task: type: PairClassification dataset: type: mteb/twittersemeval2015-pairclassification name: MTEB TwitterSemEval2015 config: default split: test revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 metrics: - type: cos_sim_accuracy value: 86.53513739047506 - type: cos_sim_ap value: 75.27741586677557 - type: cos_sim_f1 value: 69.18792902473774 - type: cos_sim_precision value: 67.94708725515136 - type: cos_sim_recall value: 70.47493403693932 - type: dot_accuracy value: 84.7052512368123 - type: dot_ap value: 69.36075482849378 - type: dot_f1 value: 64.44688376631296 - type: dot_precision value: 59.92288500793831 - type: dot_recall value: 69.70976253298153 - type: euclidean_accuracy value: 86.60666388508076 - type: euclidean_ap value: 75.47512772621097 - type: euclidean_f1 value: 69.413872536473 - type: euclidean_precision value: 67.39562624254472 - type: euclidean_recall value: 71.55672823218997 - type: manhattan_accuracy value: 86.52917684925792 - type: manhattan_ap value: 75.34000110496703 - type: manhattan_f1 value: 69.28489190226429 - type: manhattan_precision value: 67.24608889992551 - type: manhattan_recall value: 71.45118733509234 - type: max_accuracy value: 86.60666388508076 - type: max_ap value: 75.47512772621097 - type: max_f1 value: 69.413872536473 - task: type: PairClassification dataset: type: mteb/twitterurlcorpus-pairclassification name: MTEB TwitterURLCorpus config: default split: test revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf metrics: - type: cos_sim_accuracy value: 89.01695967710637 - type: cos_sim_ap value: 85.8298270742901 - type: cos_sim_f1 value: 78.46988128389272 - type: cos_sim_precision value: 74.86017897091722 - type: cos_sim_recall value: 82.44533415460425 - type: dot_accuracy value: 88.19420188613343 - type: dot_ap value: 83.82679165901324 - type: dot_f1 value: 76.55833777304208 - type: dot_precision value: 75.6884875846501 - type: dot_recall value: 77.44841392054204 - type: euclidean_accuracy value: 89.03054294252338 - type: euclidean_ap value: 85.89089555185325 - type: euclidean_f1 value: 78.62997658079624 - type: euclidean_precision value: 74.92329149232914 - type: euclidean_recall value: 82.72251308900523 - type: manhattan_accuracy value: 89.0266620095471 - type: manhattan_ap value: 85.86458997929147 - type: manhattan_f1 value: 78.50685331000291 - type: manhattan_precision value: 74.5499861534201 - type: manhattan_recall value: 82.90729904527257 - type: max_accuracy value: 89.03054294252338 - type: max_ap value: 85.89089555185325 - type: max_f1 value: 78.62997658079624 language: - multilingual - af - am - ar - as - az - be - bg - bn - br - bs - ca - cs - cy - da - de - el - en - eo - es - et - eu - fa - fi - fr - fy - ga - gd - gl - gu - ha - he - hi - hr - hu - hy - id - is - it - ja - jv - ka - kk - km - kn - ko - ku - ky - la - lo - lt - lv - mg - mk - ml - mn - mr - ms - my - ne - nl - 'no' - om - or - pa - pl - ps - pt - ro - ru - sa - sd - si - sk - sl - so - sq - sr - su - sv - sw - ta - te - th - tl - tr - ug - uk - ur - uz - vi - xh - yi - zh license: mit --- ## Multilingual-E5-large [Multilingual E5 Text Embeddings: A Technical Report](https://arxiv.org/pdf/2402.05672). Liang Wang, Nan Yang, Xiaolong Huang, Linjun Yang, Rangan Majumder, Furu Wei, arXiv 2024 This model has 24 layers and the embedding size is 1024. ## Usage Below is an example to encode queries and passages from the MS-MARCO passage ranking dataset. ```python import torch.nn.functional as F from torch import Tensor from transformers import AutoTokenizer, AutoModel def average_pool(last_hidden_states: Tensor, attention_mask: Tensor) -> Tensor: last_hidden = last_hidden_states.masked_fill(~attention_mask[..., None].bool(), 0.0) return last_hidden.sum(dim=1) / attention_mask.sum(dim=1)[..., None] # Each input text should start with "query: " or "passage: ", even for non-English texts. # For tasks other than retrieval, you can simply use the "query: " prefix. input_texts = ['query: how much protein should a female eat', 'query: 南瓜的家常做法', "passage: As a general guideline, the CDC's average requirement of protein for women ages 19 to 70 is 46 grams per day. But, as you can see from this chart, you'll need to increase that if you're expecting or training for a marathon. Check out the chart below to see how much protein you should be eating each day.", "passage: 1.清炒南瓜丝 原料:嫩南瓜半个 调料:葱、盐、白糖、鸡精 做法: 1、南瓜用刀薄薄的削去表面一层皮,用勺子刮去瓤 2、擦成细丝(没有擦菜板就用刀慢慢切成细丝) 3、锅烧热放油,入葱花煸出香味 4、入南瓜丝快速翻炒一分钟左右,放盐、一点白糖和鸡精调味出锅 2.香葱炒南瓜 原料:南瓜1只 调料:香葱、蒜末、橄榄油、盐 做法: 1、将南瓜去皮,切成片 2、油锅8成热后,将蒜末放入爆香 3、爆香后,将南瓜片放入,翻炒 4、在翻炒的同时,可以不时地往锅里加水,但不要太多 5、放入盐,炒匀 6、南瓜差不多软和绵了之后,就可以关火 7、撒入香葱,即可出锅"] tokenizer = AutoTokenizer.from_pretrained('intfloat/multilingual-e5-large') model = AutoModel.from_pretrained('intfloat/multilingual-e5-large') # Tokenize the input texts batch_dict = tokenizer(input_texts, max_length=512, padding=True, truncation=True, return_tensors='pt') outputs = model(**batch_dict) embeddings = average_pool(outputs.last_hidden_state, batch_dict['attention_mask']) # normalize embeddings embeddings = F.normalize(embeddings, p=2, dim=1) scores = (embeddings[:2] @ embeddings[2:].T) * 100 print(scores.tolist()) ``` ## Supported Languages This model is initialized from [xlm-roberta-large](https://huggingface.co/xlm-roberta-large) and continually trained on a mixture of multilingual datasets. It supports 100 languages from xlm-roberta, but low-resource languages may see performance degradation. ## Training Details **Initialization**: [xlm-roberta-large](https://huggingface.co/xlm-roberta-large) **First stage**: contrastive pre-training with weak supervision | Dataset | Weak supervision | # of text pairs | |--------------------------------------------------------------------------------------------------------|---------------------------------------|-----------------| | Filtered [mC4](https://huggingface.co/datasets/mc4) | (title, page content) | 1B | | [CC News](https://huggingface.co/datasets/intfloat/multilingual_cc_news) | (title, news content) | 400M | | [NLLB](https://huggingface.co/datasets/allenai/nllb) | translation pairs | 2.4B | | [Wikipedia](https://huggingface.co/datasets/intfloat/wikipedia) | (hierarchical section title, passage) | 150M | | Filtered [Reddit](https://www.reddit.com/) | (comment, response) | 800M | | [S2ORC](https://github.com/allenai/s2orc) | (title, abstract) and citation pairs | 100M | | [Stackexchange](https://stackexchange.com/) | (question, answer) | 50M | | [xP3](https://huggingface.co/datasets/bigscience/xP3) | (input prompt, response) | 80M | | [Miscellaneous unsupervised SBERT data](https://huggingface.co/sentence-transformers/all-MiniLM-L6-v2) | - | 10M | **Second stage**: supervised fine-tuning | Dataset | Language | # of text pairs | |----------------------------------------------------------------------------------------|--------------|-----------------| | [MS MARCO](https://microsoft.github.io/msmarco/) | English | 500k | | [NQ](https://github.com/facebookresearch/DPR) | English | 70k | | [Trivia QA](https://github.com/facebookresearch/DPR) | English | 60k | | [NLI from SimCSE](https://github.com/princeton-nlp/SimCSE) | English | <300k | | [ELI5](https://huggingface.co/datasets/eli5) | English | 500k | | [DuReader Retrieval](https://github.com/baidu/DuReader/tree/master/DuReader-Retrieval) | Chinese | 86k | | [KILT Fever](https://huggingface.co/datasets/kilt_tasks) | English | 70k | | [KILT HotpotQA](https://huggingface.co/datasets/kilt_tasks) | English | 70k | | [SQuAD](https://huggingface.co/datasets/squad) | English | 87k | | [Quora](https://huggingface.co/datasets/quora) | English | 150k | | [Mr. TyDi](https://huggingface.co/datasets/castorini/mr-tydi) | 11 languages | 50k | | [MIRACL](https://huggingface.co/datasets/miracl/miracl) | 16 languages | 40k | For all labeled datasets, we only use its training set for fine-tuning. For other training details, please refer to our paper at [https://arxiv.org/pdf/2402.05672](https://arxiv.org/pdf/2402.05672). ## Benchmark Results on [Mr. TyDi](https://arxiv.org/abs/2108.08787) | Model | Avg MRR@10 | | ar | bn | en | fi | id | ja | ko | ru | sw | te | th | |-----------------------|------------|-------|------| --- | --- | --- | --- | --- | --- | --- |------| --- | --- | | BM25 | 33.3 | | 36.7 | 41.3 | 15.1 | 28.8 | 38.2 | 21.7 | 28.1 | 32.9 | 39.6 | 42.4 | 41.7 | | mDPR | 16.7 | | 26.0 | 25.8 | 16.2 | 11.3 | 14.6 | 18.1 | 21.9 | 18.5 | 7.3 | 10.6 | 13.5 | | BM25 + mDPR | 41.7 | | 49.1 | 53.5 | 28.4 | 36.5 | 45.5 | 35.5 | 36.2 | 42.7 | 40.5 | 42.0 | 49.2 | | | | | multilingual-e5-small | 64.4 | | 71.5 | 66.3 | 54.5 | 57.7 | 63.2 | 55.4 | 54.3 | 60.8 | 65.4 | 89.1 | 70.1 | | multilingual-e5-base | 65.9 | | 72.3 | 65.0 | 58.5 | 60.8 | 64.9 | 56.6 | 55.8 | 62.7 | 69.0 | 86.6 | 72.7 | | multilingual-e5-large | **70.5** | | 77.5 | 73.2 | 60.8 | 66.8 | 68.5 | 62.5 | 61.6 | 65.8 | 72.7 | 90.2 | 76.2 | ## MTEB Benchmark Evaluation Check out [unilm/e5](https://github.com/microsoft/unilm/tree/master/e5) to reproduce evaluation results on the [BEIR](https://arxiv.org/abs/2104.08663) and [MTEB benchmark](https://arxiv.org/abs/2210.07316). ## Support for Sentence Transformers Below is an example for usage with sentence_transformers. ```python from sentence_transformers import SentenceTransformer model = SentenceTransformer('intfloat/multilingual-e5-large') input_texts = [ 'query: how much protein should a female eat', 'query: 南瓜的家常做法', "passage: As a general guideline, the CDC's average requirement of protein for women ages 19 to 70 i s 46 grams per day. But, as you can see from this chart, you'll need to increase that if you're expecting or traini ng for a marathon. Check out the chart below to see how much protein you should be eating each day.", "passage: 1.清炒南瓜丝 原料:嫩南瓜半个 调料:葱、盐、白糖、鸡精 做法: 1、南瓜用刀薄薄的削去表面一层皮 ,用勺子刮去瓤 2、擦成细丝(没有擦菜板就用刀慢慢切成细丝) 3、锅烧热放油,入葱花煸出香味 4、入南瓜丝快速翻炒一分钟左右, 放盐、一点白糖和鸡精调味出锅 2.香葱炒南瓜 原料:南瓜1只 调料:香葱、蒜末、橄榄油、盐 做法: 1、将南瓜去皮,切成片 2、油 锅8成热后,将蒜末放入爆香 3、爆香后,将南瓜片放入,翻炒 4、在翻炒的同时,可以不时地往锅里加水,但不要太多 5、放入盐,炒匀 6、南瓜差不多软和绵了之后,就可以关火 7、撒入香葱,即可出锅" ] embeddings = model.encode(input_texts, normalize_embeddings=True) ``` Package requirements `pip install sentence_transformers~=2.2.2` Contributors: [michaelfeil](https://huggingface.co/michaelfeil) ## FAQ **1. Do I need to add the prefix "query: " and "passage: " to input texts?** Yes, this is how the model is trained, otherwise you will see a performance degradation. Here are some rules of thumb: - Use "query: " and "passage: " correspondingly for asymmetric tasks such as passage retrieval in open QA, ad-hoc information retrieval. - Use "query: " prefix for symmetric tasks such as semantic similarity, bitext mining, paraphrase retrieval. - Use "query: " prefix if you want to use embeddings as features, such as linear probing classification, clustering. **2. Why are my reproduced results slightly different from reported in the model card?** Different versions of `transformers` and `pytorch` could cause negligible but non-zero performance differences. **3. Why does the cosine similarity scores distribute around 0.7 to 1.0?** This is a known and expected behavior as we use a low temperature 0.01 for InfoNCE contrastive loss. For text embedding tasks like text retrieval or semantic similarity, what matters is the relative order of the scores instead of the absolute values, so this should not be an issue. ## Citation If you find our paper or models helpful, please consider cite as follows: ``` @article{wang2024multilingual, title={Multilingual E5 Text Embeddings: A Technical Report}, author={Wang, Liang and Yang, Nan and Huang, Xiaolong and Yang, Linjun and Majumder, Rangan and Wei, Furu}, journal={arXiv preprint arXiv:2402.05672}, year={2024} } ``` ## Limitations Long texts will be truncated to at most 512 tokens.

tsmatz/xlm-roberta-ner-japanese

tsmatz

transformers

token-classification

--- language: - ja license: mit tags: - generated_from_trainer - ner - bert metrics: - f1 widget: - text: 鈴木は4月の陽気の良い日に、鈴をつけて熊本県の阿蘇山に登った - text: 中国では、中国共産党による一党統治が続く base_model: xlm-roberta-base model-index: - name: xlm-roberta-ner-ja results: [] --- <!-- This model card has been generated automatically according to the information the Trainer had access to. You should probably proofread and complete it, then remove this comment. --> # xlm-roberta-ner-japanese (Japanese caption : 日本語の固有表現抽出のモデル) This model is a fine-tuned version of [xlm-roberta-base](https://huggingface.co/xlm-roberta-base) (pre-trained cross-lingual ```RobertaModel```) trained for named entity recognition (NER) token classification. The model is fine-tuned on NER dataset provided by Stockmark Inc, in which data is collected from Japanese Wikipedia articles.<br> See [here](https://github.com/stockmarkteam/ner-wikipedia-dataset) for the license of this dataset. Each token is labeled by : | Label id | Tag | Tag in Widget | Description | |---|---|---|---| | 0 | O | (None) | others or nothing | | 1 | PER | PER | person | | 2 | ORG | ORG | general corporation organization | | 3 | ORG-P | P | political organization | | 4 | ORG-O | O | other organization | | 5 | LOC | LOC | location | | 6 | INS | INS | institution, facility | | 7 | PRD | PRD | product | | 8 | EVT | EVT | event | ## Intended uses ```python from transformers import pipeline model_name = "tsmatz/xlm-roberta-ner-japanese" classifier = pipeline("token-classification", model=model_name) result = classifier("鈴木は4月の陽気の良い日に、鈴をつけて熊本県の阿蘇山に登った") print(result) ``` ## Training procedure You can download the source code for fine-tuning from [here](https://github.com/tsmatz/huggingface-finetune-japanese/blob/master/01-named-entity.ipynb). ### Training hyperparameters The following hyperparameters were used during training: - learning_rate: 5e-05 - train_batch_size: 12 - eval_batch_size: 12 - seed: 42 - optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 - lr_scheduler_type: linear - num_epochs: 5 ### Training results | Training Loss | Epoch | Step | Validation Loss | F1 | |:-------------:|:-----:|:----:|:---------------:|:------:| | No log | 1.0 | 446 | 0.1510 | 0.8457 | | No log | 2.0 | 892 | 0.0626 | 0.9261 | | No log | 3.0 | 1338 | 0.0366 | 0.9580 | | No log | 4.0 | 1784 | 0.0196 | 0.9792 | | No log | 5.0 | 2230 | 0.0173 | 0.9864 | ### Framework versions - Transformers 4.23.1 - Pytorch 1.12.1+cu102 - Datasets 2.6.1 - Tokenizers 0.13.1

amazon/chronos-t5-small

amazon

transformers

time-series-forecasting

--- license: apache-2.0 pipeline_tag: time-series-forecasting tags: - time series - forecasting - pretrained models - foundation models - time series foundation models - time-series --- # Chronos-T5 (Small) Chronos is a family of **pretrained time series forecasting models** based on language model architectures. A time series is transformed into a sequence of tokens via scaling and quantization, and a language model is trained on these tokens using the cross-entropy loss. Once trained, probabilistic forecasts are obtained by sampling multiple future trajectories given the historical context. Chronos models have been trained on a large corpus of publicly available time series data, as well as synthetic data generated using Gaussian processes. For details on Chronos models, training data and procedures, and experimental results, please refer to the paper [Chronos: Learning the Language of Time Series](https://arxiv.org/abs/2403.07815). <p align="center"> <img src="figures/main-figure.png" width="100%"> <br /> <span> Fig. 1: High-level depiction of Chronos. (<b>Left</b>) The input time series is scaled and quantized to obtain a sequence of tokens. (<b>Center</b>) The tokens are fed into a language model which may either be an encoder-decoder or a decoder-only model. The model is trained using the cross-entropy loss. (<b>Right</b>) During inference, we autoregressively sample tokens from the model and map them back to numerical values. Multiple trajectories are sampled to obtain a predictive distribution. </span> </p> --- ## Architecture The models in this repository are based on the [T5 architecture](https://arxiv.org/abs/1910.10683). The only difference is in the vocabulary size: Chronos-T5 models use 4096 different tokens, compared to 32128 of the original T5 models, resulting in fewer parameters. | Model | Parameters | Based on | | ---------------------------------------------------------------------- | ---------- | ---------------------------------------------------------------------- | | [**chronos-t5-tiny**](https://huggingface.co/amazon/chronos-t5-tiny) | 8M | [t5-efficient-tiny](https://huggingface.co/google/t5-efficient-tiny) | | [**chronos-t5-mini**](https://huggingface.co/amazon/chronos-t5-mini) | 20M | [t5-efficient-mini](https://huggingface.co/google/t5-efficient-mini) | | [**chronos-t5-small**](https://huggingface.co/amazon/chronos-t5-small) | 46M | [t5-efficient-small](https://huggingface.co/google/t5-efficient-small) | | [**chronos-t5-base**](https://huggingface.co/amazon/chronos-t5-base) | 200M | [t5-efficient-base](https://huggingface.co/google/t5-efficient-base) | | [**chronos-t5-large**](https://huggingface.co/amazon/chronos-t5-large) | 710M | [t5-efficient-large](https://huggingface.co/google/t5-efficient-large) | ## Usage To perform inference with Chronos models, install the package in the GitHub [companion repo](https://github.com/amazon-science/chronos-forecasting) by running: ``` pip install git+https://github.com/amazon-science/chronos-forecasting.git ``` A minimal example showing how to perform inference using Chronos models: ```python import matplotlib.pyplot as plt import numpy as np import pandas as pd import torch from chronos import ChronosPipeline pipeline = ChronosPipeline.from_pretrained( "amazon/chronos-t5-small", device_map="cuda", torch_dtype=torch.bfloat16, ) df = pd.read_csv("https://raw.githubusercontent.com/AileenNielsen/TimeSeriesAnalysisWithPython/master/data/AirPassengers.csv") # context must be either a 1D tensor, a list of 1D tensors, # or a left-padded 2D tensor with batch as the first dimension context = torch.tensor(df["#Passengers"]) prediction_length = 12 forecast = pipeline.predict(context, prediction_length) # shape [num_series, num_samples, prediction_length] # visualize the forecast forecast_index = range(len(df), len(df) + prediction_length) low, median, high = np.quantile(forecast[0].numpy(), [0.1, 0.5, 0.9], axis=0) plt.figure(figsize=(8, 4)) plt.plot(df["#Passengers"], color="royalblue", label="historical data") plt.plot(forecast_index, median, color="tomato", label="median forecast") plt.fill_between(forecast_index, low, high, color="tomato", alpha=0.3, label="80% prediction interval") plt.legend() plt.grid() plt.show() ``` ## Citation If you find Chronos models useful for your research, please consider citing the associated [paper](https://arxiv.org/abs/2403.07815): ``` @article{ansari2024chronos, author = {Ansari, Abdul Fatir and Stella, Lorenzo and Turkmen, Caner and Zhang, Xiyuan, and Mercado, Pedro and Shen, Huibin and Shchur, Oleksandr and Rangapuram, Syama Syndar and Pineda Arango, Sebastian and Kapoor, Shubham and Zschiegner, Jasper and Maddix, Danielle C. and Mahoney, Michael W. and Torkkola, Kari and Gordon Wilson, Andrew and Bohlke-Schneider, Michael and Wang, Yuyang}, title = {Chronos: Learning the Language of Time Series}, journal = {arXiv preprint arXiv:2403.07815}, year = {2024} } ``` ## Security See [CONTRIBUTING](CONTRIBUTING.md#security-issue-notifications) for more information. ## License This project is licensed under the Apache-2.0 License.

tohoku-nlp/bert-base-japanese

tohoku-nlp

transformers

fill-mask

--- language: ja license: cc-by-sa-4.0 datasets: - wikipedia widget: - text: 東北大学で[MASK]の研究をしています。 --- # BERT base Japanese (IPA dictionary) This is a [BERT](https://github.com/google-research/bert) model pretrained on texts in the Japanese language. This version of the model processes input texts with word-level tokenization based on the IPA dictionary, followed by the WordPiece subword tokenization. The codes for the pretraining are available at [cl-tohoku/bert-japanese](https://github.com/cl-tohoku/bert-japanese/tree/v1.0). ## Model architecture The model architecture is the same as the original BERT base model; 12 layers, 768 dimensions of hidden states, and 12 attention heads. ## Training Data The model is trained on Japanese Wikipedia as of September 1, 2019. To generate the training corpus, [WikiExtractor](https://github.com/attardi/wikiextractor) is used to extract plain texts from a dump file of Wikipedia articles. The text files used for the training are 2.6GB in size, consisting of approximately 17M sentences. ## Tokenization The texts are first tokenized by [MeCab](https://taku910.github.io/mecab/) morphological parser with the IPA dictionary and then split into subwords by the WordPiece algorithm. The vocabulary size is 32000. ## Training The model is trained with the same configuration as the original BERT; 512 tokens per instance, 256 instances per batch, and 1M training steps. ## Licenses The pretrained models are distributed under the terms of the [Creative Commons Attribution-ShareAlike 3.0](https://creativecommons.org/licenses/by-sa/3.0/). ## Acknowledgments For training models, we used Cloud TPUs provided by [TensorFlow Research Cloud](https://www.tensorflow.org/tfrc/) program.

mattmdjaga/segformer_b2_clothes

mattmdjaga

transformers

image-segmentation

--- license: mit tags: - vision - image-segmentation widget: - src: https://images.unsplash.com/photo-1643310325061-2beef64926a5?ixlib=rb-4.0.3&ixid=MnwxMjA3fDB8MHxzZWFyY2h8Nnx8cmFjb29uc3xlbnwwfHwwfHw%3D&w=1000&q=80 example_title: Person - src: https://freerangestock.com/sample/139043/young-man-standing-and-leaning-on-car.jpg example_title: Person datasets: - mattmdjaga/human_parsing_dataset --- # Segformer B2 fine-tuned for clothes segmentation SegFormer model fine-tuned on [ATR dataset](https://github.com/lemondan/HumanParsing-Dataset) for clothes segmentation but can also be used for human segmentation. The dataset on hugging face is called "mattmdjaga/human_parsing_dataset". **[Training code](https://github.com/mattmdjaga/segformer_b2_clothes)**. ```python from transformers import SegformerImageProcessor, AutoModelForSemanticSegmentation from PIL import Image import requests import matplotlib.pyplot as plt import torch.nn as nn processor = SegformerImageProcessor.from_pretrained("mattmdjaga/segformer_b2_clothes") model = AutoModelForSemanticSegmentation.from_pretrained("mattmdjaga/segformer_b2_clothes") url = "https://plus.unsplash.com/premium_photo-1673210886161-bfcc40f54d1f?ixlib=rb-4.0.3&ixid=MnwxMjA3fDB8MHxzZWFyY2h8MXx8cGVyc29uJTIwc3RhbmRpbmd8ZW58MHx8MHx8&w=1000&q=80" image = Image.open(requests.get(url, stream=True).raw) inputs = processor(images=image, return_tensors="pt") outputs = model(**inputs) logits = outputs.logits.cpu() upsampled_logits = nn.functional.interpolate( logits, size=image.size[::-1], mode="bilinear", align_corners=False, ) pred_seg = upsampled_logits.argmax(dim=1)[0] plt.imshow(pred_seg) ``` Labels: 0: "Background", 1: "Hat", 2: "Hair", 3: "Sunglasses", 4: "Upper-clothes", 5: "Skirt", 6: "Pants", 7: "Dress", 8: "Belt", 9: "Left-shoe", 10: "Right-shoe", 11: "Face", 12: "Left-leg", 13: "Right-leg", 14: "Left-arm", 15: "Right-arm", 16: "Bag", 17: "Scarf" ### Evaluation | Label Index | Label Name | Category Accuracy | Category IoU | |:-------------:|:----------------:|:-----------------:|:------------:| | 0 | Background | 0.99 | 0.99 | | 1 | Hat | 0.73 | 0.68 | | 2 | Hair | 0.91 | 0.82 | | 3 | Sunglasses | 0.73 | 0.63 | | 4 | Upper-clothes | 0.87 | 0.78 | | 5 | Skirt | 0.76 | 0.65 | | 6 | Pants | 0.90 | 0.84 | | 7 | Dress | 0.74 | 0.55 | | 8 | Belt | 0.35 | 0.30 | | 9 | Left-shoe | 0.74 | 0.58 | | 10 | Right-shoe | 0.75 | 0.60 | | 11 | Face | 0.92 | 0.85 | | 12 | Left-leg | 0.90 | 0.82 | | 13 | Right-leg | 0.90 | 0.81 | | 14 | Left-arm | 0.86 | 0.74 | | 15 | Right-arm | 0.82 | 0.73 | | 16 | Bag | 0.91 | 0.84 | | 17 | Scarf | 0.63 | 0.29 | Overall Evaluation Metrics: - Evaluation Loss: 0.15 - Mean Accuracy: 0.80 - Mean IoU: 0.69 ### License The license for this model can be found [here](https://github.com/NVlabs/SegFormer/blob/master/LICENSE). ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-2105-15203, author = {Enze Xie and Wenhai Wang and Zhiding Yu and Anima Anandkumar and Jose M. Alvarez and Ping Luo}, title = {SegFormer: Simple and Efficient Design for Semantic Segmentation with Transformers}, journal = {CoRR}, volume = {abs/2105.15203}, year = {2021}, url = {https://arxiv.org/abs/2105.15203}, eprinttype = {arXiv}, eprint = {2105.15203}, timestamp = {Wed, 02 Jun 2021 11:46:42 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2105-15203.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

facebook/contriever

facebook

transformers

This model has been trained without supervision following the approach described in [Towards Unsupervised Dense Information Retrieval with Contrastive Learning](https://arxiv.org/abs/2112.09118). The associated GitHub repository is available here https://github.com/facebookresearch/contriever. ## Usage (HuggingFace Transformers) Using the model directly available in HuggingFace transformers requires to add a mean pooling operation to obtain a sentence embedding. ```python import torch from transformers import AutoTokenizer, AutoModel tokenizer = AutoTokenizer.from_pretrained('facebook/contriever') model = AutoModel.from_pretrained('facebook/contriever') sentences = [ "Where was Marie Curie born?", "Maria Sklodowska, later known as Marie Curie, was born on November 7, 1867.", "Born in Paris on 15 May 1859, Pierre Curie was the son of Eugène Curie, a doctor of French Catholic origin from Alsace." ] # Apply tokenizer inputs = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # Compute token embeddings outputs = model(**inputs) # Mean pooling def mean_pooling(token_embeddings, mask): token_embeddings = token_embeddings.masked_fill(~mask[..., None].bool(), 0.) sentence_embeddings = token_embeddings.sum(dim=1) / mask.sum(dim=1)[..., None] return sentence_embeddings embeddings = mean_pooling(outputs[0], inputs['attention_mask']) ```

Systran/faster-whisper-medium

Systran

ctranslate2

automatic-speech-recognition

--- language: - en - zh - de - es - ru - ko - fr - ja - pt - tr - pl - ca - nl - ar - sv - it - id - hi - fi - vi - he - uk - el - ms - cs - ro - da - hu - ta - 'no' - th - ur - hr - bg - lt - la - mi - ml - cy - sk - te - fa - lv - bn - sr - az - sl - kn - et - mk - br - eu - is - hy - ne - mn - bs - kk - sq - sw - gl - mr - pa - si - km - sn - yo - so - af - oc - ka - be - tg - sd - gu - am - yi - lo - uz - fo - ht - ps - tk - nn - mt - sa - lb - my - bo - tl - mg - as - tt - haw - ln - ha - ba - jw - su tags: - audio - automatic-speech-recognition license: mit library_name: ctranslate2 --- # Whisper medium model for CTranslate2 This repository contains the conversion of [openai/whisper-medium](https://huggingface.co/openai/whisper-medium) to the [CTranslate2](https://github.com/OpenNMT/CTranslate2) model format. This model can be used in CTranslate2 or projects based on CTranslate2 such as [faster-whisper](https://github.com/systran/faster-whisper). ## Example ```python from faster_whisper import WhisperModel model = WhisperModel("medium") segments, info = model.transcribe("audio.mp3") for segment in segments: print("[%.2fs -> %.2fs] %s" % (segment.start, segment.end, segment.text)) ``` ## Conversion details The original model was converted with the following command: ``` ct2-transformers-converter --model openai/whisper-medium --output_dir faster-whisper-medium \ --copy_files tokenizer.json --quantization float16 ``` Note that the model weights are saved in FP16. This type can be changed when the model is loaded using the [`compute_type` option in CTranslate2](https://opennmt.net/CTranslate2/quantization.html). ## More information **For more information about the original model, see its [model card](https://huggingface.co/openai/whisper-medium).**

timm/resnet18.a1_in1k

timm

timm

image-classification

--- tags: - image-classification - timm license: apache-2.0 library_name: timm --- # Model card for resnet18.a1_in1k A ResNet-B image classification model. This model features: * ReLU activations * single layer 7x7 convolution with pooling * 1x1 convolution shortcut downsample Trained on ImageNet-1k in `timm` using recipe template described below. Recipe details: * ResNet Strikes Back `A1` recipe * LAMB optimizer with BCE loss * Cosine LR schedule with warmup ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 11.7 - GMACs: 1.8 - Activations (M): 2.5 - Image size: train = 224 x 224, test = 288 x 288 - **Papers:** - ResNet strikes back: An improved training procedure in timm: https://arxiv.org/abs/2110.00476 - Deep Residual Learning for Image Recognition: https://arxiv.org/abs/1512.03385 - **Original:** https://github.com/huggingface/pytorch-image-models ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('resnet18.a1_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Feature Map Extraction ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'resnet18.a1_in1k', pretrained=True, features_only=True, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 for o in output: # print shape of each feature map in output # e.g.: # torch.Size([1, 64, 112, 112]) # torch.Size([1, 64, 56, 56]) # torch.Size([1, 128, 28, 28]) # torch.Size([1, 256, 14, 14]) # torch.Size([1, 512, 7, 7]) print(o.shape) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'resnet18.a1_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled, a (1, 512, 7, 7) shaped tensor output = model.forward_head(output, pre_logits=True) # output is a (1, num_features) shaped tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). |model |img_size|top1 |top5 |param_count|gmacs|macts|img/sec| |------------------------------------------|--------|-----|-----|-----------|-----|-----|-------| |[seresnextaa101d_32x8d.sw_in12k_ft_in1k_288](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k_288)|320 |86.72|98.17|93.6 |35.2 |69.7 |451 | |[seresnextaa101d_32x8d.sw_in12k_ft_in1k_288](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k_288)|288 |86.51|98.08|93.6 |28.5 |56.4 |560 | |[seresnextaa101d_32x8d.sw_in12k_ft_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k)|288 |86.49|98.03|93.6 |28.5 |56.4 |557 | |[seresnextaa101d_32x8d.sw_in12k_ft_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k)|224 |85.96|97.82|93.6 |17.2 |34.2 |923 | |[resnext101_32x32d.fb_wsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x32d.fb_wsl_ig1b_ft_in1k)|224 |85.11|97.44|468.5 |87.3 |91.1 |254 | |[resnetrs420.tf_in1k](https://huggingface.co/timm/resnetrs420.tf_in1k)|416 |85.0 |97.12|191.9 |108.4|213.8|134 | |[ecaresnet269d.ra2_in1k](https://huggingface.co/timm/ecaresnet269d.ra2_in1k)|352 |84.96|97.22|102.1 |50.2 |101.2|291 | |[ecaresnet269d.ra2_in1k](https://huggingface.co/timm/ecaresnet269d.ra2_in1k)|320 |84.73|97.18|102.1 |41.5 |83.7 |353 | |[resnetrs350.tf_in1k](https://huggingface.co/timm/resnetrs350.tf_in1k)|384 |84.71|96.99|164.0 |77.6 |154.7|183 | |[seresnextaa101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.ah_in1k)|288 |84.57|97.08|93.6 |28.5 |56.4 |557 | |[resnetrs200.tf_in1k](https://huggingface.co/timm/resnetrs200.tf_in1k)|320 |84.45|97.08|93.2 |31.5 |67.8 |446 | |[resnetrs270.tf_in1k](https://huggingface.co/timm/resnetrs270.tf_in1k)|352 |84.43|96.97|129.9 |51.1 |105.5|280 | |[seresnext101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101d_32x8d.ah_in1k)|288 |84.36|96.92|93.6 |27.6 |53.0 |595 | |[seresnet152d.ra2_in1k](https://huggingface.co/timm/seresnet152d.ra2_in1k)|320 |84.35|97.04|66.8 |24.1 |47.7 |610 | |[resnetrs350.tf_in1k](https://huggingface.co/timm/resnetrs350.tf_in1k)|288 |84.3 |96.94|164.0 |43.7 |87.1 |333 | |[resnext101_32x8d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x8d.fb_swsl_ig1b_ft_in1k)|224 |84.28|97.17|88.8 |16.5 |31.2 |1100 | |[resnetrs420.tf_in1k](https://huggingface.co/timm/resnetrs420.tf_in1k)|320 |84.24|96.86|191.9 |64.2 |126.6|228 | |[seresnext101_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101_32x8d.ah_in1k)|288 |84.19|96.87|93.6 |27.2 |51.6 |613 | |[resnext101_32x16d.fb_wsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x16d.fb_wsl_ig1b_ft_in1k)|224 |84.18|97.19|194.0 |36.3 |51.2 |581 | |[resnetaa101d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa101d.sw_in12k_ft_in1k)|288 |84.11|97.11|44.6 |15.1 |29.0 |1144 | |[resnet200d.ra2_in1k](https://huggingface.co/timm/resnet200d.ra2_in1k)|320 |83.97|96.82|64.7 |31.2 |67.3 |518 | |[resnetrs200.tf_in1k](https://huggingface.co/timm/resnetrs200.tf_in1k)|256 |83.87|96.75|93.2 |20.2 |43.4 |692 | |[seresnextaa101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.ah_in1k)|224 |83.86|96.65|93.6 |17.2 |34.2 |923 | |[resnetrs152.tf_in1k](https://huggingface.co/timm/resnetrs152.tf_in1k)|320 |83.72|96.61|86.6 |24.3 |48.1 |617 | |[seresnet152d.ra2_in1k](https://huggingface.co/timm/seresnet152d.ra2_in1k)|256 |83.69|96.78|66.8 |15.4 |30.6 |943 | |[seresnext101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101d_32x8d.ah_in1k)|224 |83.68|96.61|93.6 |16.7 |32.0 |986 | |[resnet152d.ra2_in1k](https://huggingface.co/timm/resnet152d.ra2_in1k)|320 |83.67|96.74|60.2 |24.1 |47.7 |706 | |[resnetrs270.tf_in1k](https://huggingface.co/timm/resnetrs270.tf_in1k)|256 |83.59|96.61|129.9 |27.1 |55.8 |526 | |[seresnext101_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101_32x8d.ah_in1k)|224 |83.58|96.4 |93.6 |16.5 |31.2 |1013 | |[resnetaa101d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa101d.sw_in12k_ft_in1k)|224 |83.54|96.83|44.6 |9.1 |17.6 |1864 | |[resnet152.a1h_in1k](https://huggingface.co/timm/resnet152.a1h_in1k)|288 |83.46|96.54|60.2 |19.1 |37.3 |904 | |[resnext101_32x16d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x16d.fb_swsl_ig1b_ft_in1k)|224 |83.35|96.85|194.0 |36.3 |51.2 |582 | |[resnet200d.ra2_in1k](https://huggingface.co/timm/resnet200d.ra2_in1k)|256 |83.23|96.53|64.7 |20.0 |43.1 |809 | |[resnext101_32x4d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x4d.fb_swsl_ig1b_ft_in1k)|224 |83.22|96.75|44.2 |8.0 |21.2 |1814 | |[resnext101_64x4d.c1_in1k](https://huggingface.co/timm/resnext101_64x4d.c1_in1k)|288 |83.16|96.38|83.5 |25.7 |51.6 |590 | |[resnet152d.ra2_in1k](https://huggingface.co/timm/resnet152d.ra2_in1k)|256 |83.14|96.38|60.2 |15.4 |30.5 |1096 | |[resnet101d.ra2_in1k](https://huggingface.co/timm/resnet101d.ra2_in1k)|320 |83.02|96.45|44.6 |16.5 |34.8 |992 | |[ecaresnet101d.miil_in1k](https://huggingface.co/timm/ecaresnet101d.miil_in1k)|288 |82.98|96.54|44.6 |13.4 |28.2 |1077 | |[resnext101_64x4d.tv_in1k](https://huggingface.co/timm/resnext101_64x4d.tv_in1k)|224 |82.98|96.25|83.5 |15.5 |31.2 |989 | |[resnetrs152.tf_in1k](https://huggingface.co/timm/resnetrs152.tf_in1k)|256 |82.86|96.28|86.6 |15.6 |30.8 |951 | |[resnext101_32x8d.tv2_in1k](https://huggingface.co/timm/resnext101_32x8d.tv2_in1k)|224 |82.83|96.22|88.8 |16.5 |31.2 |1099 | |[resnet152.a1h_in1k](https://huggingface.co/timm/resnet152.a1h_in1k)|224 |82.8 |96.13|60.2 |11.6 |22.6 |1486 | |[resnet101.a1h_in1k](https://huggingface.co/timm/resnet101.a1h_in1k)|288 |82.8 |96.32|44.6 |13.0 |26.8 |1291 | |[resnet152.a1_in1k](https://huggingface.co/timm/resnet152.a1_in1k)|288 |82.74|95.71|60.2 |19.1 |37.3 |905 | |[resnext101_32x8d.fb_wsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x8d.fb_wsl_ig1b_ft_in1k)|224 |82.69|96.63|88.8 |16.5 |31.2 |1100 | |[resnet152.a2_in1k](https://huggingface.co/timm/resnet152.a2_in1k)|288 |82.62|95.75|60.2 |19.1 |37.3 |904 | |[resnetaa50d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa50d.sw_in12k_ft_in1k)|288 |82.61|96.49|25.6 |8.9 |20.6 |1729 | |[resnet61q.ra2_in1k](https://huggingface.co/timm/resnet61q.ra2_in1k)|288 |82.53|96.13|36.8 |9.9 |21.5 |1773 | |[wide_resnet101_2.tv2_in1k](https://huggingface.co/timm/wide_resnet101_2.tv2_in1k)|224 |82.5 |96.02|126.9 |22.8 |21.2 |1078 | |[resnext101_64x4d.c1_in1k](https://huggingface.co/timm/resnext101_64x4d.c1_in1k)|224 |82.46|95.92|83.5 |15.5 |31.2 |987 | |[resnet51q.ra2_in1k](https://huggingface.co/timm/resnet51q.ra2_in1k)|288 |82.36|96.18|35.7 |8.1 |20.9 |1964 | |[ecaresnet50t.ra2_in1k](https://huggingface.co/timm/ecaresnet50t.ra2_in1k)|320 |82.35|96.14|25.6 |8.8 |24.1 |1386 | |[resnet101.a1_in1k](https://huggingface.co/timm/resnet101.a1_in1k)|288 |82.31|95.63|44.6 |13.0 |26.8 |1291 | |[resnetrs101.tf_in1k](https://huggingface.co/timm/resnetrs101.tf_in1k)|288 |82.29|96.01|63.6 |13.6 |28.5 |1078 | |[resnet152.tv2_in1k](https://huggingface.co/timm/resnet152.tv2_in1k)|224 |82.29|96.0 |60.2 |11.6 |22.6 |1484 | |[wide_resnet50_2.racm_in1k](https://huggingface.co/timm/wide_resnet50_2.racm_in1k)|288 |82.27|96.06|68.9 |18.9 |23.8 |1176 | |[resnet101d.ra2_in1k](https://huggingface.co/timm/resnet101d.ra2_in1k)|256 |82.26|96.07|44.6 |10.6 |22.2 |1542 | |[resnet101.a2_in1k](https://huggingface.co/timm/resnet101.a2_in1k)|288 |82.24|95.73|44.6 |13.0 |26.8 |1290 | |[seresnext50_32x4d.racm_in1k](https://huggingface.co/timm/seresnext50_32x4d.racm_in1k)|288 |82.2 |96.14|27.6 |7.0 |23.8 |1547 | |[ecaresnet101d.miil_in1k](https://huggingface.co/timm/ecaresnet101d.miil_in1k)|224 |82.18|96.05|44.6 |8.1 |17.1 |1771 | |[resnext50_32x4d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext50_32x4d.fb_swsl_ig1b_ft_in1k)|224 |82.17|96.22|25.0 |4.3 |14.4 |2943 | |[ecaresnet50t.a1_in1k](https://huggingface.co/timm/ecaresnet50t.a1_in1k)|288 |82.12|95.65|25.6 |7.1 |19.6 |1704 | |[resnext50_32x4d.a1h_in1k](https://huggingface.co/timm/resnext50_32x4d.a1h_in1k)|288 |82.03|95.94|25.0 |7.0 |23.8 |1745 | |[ecaresnet101d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet101d_pruned.miil_in1k)|288 |82.0 |96.15|24.9 |5.8 |12.7 |1787 | |[resnet61q.ra2_in1k](https://huggingface.co/timm/resnet61q.ra2_in1k)|256 |81.99|95.85|36.8 |7.8 |17.0 |2230 | |[resnext101_32x8d.tv2_in1k](https://huggingface.co/timm/resnext101_32x8d.tv2_in1k)|176 |81.98|95.72|88.8 |10.3 |19.4 |1768 | |[resnet152.a1_in1k](https://huggingface.co/timm/resnet152.a1_in1k)|224 |81.97|95.24|60.2 |11.6 |22.6 |1486 | |[resnet101.a1h_in1k](https://huggingface.co/timm/resnet101.a1h_in1k)|224 |81.93|95.75|44.6 |7.8 |16.2 |2122 | |[resnet101.tv2_in1k](https://huggingface.co/timm/resnet101.tv2_in1k)|224 |81.9 |95.77|44.6 |7.8 |16.2 |2118 | |[resnext101_32x16d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext101_32x16d.fb_ssl_yfcc100m_ft_in1k)|224 |81.84|96.1 |194.0 |36.3 |51.2 |583 | |[resnet51q.ra2_in1k](https://huggingface.co/timm/resnet51q.ra2_in1k)|256 |81.78|95.94|35.7 |6.4 |16.6 |2471 | |[resnet152.a2_in1k](https://huggingface.co/timm/resnet152.a2_in1k)|224 |81.77|95.22|60.2 |11.6 |22.6 |1485 | |[resnetaa50d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa50d.sw_in12k_ft_in1k)|224 |81.74|96.06|25.6 |5.4 |12.4 |2813 | |[ecaresnet50t.a2_in1k](https://huggingface.co/timm/ecaresnet50t.a2_in1k)|288 |81.65|95.54|25.6 |7.1 |19.6 |1703 | |[ecaresnet50d.miil_in1k](https://huggingface.co/timm/ecaresnet50d.miil_in1k)|288 |81.64|95.88|25.6 |7.2 |19.7 |1694 | |[resnext101_32x8d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext101_32x8d.fb_ssl_yfcc100m_ft_in1k)|224 |81.62|96.04|88.8 |16.5 |31.2 |1101 | |[wide_resnet50_2.tv2_in1k](https://huggingface.co/timm/wide_resnet50_2.tv2_in1k)|224 |81.61|95.76|68.9 |11.4 |14.4 |1930 | |[resnetaa50.a1h_in1k](https://huggingface.co/timm/resnetaa50.a1h_in1k)|288 |81.61|95.83|25.6 |8.5 |19.2 |1868 | |[resnet101.a1_in1k](https://huggingface.co/timm/resnet101.a1_in1k)|224 |81.5 |95.16|44.6 |7.8 |16.2 |2125 | |[resnext50_32x4d.a1_in1k](https://huggingface.co/timm/resnext50_32x4d.a1_in1k)|288 |81.48|95.16|25.0 |7.0 |23.8 |1745 | |[gcresnet50t.ra2_in1k](https://huggingface.co/timm/gcresnet50t.ra2_in1k)|288 |81.47|95.71|25.9 |6.9 |18.6 |2071 | |[wide_resnet50_2.racm_in1k](https://huggingface.co/timm/wide_resnet50_2.racm_in1k)|224 |81.45|95.53|68.9 |11.4 |14.4 |1929 | |[resnet50d.a1_in1k](https://huggingface.co/timm/resnet50d.a1_in1k)|288 |81.44|95.22|25.6 |7.2 |19.7 |1908 | |[ecaresnet50t.ra2_in1k](https://huggingface.co/timm/ecaresnet50t.ra2_in1k)|256 |81.44|95.67|25.6 |5.6 |15.4 |2168 | |[ecaresnetlight.miil_in1k](https://huggingface.co/timm/ecaresnetlight.miil_in1k)|288 |81.4 |95.82|30.2 |6.8 |13.9 |2132 | |[resnet50d.ra2_in1k](https://huggingface.co/timm/resnet50d.ra2_in1k)|288 |81.37|95.74|25.6 |7.2 |19.7 |1910 | |[resnet101.a2_in1k](https://huggingface.co/timm/resnet101.a2_in1k)|224 |81.32|95.19|44.6 |7.8 |16.2 |2125 | |[seresnet50.ra2_in1k](https://huggingface.co/timm/seresnet50.ra2_in1k)|288 |81.3 |95.65|28.1 |6.8 |18.4 |1803 | |[resnext50_32x4d.a2_in1k](https://huggingface.co/timm/resnext50_32x4d.a2_in1k)|288 |81.3 |95.11|25.0 |7.0 |23.8 |1746 | |[seresnext50_32x4d.racm_in1k](https://huggingface.co/timm/seresnext50_32x4d.racm_in1k)|224 |81.27|95.62|27.6 |4.3 |14.4 |2591 | |[ecaresnet50t.a1_in1k](https://huggingface.co/timm/ecaresnet50t.a1_in1k)|224 |81.26|95.16|25.6 |4.3 |11.8 |2823 | |[gcresnext50ts.ch_in1k](https://huggingface.co/timm/gcresnext50ts.ch_in1k)|288 |81.23|95.54|15.7 |4.8 |19.6 |2117 | |[senet154.gluon_in1k](https://huggingface.co/timm/senet154.gluon_in1k)|224 |81.23|95.35|115.1 |20.8 |38.7 |545 | |[resnet50.a1_in1k](https://huggingface.co/timm/resnet50.a1_in1k)|288 |81.22|95.11|25.6 |6.8 |18.4 |2089 | |[resnet50_gn.a1h_in1k](https://huggingface.co/timm/resnet50_gn.a1h_in1k)|288 |81.22|95.63|25.6 |6.8 |18.4 |676 | |[resnet50d.a2_in1k](https://huggingface.co/timm/resnet50d.a2_in1k)|288 |81.18|95.09|25.6 |7.2 |19.7 |1908 | |[resnet50.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnet50.fb_swsl_ig1b_ft_in1k)|224 |81.18|95.98|25.6 |4.1 |11.1 |3455 | |[resnext50_32x4d.tv2_in1k](https://huggingface.co/timm/resnext50_32x4d.tv2_in1k)|224 |81.17|95.34|25.0 |4.3 |14.4 |2933 | |[resnext50_32x4d.a1h_in1k](https://huggingface.co/timm/resnext50_32x4d.a1h_in1k)|224 |81.1 |95.33|25.0 |4.3 |14.4 |2934 | |[seresnet50.a2_in1k](https://huggingface.co/timm/seresnet50.a2_in1k)|288 |81.1 |95.23|28.1 |6.8 |18.4 |1801 | |[seresnet50.a1_in1k](https://huggingface.co/timm/seresnet50.a1_in1k)|288 |81.1 |95.12|28.1 |6.8 |18.4 |1799 | |[resnet152s.gluon_in1k](https://huggingface.co/timm/resnet152s.gluon_in1k)|224 |81.02|95.41|60.3 |12.9 |25.0 |1347 | |[resnet50.d_in1k](https://huggingface.co/timm/resnet50.d_in1k)|288 |80.97|95.44|25.6 |6.8 |18.4 |2085 | |[gcresnet50t.ra2_in1k](https://huggingface.co/timm/gcresnet50t.ra2_in1k)|256 |80.94|95.45|25.9 |5.4 |14.7 |2571 | |[resnext101_32x4d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext101_32x4d.fb_ssl_yfcc100m_ft_in1k)|224 |80.93|95.73|44.2 |8.0 |21.2 |1814 | |[resnet50.c1_in1k](https://huggingface.co/timm/resnet50.c1_in1k)|288 |80.91|95.55|25.6 |6.8 |18.4 |2084 | |[seresnext101_32x4d.gluon_in1k](https://huggingface.co/timm/seresnext101_32x4d.gluon_in1k)|224 |80.9 |95.31|49.0 |8.0 |21.3 |1585 | |[seresnext101_64x4d.gluon_in1k](https://huggingface.co/timm/seresnext101_64x4d.gluon_in1k)|224 |80.9 |95.3 |88.2 |15.5 |31.2 |918 | |[resnet50.c2_in1k](https://huggingface.co/timm/resnet50.c2_in1k)|288 |80.86|95.52|25.6 |6.8 |18.4 |2085 | |[resnet50.tv2_in1k](https://huggingface.co/timm/resnet50.tv2_in1k)|224 |80.85|95.43|25.6 |4.1 |11.1 |3450 | |[ecaresnet50t.a2_in1k](https://huggingface.co/timm/ecaresnet50t.a2_in1k)|224 |80.84|95.02|25.6 |4.3 |11.8 |2821 | |[ecaresnet101d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet101d_pruned.miil_in1k)|224 |80.79|95.62|24.9 |3.5 |7.7 |2961 | |[seresnet33ts.ra2_in1k](https://huggingface.co/timm/seresnet33ts.ra2_in1k)|288 |80.79|95.36|19.8 |6.0 |14.8 |2506 | |[ecaresnet50d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet50d_pruned.miil_in1k)|288 |80.79|95.58|19.9 |4.2 |10.6 |2349 | |[resnet50.a2_in1k](https://huggingface.co/timm/resnet50.a2_in1k)|288 |80.78|94.99|25.6 |6.8 |18.4 |2088 | |[resnet50.b1k_in1k](https://huggingface.co/timm/resnet50.b1k_in1k)|288 |80.71|95.43|25.6 |6.8 |18.4 |2087 | |[resnext50_32x4d.ra_in1k](https://huggingface.co/timm/resnext50_32x4d.ra_in1k)|288 |80.7 |95.39|25.0 |7.0 |23.8 |1749 | |[resnetrs101.tf_in1k](https://huggingface.co/timm/resnetrs101.tf_in1k)|192 |80.69|95.24|63.6 |6.0 |12.7 |2270 | |[resnet50d.a1_in1k](https://huggingface.co/timm/resnet50d.a1_in1k)|224 |80.68|94.71|25.6 |4.4 |11.9 |3162 | |[eca_resnet33ts.ra2_in1k](https://huggingface.co/timm/eca_resnet33ts.ra2_in1k)|288 |80.68|95.36|19.7 |6.0 |14.8 |2637 | |[resnet50.a1h_in1k](https://huggingface.co/timm/resnet50.a1h_in1k)|224 |80.67|95.3 |25.6 |4.1 |11.1 |3452 | |[resnext50d_32x4d.bt_in1k](https://huggingface.co/timm/resnext50d_32x4d.bt_in1k)|288 |80.67|95.42|25.0 |7.4 |25.1 |1626 | |[resnetaa50.a1h_in1k](https://huggingface.co/timm/resnetaa50.a1h_in1k)|224 |80.63|95.21|25.6 |5.2 |11.6 |3034 | |[ecaresnet50d.miil_in1k](https://huggingface.co/timm/ecaresnet50d.miil_in1k)|224 |80.61|95.32|25.6 |4.4 |11.9 |2813 | |[resnext101_64x4d.gluon_in1k](https://huggingface.co/timm/resnext101_64x4d.gluon_in1k)|224 |80.61|94.99|83.5 |15.5 |31.2 |989 | |[gcresnet33ts.ra2_in1k](https://huggingface.co/timm/gcresnet33ts.ra2_in1k)|288 |80.6 |95.31|19.9 |6.0 |14.8 |2578 | |[gcresnext50ts.ch_in1k](https://huggingface.co/timm/gcresnext50ts.ch_in1k)|256 |80.57|95.17|15.7 |3.8 |15.5 |2710 | |[resnet152.a3_in1k](https://huggingface.co/timm/resnet152.a3_in1k)|224 |80.56|95.0 |60.2 |11.6 |22.6 |1483 | |[resnet50d.ra2_in1k](https://huggingface.co/timm/resnet50d.ra2_in1k)|224 |80.53|95.16|25.6 |4.4 |11.9 |3164 | |[resnext50_32x4d.a1_in1k](https://huggingface.co/timm/resnext50_32x4d.a1_in1k)|224 |80.53|94.46|25.0 |4.3 |14.4 |2930 | |[wide_resnet101_2.tv2_in1k](https://huggingface.co/timm/wide_resnet101_2.tv2_in1k)|176 |80.48|94.98|126.9 |14.3 |13.2 |1719 | |[resnet152d.gluon_in1k](https://huggingface.co/timm/resnet152d.gluon_in1k)|224 |80.47|95.2 |60.2 |11.8 |23.4 |1428 | |[resnet50.b2k_in1k](https://huggingface.co/timm/resnet50.b2k_in1k)|288 |80.45|95.32|25.6 |6.8 |18.4 |2086 | |[ecaresnetlight.miil_in1k](https://huggingface.co/timm/ecaresnetlight.miil_in1k)|224 |80.45|95.24|30.2 |4.1 |8.4 |3530 | |[resnext50_32x4d.a2_in1k](https://huggingface.co/timm/resnext50_32x4d.a2_in1k)|224 |80.45|94.63|25.0 |4.3 |14.4 |2936 | |[wide_resnet50_2.tv2_in1k](https://huggingface.co/timm/wide_resnet50_2.tv2_in1k)|176 |80.43|95.09|68.9 |7.3 |9.0 |3015 | |[resnet101d.gluon_in1k](https://huggingface.co/timm/resnet101d.gluon_in1k)|224 |80.42|95.01|44.6 |8.1 |17.0 |2007 | |[resnet50.a1_in1k](https://huggingface.co/timm/resnet50.a1_in1k)|224 |80.38|94.6 |25.6 |4.1 |11.1 |3461 | |[seresnet33ts.ra2_in1k](https://huggingface.co/timm/seresnet33ts.ra2_in1k)|256 |80.36|95.1 |19.8 |4.8 |11.7 |3267 | |[resnext101_32x4d.gluon_in1k](https://huggingface.co/timm/resnext101_32x4d.gluon_in1k)|224 |80.34|94.93|44.2 |8.0 |21.2 |1814 | |[resnext50_32x4d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext50_32x4d.fb_ssl_yfcc100m_ft_in1k)|224 |80.32|95.4 |25.0 |4.3 |14.4 |2941 | |[resnet101s.gluon_in1k](https://huggingface.co/timm/resnet101s.gluon_in1k)|224 |80.28|95.16|44.7 |9.2 |18.6 |1851 | |[seresnet50.ra2_in1k](https://huggingface.co/timm/seresnet50.ra2_in1k)|224 |80.26|95.08|28.1 |4.1 |11.1 |2972 | |[resnetblur50.bt_in1k](https://huggingface.co/timm/resnetblur50.bt_in1k)|288 |80.24|95.24|25.6 |8.5 |19.9 |1523 | |[resnet50d.a2_in1k](https://huggingface.co/timm/resnet50d.a2_in1k)|224 |80.22|94.63|25.6 |4.4 |11.9 |3162 | |[resnet152.tv2_in1k](https://huggingface.co/timm/resnet152.tv2_in1k)|176 |80.2 |94.64|60.2 |7.2 |14.0 |2346 | |[seresnet50.a2_in1k](https://huggingface.co/timm/seresnet50.a2_in1k)|224 |80.08|94.74|28.1 |4.1 |11.1 |2969 | |[eca_resnet33ts.ra2_in1k](https://huggingface.co/timm/eca_resnet33ts.ra2_in1k)|256 |80.08|94.97|19.7 |4.8 |11.7 |3284 | |[gcresnet33ts.ra2_in1k](https://huggingface.co/timm/gcresnet33ts.ra2_in1k)|256 |80.06|94.99|19.9 |4.8 |11.7 |3216 | |[resnet50_gn.a1h_in1k](https://huggingface.co/timm/resnet50_gn.a1h_in1k)|224 |80.06|94.95|25.6 |4.1 |11.1 |1109 | |[seresnet50.a1_in1k](https://huggingface.co/timm/seresnet50.a1_in1k)|224 |80.02|94.71|28.1 |4.1 |11.1 |2962 | |[resnet50.ram_in1k](https://huggingface.co/timm/resnet50.ram_in1k)|288 |79.97|95.05|25.6 |6.8 |18.4 |2086 | |[resnet152c.gluon_in1k](https://huggingface.co/timm/resnet152c.gluon_in1k)|224 |79.92|94.84|60.2 |11.8 |23.4 |1455 | |[seresnext50_32x4d.gluon_in1k](https://huggingface.co/timm/seresnext50_32x4d.gluon_in1k)|224 |79.91|94.82|27.6 |4.3 |14.4 |2591 | |[resnet50.d_in1k](https://huggingface.co/timm/resnet50.d_in1k)|224 |79.91|94.67|25.6 |4.1 |11.1 |3456 | |[resnet101.tv2_in1k](https://huggingface.co/timm/resnet101.tv2_in1k)|176 |79.9 |94.6 |44.6 |4.9 |10.1 |3341 | |[resnetrs50.tf_in1k](https://huggingface.co/timm/resnetrs50.tf_in1k)|224 |79.89|94.97|35.7 |4.5 |12.1 |2774 | |[resnet50.c2_in1k](https://huggingface.co/timm/resnet50.c2_in1k)|224 |79.88|94.87|25.6 |4.1 |11.1 |3455 | |[ecaresnet26t.ra2_in1k](https://huggingface.co/timm/ecaresnet26t.ra2_in1k)|320 |79.86|95.07|16.0 |5.2 |16.4 |2168 | |[resnet50.a2_in1k](https://huggingface.co/timm/resnet50.a2_in1k)|224 |79.85|94.56|25.6 |4.1 |11.1 |3460 | |[resnet50.ra_in1k](https://huggingface.co/timm/resnet50.ra_in1k)|288 |79.83|94.97|25.6 |6.8 |18.4 |2087 | |[resnet101.a3_in1k](https://huggingface.co/timm/resnet101.a3_in1k)|224 |79.82|94.62|44.6 |7.8 |16.2 |2114 | |[resnext50_32x4d.ra_in1k](https://huggingface.co/timm/resnext50_32x4d.ra_in1k)|224 |79.76|94.6 |25.0 |4.3 |14.4 |2943 | |[resnet50.c1_in1k](https://huggingface.co/timm/resnet50.c1_in1k)|224 |79.74|94.95|25.6 |4.1 |11.1 |3455 | |[ecaresnet50d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet50d_pruned.miil_in1k)|224 |79.74|94.87|19.9 |2.5 |6.4 |3929 | |[resnet33ts.ra2_in1k](https://huggingface.co/timm/resnet33ts.ra2_in1k)|288 |79.71|94.83|19.7 |6.0 |14.8 |2710 | |[resnet152.gluon_in1k](https://huggingface.co/timm/resnet152.gluon_in1k)|224 |79.68|94.74|60.2 |11.6 |22.6 |1486 | |[resnext50d_32x4d.bt_in1k](https://huggingface.co/timm/resnext50d_32x4d.bt_in1k)|224 |79.67|94.87|25.0 |4.5 |15.2 |2729 | |[resnet50.bt_in1k](https://huggingface.co/timm/resnet50.bt_in1k)|288 |79.63|94.91|25.6 |6.8 |18.4 |2086 | |[ecaresnet50t.a3_in1k](https://huggingface.co/timm/ecaresnet50t.a3_in1k)|224 |79.56|94.72|25.6 |4.3 |11.8 |2805 | |[resnet101c.gluon_in1k](https://huggingface.co/timm/resnet101c.gluon_in1k)|224 |79.53|94.58|44.6 |8.1 |17.0 |2062 | |[resnet50.b1k_in1k](https://huggingface.co/timm/resnet50.b1k_in1k)|224 |79.52|94.61|25.6 |4.1 |11.1 |3459 | |[resnet50.tv2_in1k](https://huggingface.co/timm/resnet50.tv2_in1k)|176 |79.42|94.64|25.6 |2.6 |6.9 |5397 | |[resnet32ts.ra2_in1k](https://huggingface.co/timm/resnet32ts.ra2_in1k)|288 |79.4 |94.66|18.0 |5.9 |14.6 |2752 | |[resnet50.b2k_in1k](https://huggingface.co/timm/resnet50.b2k_in1k)|224 |79.38|94.57|25.6 |4.1 |11.1 |3459 | |[resnext50_32x4d.tv2_in1k](https://huggingface.co/timm/resnext50_32x4d.tv2_in1k)|176 |79.37|94.3 |25.0 |2.7 |9.0 |4577 | |[resnext50_32x4d.gluon_in1k](https://huggingface.co/timm/resnext50_32x4d.gluon_in1k)|224 |79.36|94.43|25.0 |4.3 |14.4 |2942 | |[resnext101_32x8d.tv_in1k](https://huggingface.co/timm/resnext101_32x8d.tv_in1k)|224 |79.31|94.52|88.8 |16.5 |31.2 |1100 | |[resnet101.gluon_in1k](https://huggingface.co/timm/resnet101.gluon_in1k)|224 |79.31|94.53|44.6 |7.8 |16.2 |2125 | |[resnetblur50.bt_in1k](https://huggingface.co/timm/resnetblur50.bt_in1k)|224 |79.31|94.63|25.6 |5.2 |12.0 |2524 | |[resnet50.a1h_in1k](https://huggingface.co/timm/resnet50.a1h_in1k)|176 |79.27|94.49|25.6 |2.6 |6.9 |5404 | |[resnext50_32x4d.a3_in1k](https://huggingface.co/timm/resnext50_32x4d.a3_in1k)|224 |79.25|94.31|25.0 |4.3 |14.4 |2931 | |[resnet50.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnet50.fb_ssl_yfcc100m_ft_in1k)|224 |79.22|94.84|25.6 |4.1 |11.1 |3451 | |[resnet33ts.ra2_in1k](https://huggingface.co/timm/resnet33ts.ra2_in1k)|256 |79.21|94.56|19.7 |4.8 |11.7 |3392 | |[resnet50d.gluon_in1k](https://huggingface.co/timm/resnet50d.gluon_in1k)|224 |79.07|94.48|25.6 |4.4 |11.9 |3162 | |[resnet50.ram_in1k](https://huggingface.co/timm/resnet50.ram_in1k)|224 |79.03|94.38|25.6 |4.1 |11.1 |3453 | |[resnet50.am_in1k](https://huggingface.co/timm/resnet50.am_in1k)|224 |79.01|94.39|25.6 |4.1 |11.1 |3461 | |[resnet32ts.ra2_in1k](https://huggingface.co/timm/resnet32ts.ra2_in1k)|256 |79.01|94.37|18.0 |4.6 |11.6 |3440 | |[ecaresnet26t.ra2_in1k](https://huggingface.co/timm/ecaresnet26t.ra2_in1k)|256 |78.9 |94.54|16.0 |3.4 |10.5 |3421 | |[resnet152.a3_in1k](https://huggingface.co/timm/resnet152.a3_in1k)|160 |78.89|94.11|60.2 |5.9 |11.5 |2745 | |[wide_resnet101_2.tv_in1k](https://huggingface.co/timm/wide_resnet101_2.tv_in1k)|224 |78.84|94.28|126.9 |22.8 |21.2 |1079 | |[seresnext26d_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26d_32x4d.bt_in1k)|288 |78.83|94.24|16.8 |4.5 |16.8 |2251 | |[resnet50.ra_in1k](https://huggingface.co/timm/resnet50.ra_in1k)|224 |78.81|94.32|25.6 |4.1 |11.1 |3454 | |[seresnext26t_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26t_32x4d.bt_in1k)|288 |78.74|94.33|16.8 |4.5 |16.7 |2264 | |[resnet50s.gluon_in1k](https://huggingface.co/timm/resnet50s.gluon_in1k)|224 |78.72|94.23|25.7 |5.5 |13.5 |2796 | |[resnet50d.a3_in1k](https://huggingface.co/timm/resnet50d.a3_in1k)|224 |78.71|94.24|25.6 |4.4 |11.9 |3154 | |[wide_resnet50_2.tv_in1k](https://huggingface.co/timm/wide_resnet50_2.tv_in1k)|224 |78.47|94.09|68.9 |11.4 |14.4 |1934 | |[resnet50.bt_in1k](https://huggingface.co/timm/resnet50.bt_in1k)|224 |78.46|94.27|25.6 |4.1 |11.1 |3454 | |[resnet34d.ra2_in1k](https://huggingface.co/timm/resnet34d.ra2_in1k)|288 |78.43|94.35|21.8 |6.5 |7.5 |3291 | |[gcresnext26ts.ch_in1k](https://huggingface.co/timm/gcresnext26ts.ch_in1k)|288 |78.42|94.04|10.5 |3.1 |13.3 |3226 | |[resnet26t.ra2_in1k](https://huggingface.co/timm/resnet26t.ra2_in1k)|320 |78.33|94.13|16.0 |5.2 |16.4 |2391 | |[resnet152.tv_in1k](https://huggingface.co/timm/resnet152.tv_in1k)|224 |78.32|94.04|60.2 |11.6 |22.6 |1487 | |[seresnext26ts.ch_in1k](https://huggingface.co/timm/seresnext26ts.ch_in1k)|288 |78.28|94.1 |10.4 |3.1 |13.3 |3062 | |[bat_resnext26ts.ch_in1k](https://huggingface.co/timm/bat_resnext26ts.ch_in1k)|256 |78.25|94.1 |10.7 |2.5 |12.5 |3393 | |[resnet50.a3_in1k](https://huggingface.co/timm/resnet50.a3_in1k)|224 |78.06|93.78|25.6 |4.1 |11.1 |3450 | |[resnet50c.gluon_in1k](https://huggingface.co/timm/resnet50c.gluon_in1k)|224 |78.0 |93.99|25.6 |4.4 |11.9 |3286 | |[eca_resnext26ts.ch_in1k](https://huggingface.co/timm/eca_resnext26ts.ch_in1k)|288 |78.0 |93.91|10.3 |3.1 |13.3 |3297 | |[seresnext26t_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26t_32x4d.bt_in1k)|224 |77.98|93.75|16.8 |2.7 |10.1 |3841 | |[resnet34.a1_in1k](https://huggingface.co/timm/resnet34.a1_in1k)|288 |77.92|93.77|21.8 |6.1 |6.2 |3609 | |[resnet101.a3_in1k](https://huggingface.co/timm/resnet101.a3_in1k)|160 |77.88|93.71|44.6 |4.0 |8.3 |3926 | |[resnet26t.ra2_in1k](https://huggingface.co/timm/resnet26t.ra2_in1k)|256 |77.87|93.84|16.0 |3.4 |10.5 |3772 | |[seresnext26ts.ch_in1k](https://huggingface.co/timm/seresnext26ts.ch_in1k)|256 |77.86|93.79|10.4 |2.4 |10.5 |4263 | |[resnetrs50.tf_in1k](https://huggingface.co/timm/resnetrs50.tf_in1k)|160 |77.82|93.81|35.7 |2.3 |6.2 |5238 | |[gcresnext26ts.ch_in1k](https://huggingface.co/timm/gcresnext26ts.ch_in1k)|256 |77.81|93.82|10.5 |2.4 |10.5 |4183 | |[ecaresnet50t.a3_in1k](https://huggingface.co/timm/ecaresnet50t.a3_in1k)|160 |77.79|93.6 |25.6 |2.2 |6.0 |5329 | |[resnext50_32x4d.a3_in1k](https://huggingface.co/timm/resnext50_32x4d.a3_in1k)|160 |77.73|93.32|25.0 |2.2 |7.4 |5576 | |[resnext50_32x4d.tv_in1k](https://huggingface.co/timm/resnext50_32x4d.tv_in1k)|224 |77.61|93.7 |25.0 |4.3 |14.4 |2944 | |[seresnext26d_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26d_32x4d.bt_in1k)|224 |77.59|93.61|16.8 |2.7 |10.2 |3807 | |[resnet50.gluon_in1k](https://huggingface.co/timm/resnet50.gluon_in1k)|224 |77.58|93.72|25.6 |4.1 |11.1 |3455 | |[eca_resnext26ts.ch_in1k](https://huggingface.co/timm/eca_resnext26ts.ch_in1k)|256 |77.44|93.56|10.3 |2.4 |10.5 |4284 | |[resnet26d.bt_in1k](https://huggingface.co/timm/resnet26d.bt_in1k)|288 |77.41|93.63|16.0 |4.3 |13.5 |2907 | |[resnet101.tv_in1k](https://huggingface.co/timm/resnet101.tv_in1k)|224 |77.38|93.54|44.6 |7.8 |16.2 |2125 | |[resnet50d.a3_in1k](https://huggingface.co/timm/resnet50d.a3_in1k)|160 |77.22|93.27|25.6 |2.2 |6.1 |5982 | |[resnext26ts.ra2_in1k](https://huggingface.co/timm/resnext26ts.ra2_in1k)|288 |77.17|93.47|10.3 |3.1 |13.3 |3392 | |[resnet34.a2_in1k](https://huggingface.co/timm/resnet34.a2_in1k)|288 |77.15|93.27|21.8 |6.1 |6.2 |3615 | |[resnet34d.ra2_in1k](https://huggingface.co/timm/resnet34d.ra2_in1k)|224 |77.1 |93.37|21.8 |3.9 |4.5 |5436 | |[seresnet50.a3_in1k](https://huggingface.co/timm/seresnet50.a3_in1k)|224 |77.02|93.07|28.1 |4.1 |11.1 |2952 | |[resnext26ts.ra2_in1k](https://huggingface.co/timm/resnext26ts.ra2_in1k)|256 |76.78|93.13|10.3 |2.4 |10.5 |4410 | |[resnet26d.bt_in1k](https://huggingface.co/timm/resnet26d.bt_in1k)|224 |76.7 |93.17|16.0 |2.6 |8.2 |4859 | |[resnet34.bt_in1k](https://huggingface.co/timm/resnet34.bt_in1k)|288 |76.5 |93.35|21.8 |6.1 |6.2 |3617 | |[resnet34.a1_in1k](https://huggingface.co/timm/resnet34.a1_in1k)|224 |76.42|92.87|21.8 |3.7 |3.7 |5984 | |[resnet26.bt_in1k](https://huggingface.co/timm/resnet26.bt_in1k)|288 |76.35|93.18|16.0 |3.9 |12.2 |3331 | |[resnet50.tv_in1k](https://huggingface.co/timm/resnet50.tv_in1k)|224 |76.13|92.86|25.6 |4.1 |11.1 |3457 | |[resnet50.a3_in1k](https://huggingface.co/timm/resnet50.a3_in1k)|160 |75.96|92.5 |25.6 |2.1 |5.7 |6490 | |[resnet34.a2_in1k](https://huggingface.co/timm/resnet34.a2_in1k)|224 |75.52|92.44|21.8 |3.7 |3.7 |5991 | |[resnet26.bt_in1k](https://huggingface.co/timm/resnet26.bt_in1k)|224 |75.3 |92.58|16.0 |2.4 |7.4 |5583 | |[resnet34.bt_in1k](https://huggingface.co/timm/resnet34.bt_in1k)|224 |75.16|92.18|21.8 |3.7 |3.7 |5994 | |[seresnet50.a3_in1k](https://huggingface.co/timm/seresnet50.a3_in1k)|160 |75.1 |92.08|28.1 |2.1 |5.7 |5513 | |[resnet34.gluon_in1k](https://huggingface.co/timm/resnet34.gluon_in1k)|224 |74.57|91.98|21.8 |3.7 |3.7 |5984 | |[resnet18d.ra2_in1k](https://huggingface.co/timm/resnet18d.ra2_in1k)|288 |73.81|91.83|11.7 |3.4 |5.4 |5196 | |[resnet34.tv_in1k](https://huggingface.co/timm/resnet34.tv_in1k)|224 |73.32|91.42|21.8 |3.7 |3.7 |5979 | |[resnet18.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnet18.fb_swsl_ig1b_ft_in1k)|224 |73.28|91.73|11.7 |1.8 |2.5 |10213 | |[resnet18.a1_in1k](https://huggingface.co/timm/resnet18.a1_in1k)|288 |73.16|91.03|11.7 |3.0 |4.1 |6050 | |[resnet34.a3_in1k](https://huggingface.co/timm/resnet34.a3_in1k)|224 |72.98|91.11|21.8 |3.7 |3.7 |5967 | |[resnet18.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnet18.fb_ssl_yfcc100m_ft_in1k)|224 |72.6 |91.42|11.7 |1.8 |2.5 |10213 | |[resnet18.a2_in1k](https://huggingface.co/timm/resnet18.a2_in1k)|288 |72.37|90.59|11.7 |3.0 |4.1 |6051 | |[resnet14t.c3_in1k](https://huggingface.co/timm/resnet14t.c3_in1k)|224 |72.26|90.31|10.1 |1.7 |5.8 |7026 | |[resnet18d.ra2_in1k](https://huggingface.co/timm/resnet18d.ra2_in1k)|224 |72.26|90.68|11.7 |2.1 |3.3 |8707 | |[resnet18.a1_in1k](https://huggingface.co/timm/resnet18.a1_in1k)|224 |71.49|90.07|11.7 |1.8 |2.5 |10187 | |[resnet14t.c3_in1k](https://huggingface.co/timm/resnet14t.c3_in1k)|176 |71.31|89.69|10.1 |1.1 |3.6 |10970 | |[resnet18.gluon_in1k](https://huggingface.co/timm/resnet18.gluon_in1k)|224 |70.84|89.76|11.7 |1.8 |2.5 |10210 | |[resnet18.a2_in1k](https://huggingface.co/timm/resnet18.a2_in1k)|224 |70.64|89.47|11.7 |1.8 |2.5 |10194 | |[resnet34.a3_in1k](https://huggingface.co/timm/resnet34.a3_in1k)|160 |70.56|89.52|21.8 |1.9 |1.9 |10737 | |[resnet18.tv_in1k](https://huggingface.co/timm/resnet18.tv_in1k)|224 |69.76|89.07|11.7 |1.8 |2.5 |10205 | |[resnet10t.c3_in1k](https://huggingface.co/timm/resnet10t.c3_in1k)|224 |68.34|88.03|5.4 |1.1 |2.4 |13079 | |[resnet18.a3_in1k](https://huggingface.co/timm/resnet18.a3_in1k)|224 |68.25|88.17|11.7 |1.8 |2.5 |10167 | |[resnet10t.c3_in1k](https://huggingface.co/timm/resnet10t.c3_in1k)|176 |66.71|86.96|5.4 |0.7 |1.5 |20327 | |[resnet18.a3_in1k](https://huggingface.co/timm/resnet18.a3_in1k)|160 |65.66|86.26|11.7 |0.9 |1.3 |18229 | ## Citation ```bibtex @inproceedings{wightman2021resnet, title={ResNet strikes back: An improved training procedure in timm}, author={Wightman, Ross and Touvron, Hugo and Jegou, Herve}, booktitle={NeurIPS 2021 Workshop on ImageNet: Past, Present, and Future} } ``` ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ``` ```bibtex @article{He2015, author = {Kaiming He and Xiangyu Zhang and Shaoqing Ren and Jian Sun}, title = {Deep Residual Learning for Image Recognition}, journal = {arXiv preprint arXiv:1512.03385}, year = {2015} } ```

llava-hf/llava-v1.6-mistral-7b-hf

llava-hf

transformers

image-text-to-text

--- license: apache-2.0 tags: - vision - image-text-to-text language: - en pipeline_tag: image-text-to-text --- # LLaVa-Next, leveraging [mistralai/Mistral-7B-Instruct-v0.2](https://huggingface.co/mistralai/Mistral-7B-Instruct-v0.2) as LLM The LLaVA-NeXT model was proposed in [LLaVA-NeXT: Improved reasoning, OCR, and world knowledge](https://llava-vl.github.io/blog/2024-01-30-llava-next/) by Haotian Liu, Chunyuan Li, Yuheng Li, Bo Li, Yuanhan Zhang, Sheng Shen, Yong Jae Lee. LLaVa-NeXT (also called LLaVa-1.6) improves upon [LLaVa-1.5](https://huggingface.co/transformers/main/model_doc/llava.html) by increasing the input image resolution and training on an improved visual instruction tuning dataset to improve OCR and common sense reasoning. Disclaimer: The team releasing LLaVa-NeXT did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description LLaVa combines a pre-trained large language model with a pre-trained vision encoder for multimodal chatbot use cases. LLaVA 1.6 improves on LLaVA 1.5 BY: - Using [Mistral-7B](https://mistral.ai/news/announcing-mistral-7b/) (for this checkpoint) and [Nous-Hermes-2-Yi-34B](https://huggingface.co/NousResearch/Nous-Hermes-2-Yi-34B) which has better commercial licenses, and bilingual support - More diverse and high quality data mixture - Dynamic high resolution  ## Intended uses & limitations You can use the raw model for tasks like image captioning, visual question answering, multimodal chatbot use cases. See the [model hub](https://huggingface.co/models?search=llava-hf) to look for other versions on a task that interests you. ### How to use Here's the prompt template for this model: ``` "[INST] <image>\nWhat is shown in this image? [/INST]" ``` You can load and use the model like following: ```python from transformers import LlavaNextProcessor, LlavaNextForConditionalGeneration import torch from PIL import Image import requests processor = LlavaNextProcessor.from_pretrained("llava-hf/llava-v1.6-mistral-7b-hf") model = LlavaNextForConditionalGeneration.from_pretrained("llava-hf/llava-v1.6-mistral-7b-hf", torch_dtype=torch.float16, low_cpu_mem_usage=True) model.to("cuda:0") # prepare image and text prompt, using the appropriate prompt template url = "https://github.com/haotian-liu/LLaVA/blob/1a91fc274d7c35a9b50b3cb29c4247ae5837ce39/images/llava_v1_5_radar.jpg?raw=true" image = Image.open(requests.get(url, stream=True).raw) # Define a chat histiry and use `apply_chat_template` to get correctly formatted prompt # Each value in "content" has to be a list of dicts with types ("text", "image") conversation = [ { "role": "user", "content": [ {"type": "text", "text": "What is shown in this image?"}, {"type": "image"}, ], }, ] prompt = processor.apply_chat_template(conversation, add_generation_prompt=True) inputs = processor(images=image, text=prompt, return_tensors="pt").to("cuda:0") # autoregressively complete prompt output = model.generate(**inputs, max_new_tokens=100) print(processor.decode(output[0], skip_special_tokens=True)) ``` ### Model optimization #### 4-bit quantization through `bitsandbytes` library First make sure to install `bitsandbytes`, `pip install bitsandbytes` and make sure to have access to a CUDA compatible GPU device. Simply change the snippet above with: ```diff model = LlavaNextForConditionalGeneration.from_pretrained( model_id, torch_dtype=torch.float16, low_cpu_mem_usage=True, + load_in_4bit=True ) ``` #### Use Flash-Attention 2 to further speed-up generation First make sure to install `flash-attn`. Refer to the [original repository of Flash Attention](https://github.com/Dao-AILab/flash-attention) regarding that package installation. Simply change the snippet above with: ```diff model = LlavaNextForConditionalGeneration.from_pretrained( model_id, torch_dtype=torch.float16, low_cpu_mem_usage=True, + use_flash_attention_2=True ).to(0) ``` ### BibTeX entry and citation info ```bibtex @misc{liu2023improved, title={Improved Baselines with Visual Instruction Tuning}, author={Haotian Liu and Chunyuan Li and Yuheng Li and Yong Jae Lee}, year={2023}, eprint={2310.03744}, archivePrefix={arXiv}, primaryClass={cs.CV} } ```

stabilityai/stable-diffusion-2-1

stabilityai

diffusers

text-to-image

--- license: openrail++ tags: - stable-diffusion - text-to-image pinned: true --- # Stable Diffusion v2-1 Model Card This model card focuses on the model associated with the Stable Diffusion v2-1 model, codebase available [here](https://github.com/Stability-AI/stablediffusion). This `stable-diffusion-2-1` model is fine-tuned from [stable-diffusion-2](https://huggingface.co/stabilityai/stable-diffusion-2) (`768-v-ema.ckpt`) with an additional 55k steps on the same dataset (with `punsafe=0.1`), and then fine-tuned for another 155k extra steps with `punsafe=0.98`. - Use it with the [`stablediffusion`](https://github.com/Stability-AI/stablediffusion) repository: download the `v2-1_768-ema-pruned.ckpt` [here](https://huggingface.co/stabilityai/stable-diffusion-2-1/blob/main/v2-1_768-ema-pruned.ckpt). - Use it with 🧨 [`diffusers`](#examples) ## Model Details - **Developed by:** Robin Rombach, Patrick Esser - **Model type:** Diffusion-based text-to-image generation model - **Language(s):** English - **License:** [CreativeML Open RAIL++-M License](https://huggingface.co/stabilityai/stable-diffusion-2/blob/main/LICENSE-MODEL) - **Model Description:** This is a model that can be used to generate and modify images based on text prompts. It is a [Latent Diffusion Model](https://arxiv.org/abs/2112.10752) that uses a fixed, pretrained text encoder ([OpenCLIP-ViT/H](https://github.com/mlfoundations/open_clip)). - **Resources for more information:** [GitHub Repository](https://github.com/Stability-AI/). - **Cite as:** @InProceedings{Rombach_2022_CVPR, author = {Rombach, Robin and Blattmann, Andreas and Lorenz, Dominik and Esser, Patrick and Ommer, Bj\"orn}, title = {High-Resolution Image Synthesis With Latent Diffusion Models}, booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition (CVPR)}, month = {June}, year = {2022}, pages = {10684-10695} } ## Examples Using the [🤗's Diffusers library](https://github.com/huggingface/diffusers) to run Stable Diffusion 2 in a simple and efficient manner. ```bash pip install diffusers transformers accelerate scipy safetensors ``` Running the pipeline (if you don't swap the scheduler it will run with the default DDIM, in this example we are swapping it to DPMSolverMultistepScheduler): ```python import torch from diffusers import StableDiffusionPipeline, DPMSolverMultistepScheduler model_id = "stabilityai/stable-diffusion-2-1" # Use the DPMSolverMultistepScheduler (DPM-Solver++) scheduler here instead pipe = StableDiffusionPipeline.from_pretrained(model_id, torch_dtype=torch.float16) pipe.scheduler = DPMSolverMultistepScheduler.from_config(pipe.scheduler.config) pipe = pipe.to("cuda") prompt = "a photo of an astronaut riding a horse on mars" image = pipe(prompt).images[0] image.save("astronaut_rides_horse.png") ``` **Notes**: - Despite not being a dependency, we highly recommend you to install [xformers](https://github.com/facebookresearch/xformers) for memory efficient attention (better performance) - If you have low GPU RAM available, make sure to add a `pipe.enable_attention_slicing()` after sending it to `cuda` for less VRAM usage (to the cost of speed) # Uses ## Direct Use The model is intended for research purposes only. Possible research areas and tasks include - Safe deployment of models which have the potential to generate harmful content. - Probing and understanding the limitations and biases of generative models. - Generation of artworks and use in design and other artistic processes. - Applications in educational or creative tools. - Research on generative models. Excluded uses are described below. ### Misuse, Malicious Use, and Out-of-Scope Use _Note: This section is originally taken from the [DALLE-MINI model card](https://huggingface.co/dalle-mini/dalle-mini), was used for Stable Diffusion v1, but applies in the same way to Stable Diffusion v2_. The model should not be used to intentionally create or disseminate images that create hostile or alienating environments for people. This includes generating images that people would foreseeably find disturbing, distressing, or offensive; or content that propagates historical or current stereotypes. #### Out-of-Scope Use The model was not trained to be factual or true representations of people or events, and therefore using the model to generate such content is out-of-scope for the abilities of this model. #### Misuse and Malicious Use Using the model to generate content that is cruel to individuals is a misuse of this model. This includes, but is not limited to: - Generating demeaning, dehumanizing, or otherwise harmful representations of people or their environments, cultures, religions, etc. - Intentionally promoting or propagating discriminatory content or harmful stereotypes. - Impersonating individuals without their consent. - Sexual content without consent of the people who might see it. - Mis- and disinformation - Representations of egregious violence and gore - Sharing of copyrighted or licensed material in violation of its terms of use. - Sharing content that is an alteration of copyrighted or licensed material in violation of its terms of use. ## Limitations and Bias ### Limitations - The model does not achieve perfect photorealism - The model cannot render legible text - The model does not perform well on more difficult tasks which involve compositionality, such as rendering an image corresponding to “A red cube on top of a blue sphere” - Faces and people in general may not be generated properly. - The model was trained mainly with English captions and will not work as well in other languages. - The autoencoding part of the model is lossy - The model was trained on a subset of the large-scale dataset [LAION-5B](https://laion.ai/blog/laion-5b/), which contains adult, violent and sexual content. To partially mitigate this, we have filtered the dataset using LAION's NFSW detector (see Training section). ### Bias While the capabilities of image generation models are impressive, they can also reinforce or exacerbate social biases. Stable Diffusion was primarily trained on subsets of [LAION-2B(en)](https://laion.ai/blog/laion-5b/), which consists of images that are limited to English descriptions. Texts and images from communities and cultures that use other languages are likely to be insufficiently accounted for. This affects the overall output of the model, as white and western cultures are often set as the default. Further, the ability of the model to generate content with non-English prompts is significantly worse than with English-language prompts. Stable Diffusion v2 mirrors and exacerbates biases to such a degree that viewer discretion must be advised irrespective of the input or its intent. ## Training **Training Data** The model developers used the following dataset for training the model: - LAION-5B and subsets (details below). The training data is further filtered using LAION's NSFW detector, with a "p_unsafe" score of 0.1 (conservative). For more details, please refer to LAION-5B's [NeurIPS 2022](https://openreview.net/forum?id=M3Y74vmsMcY) paper and reviewer discussions on the topic. **Training Procedure** Stable Diffusion v2 is a latent diffusion model which combines an autoencoder with a diffusion model that is trained in the latent space of the autoencoder. During training, - Images are encoded through an encoder, which turns images into latent representations. The autoencoder uses a relative downsampling factor of 8 and maps images of shape H x W x 3 to latents of shape H/f x W/f x 4 - Text prompts are encoded through the OpenCLIP-ViT/H text-encoder. - The output of the text encoder is fed into the UNet backbone of the latent diffusion model via cross-attention. - The loss is a reconstruction objective between the noise that was added to the latent and the prediction made by the UNet. We also use the so-called _v-objective_, see https://arxiv.org/abs/2202.00512. We currently provide the following checkpoints: - `512-base-ema.ckpt`: 550k steps at resolution `256x256` on a subset of [LAION-5B](https://laion.ai/blog/laion-5b/) filtered for explicit pornographic material, using the [LAION-NSFW classifier](https://github.com/LAION-AI/CLIP-based-NSFW-Detector) with `punsafe=0.1` and an [aesthetic score](https://github.com/christophschuhmann/improved-aesthetic-predictor) >= `4.5`. 850k steps at resolution `512x512` on the same dataset with resolution `>= 512x512`. - `768-v-ema.ckpt`: Resumed from `512-base-ema.ckpt` and trained for 150k steps using a [v-objective](https://arxiv.org/abs/2202.00512) on the same dataset. Resumed for another 140k steps on a `768x768` subset of our dataset. - `512-depth-ema.ckpt`: Resumed from `512-base-ema.ckpt` and finetuned for 200k steps. Added an extra input channel to process the (relative) depth prediction produced by [MiDaS](https://github.com/isl-org/MiDaS) (`dpt_hybrid`) which is used as an additional conditioning. The additional input channels of the U-Net which process this extra information were zero-initialized. - `512-inpainting-ema.ckpt`: Resumed from `512-base-ema.ckpt` and trained for another 200k steps. Follows the mask-generation strategy presented in [LAMA](https://github.com/saic-mdal/lama) which, in combination with the latent VAE representations of the masked image, are used as an additional conditioning. The additional input channels of the U-Net which process this extra information were zero-initialized. The same strategy was used to train the [1.5-inpainting checkpoint](https://huggingface.co/runwayml/stable-diffusion-inpainting). - `x4-upscaling-ema.ckpt`: Trained for 1.25M steps on a 10M subset of LAION containing images `>2048x2048`. The model was trained on crops of size `512x512` and is a text-guided [latent upscaling diffusion model](https://arxiv.org/abs/2112.10752). In addition to the textual input, it receives a `noise_level` as an input parameter, which can be used to add noise to the low-resolution input according to a [predefined diffusion schedule](configs/stable-diffusion/x4-upscaling.yaml). - **Hardware:** 32 x 8 x A100 GPUs - **Optimizer:** AdamW - **Gradient Accumulations**: 1 - **Batch:** 32 x 8 x 2 x 4 = 2048 - **Learning rate:** warmup to 0.0001 for 10,000 steps and then kept constant ## Evaluation Results Evaluations with different classifier-free guidance scales (1.5, 2.0, 3.0, 4.0, 5.0, 6.0, 7.0, 8.0) and 50 steps DDIM sampling steps show the relative improvements of the checkpoints:  Evaluated using 50 DDIM steps and 10000 random prompts from the COCO2017 validation set, evaluated at 512x512 resolution. Not optimized for FID scores. ## Environmental Impact **Stable Diffusion v1** **Estimated Emissions** Based on that information, we estimate the following CO2 emissions using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). The hardware, runtime, cloud provider, and compute region were utilized to estimate the carbon impact. - **Hardware Type:** A100 PCIe 40GB - **Hours used:** 200000 - **Cloud Provider:** AWS - **Compute Region:** US-east - **Carbon Emitted (Power consumption x Time x Carbon produced based on location of power grid):** 15000 kg CO2 eq. ## Citation @InProceedings{Rombach_2022_CVPR, author = {Rombach, Robin and Blattmann, Andreas and Lorenz, Dominik and Esser, Patrick and Ommer, Bj\"orn}, title = {High-Resolution Image Synthesis With Latent Diffusion Models}, booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition (CVPR)}, month = {June}, year = {2022}, pages = {10684-10695} } *This model card was written by: Robin Rombach, Patrick Esser and David Ha and is based on the [Stable Diffusion v1](https://github.com/CompVis/stable-diffusion/blob/main/Stable_Diffusion_v1_Model_Card.md) and [DALL-E Mini model card](https://huggingface.co/dalle-mini/dalle-mini).*

indobenchmark/indobert-base-p1

indobenchmark

transformers

feature-extraction

--- language: id tags: - indobert - indobenchmark - indonlu license: mit inference: false datasets: - Indo4B --- # IndoBERT Base Model (phase1 - uncased) [IndoBERT](https://arxiv.org/abs/2009.05387) is a state-of-the-art language model for Indonesian based on the BERT model. The pretrained model is trained using a masked language modeling (MLM) objective and next sentence prediction (NSP) objective. ## All Pre-trained Models | Model | #params | Arch. | Training data | |--------------------------------|--------------------------------|-------|-----------------------------------| | `indobenchmark/indobert-base-p1` | 124.5M | Base | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-base-p2` | 124.5M | Base | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-large-p1` | 335.2M | Large | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-large-p2` | 335.2M | Large | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-lite-base-p1` | 11.7M | Base | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-lite-base-p2` | 11.7M | Base | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-lite-large-p1` | 17.7M | Large | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-lite-large-p2` | 17.7M | Large | Indo4B (23.43 GB of text) | ## How to use ### Load model and tokenizer ```python from transformers import BertTokenizer, AutoModel tokenizer = BertTokenizer.from_pretrained("indobenchmark/indobert-base-p1") model = AutoModel.from_pretrained("indobenchmark/indobert-base-p1") ``` ### Extract contextual representation ```python x = torch.LongTensor(tokenizer.encode('aku adalah anak [MASK]')).view(1,-1) print(x, model(x)[0].sum()) ``` ## Authors <b>IndoBERT</b> was trained and evaluated by Bryan Wilie\*, Karissa Vincentio\*, Genta Indra Winata\*, Samuel Cahyawijaya\*, Xiaohong Li, Zhi Yuan Lim, Sidik Soleman, Rahmad Mahendra, Pascale Fung, Syafri Bahar, Ayu Purwarianti. ## Citation If you use our work, please cite: ```bibtex @inproceedings{wilie2020indonlu, title={IndoNLU: Benchmark and Resources for Evaluating Indonesian Natural Language Understanding}, author={Bryan Wilie and Karissa Vincentio and Genta Indra Winata and Samuel Cahyawijaya and X. Li and Zhi Yuan Lim and S. Soleman and R. Mahendra and Pascale Fung and Syafri Bahar and A. Purwarianti}, booktitle={Proceedings of the 1st Conference of the Asia-Pacific Chapter of the Association for Computational Linguistics and the 10th International Joint Conference on Natural Language Processing}, year={2020} } ```

blaze999/Medical-NER

blaze999

transformers

token-classification

--- license: mit base_model: microsoft/deberta-v3-base tags: - generated_from_trainer - medical model-index: - name: deberta-med-ner-2 results: [] widget: - text: 63 year old woman with history of CAD presented to ER example_title: Example-1 - text: 63 year old woman diagnosed with CAD example_title: Example-2 - text: >- A 48 year-old female presented with vaginal bleeding and abnormal Pap smears. Upon diagnosis of invasive non-keratinizing SCC of the cervix, she underwent a radical hysterectomy with salpingo-oophorectomy which demonstrated positive spread to the pelvic lymph nodes and the parametrium. Pathological examination revealed that the tumour also extensively involved the lower uterine segment. example_title: example 3 pipeline_tag: token-classification --- <!-- This model card has been generated automatically according to the information the Trainer had access to. You should probably proofread and complete it, then remove this comment. --> # deberta-med-ner-2 This model is a fine-tuned version of [DeBERTa](https://huggingface.co/microsoft/deberta-v3-base) on the PubMED Dataset. ## Model description Medical NER Model finetuned on BERT to recognize 41 Medical entities. ### Training hyperparameters The following hyperparameters were used during training: - learning_rate: 2e-05 - train_batch_size: 8 - eval_batch_size: 16 - seed: 42 - gradient_accumulation_steps: 2 - total_train_batch_size: 16 - optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 - lr_scheduler_type: cosine - lr_scheduler_warmup_ratio: 0.1 - num_epochs: 30 - mixed_precision_training: Native AMP ## Usage The easiest way is to load the inference api from huggingface and second method is through the pipeline object offered by transformers library. ```python # Use a pipeline as a high-level helper from transformers import pipeline pipe = pipeline("token-classification", model="Clinical-AI-Apollo/Medical-NER", aggregation_strategy='simple') result = pipe('45 year old woman diagnosed with CAD') # Load model directly from transformers import AutoTokenizer, AutoModelForTokenClassification tokenizer = AutoTokenizer.from_pretrained("Clinical-AI-Apollo/Medical-NER") model = AutoModelForTokenClassification.from_pretrained("Clinical-AI-Apollo/Medical-NER") ``` ### Author Author: [Saketh Mattupalli](https://huggingface.co/blaze999) ### Framework versions - Transformers 4.37.0 - Pytorch 2.1.2 - Datasets 2.1.0 - Tokenizers 0.15.1

trl-internal-testing/tiny-random-LlamaForCausalLM

trl-internal-testing

transformers

text-generation

--- library_name: transformers tags: [] --- # Model Card for Model ID <!-- Provide a quick summary of what the model is/does. --> ## Model Details ### Model Description <!-- Provide a longer summary of what this model is. --> This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated. - **Developed by:** [More Information Needed] - **Funded by [optional]:** [More Information Needed] - **Shared by [optional]:** [More Information Needed] - **Model type:** [More Information Needed] - **Language(s) (NLP):** [More Information Needed] - **License:** [More Information Needed] - **Finetuned from model [optional]:** [More Information Needed] ### Model Sources [optional] <!-- Provide the basic links for the model. --> - **Repository:** [More Information Needed] - **Paper [optional]:** [More Information Needed] - **Demo [optional]:** [More Information Needed] ## Uses <!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. --> ### Direct Use <!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. --> [More Information Needed] ### Downstream Use [optional] <!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app --> [More Information Needed] ### Out-of-Scope Use <!-- This section addresses misuse, malicious use, and uses that the model will not work well for. --> [More Information Needed] ## Bias, Risks, and Limitations <!-- This section is meant to convey both technical and sociotechnical limitations. --> [More Information Needed] ### Recommendations <!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. --> Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations. ## How to Get Started with the Model Use the code below to get started with the model. [More Information Needed] ## Training Details ### Training Data <!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. --> [More Information Needed] ### Training Procedure <!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. --> #### Preprocessing [optional] [More Information Needed] #### Training Hyperparameters - **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision --> #### Speeds, Sizes, Times [optional] <!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. --> [More Information Needed] ## Evaluation <!-- This section describes the evaluation protocols and provides the results. --> ### Testing Data, Factors & Metrics #### Testing Data <!-- This should link to a Dataset Card if possible. --> [More Information Needed] #### Factors <!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. --> [More Information Needed] #### Metrics <!-- These are the evaluation metrics being used, ideally with a description of why. --> [More Information Needed] ### Results [More Information Needed] #### Summary ## Model Examination [optional] <!-- Relevant interpretability work for the model goes here --> [More Information Needed] ## Environmental Impact <!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly --> Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). - **Hardware Type:** [More Information Needed] - **Hours used:** [More Information Needed] - **Cloud Provider:** [More Information Needed] - **Compute Region:** [More Information Needed] - **Carbon Emitted:** [More Information Needed] ## Technical Specifications [optional] ### Model Architecture and Objective [More Information Needed] ### Compute Infrastructure [More Information Needed] #### Hardware [More Information Needed] #### Software [More Information Needed] ## Citation [optional] <!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. --> **BibTeX:** [More Information Needed] **APA:** [More Information Needed] ## Glossary [optional] <!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. --> [More Information Needed] ## More Information [optional] [More Information Needed] ## Model Card Authors [optional] [More Information Needed] ## Model Card Contact [More Information Needed]

jonatasgrosman/wav2vec2-xls-r-1b-portuguese

jonatasgrosman

transformers

automatic-speech-recognition

--- language: - pt license: apache-2.0 tags: - automatic-speech-recognition - hf-asr-leaderboard - mozilla-foundation/common_voice_8_0 - pt - robust-speech-event datasets: - mozilla-foundation/common_voice_8_0 model-index: - name: XLS-R Wav2Vec2 Portuguese by Jonatas Grosman results: - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: Common Voice 8 type: mozilla-foundation/common_voice_8_0 args: pt metrics: - name: Test WER type: wer value: 8.7 - name: Test CER type: cer value: 2.55 - name: Test WER (+LM) type: wer value: 6.04 - name: Test CER (+LM) type: cer value: 1.98 - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: Robust Speech Event - Dev Data type: speech-recognition-community-v2/dev_data args: pt metrics: - name: Dev WER type: wer value: 24.23 - name: Dev CER type: cer value: 11.3 - name: Dev WER (+LM) type: wer value: 19.41 - name: Dev CER (+LM) type: cer value: 10.19 - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: Robust Speech Event - Test Data type: speech-recognition-community-v2/eval_data args: pt metrics: - name: Test WER type: wer value: 18.8 --- # Fine-tuned XLS-R 1B model for speech recognition in Portuguese Fine-tuned [facebook/wav2vec2-xls-r-1b](https://huggingface.co/facebook/wav2vec2-xls-r-1b) on Portuguese using the train and validation splits of [Common Voice 8.0](https://huggingface.co/datasets/mozilla-foundation/common_voice_8_0), [CORAA](https://github.com/nilc-nlp/CORAA), [Multilingual TEDx](http://www.openslr.org/100), and [Multilingual LibriSpeech](https://www.openslr.org/94/). When using this model, make sure that your speech input is sampled at 16kHz. This model has been fine-tuned by the [HuggingSound](https://github.com/jonatasgrosman/huggingsound) tool, and thanks to the GPU credits generously given by the [OVHcloud](https://www.ovhcloud.com/en/public-cloud/ai-training/) :) ## Usage Using the [HuggingSound](https://github.com/jonatasgrosman/huggingsound) library: ```python from huggingsound import SpeechRecognitionModel model = SpeechRecognitionModel("jonatasgrosman/wav2vec2-xls-r-1b-portuguese") audio_paths = ["/path/to/file.mp3", "/path/to/another_file.wav"] transcriptions = model.transcribe(audio_paths) ``` Writing your own inference script: ```python import torch import librosa from datasets import load_dataset from transformers import Wav2Vec2ForCTC, Wav2Vec2Processor LANG_ID = "pt" MODEL_ID = "jonatasgrosman/wav2vec2-xls-r-1b-portuguese" SAMPLES = 10 test_dataset = load_dataset("common_voice", LANG_ID, split=f"test[:{SAMPLES}]") processor = Wav2Vec2Processor.from_pretrained(MODEL_ID) model = Wav2Vec2ForCTC.from_pretrained(MODEL_ID) # Preprocessing the datasets. # We need to read the audio files as arrays def speech_file_to_array_fn(batch): speech_array, sampling_rate = librosa.load(batch["path"], sr=16_000) batch["speech"] = speech_array batch["sentence"] = batch["sentence"].upper() return batch test_dataset = test_dataset.map(speech_file_to_array_fn) inputs = processor(test_dataset["speech"], sampling_rate=16_000, return_tensors="pt", padding=True) with torch.no_grad(): logits = model(inputs.input_values, attention_mask=inputs.attention_mask).logits predicted_ids = torch.argmax(logits, dim=-1) predicted_sentences = processor.batch_decode(predicted_ids) ``` ## Evaluation Commands 1. To evaluate on `mozilla-foundation/common_voice_8_0` with split `test` ```bash python eval.py --model_id jonatasgrosman/wav2vec2-xls-r-1b-portuguese --dataset mozilla-foundation/common_voice_8_0 --config pt --split test ``` 2. To evaluate on `speech-recognition-community-v2/dev_data` ```bash python eval.py --model_id jonatasgrosman/wav2vec2-xls-r-1b-portuguese --dataset speech-recognition-community-v2/dev_data --config pt --split validation --chunk_length_s 5.0 --stride_length_s 1.0 ``` ## Citation If you want to cite this model you can use this: ```bibtex @misc{grosman2021xlsr-1b-portuguese, title={Fine-tuned {XLS-R} 1{B} model for speech recognition in {P}ortuguese}, author={Grosman, Jonatas}, howpublished={\url{https://huggingface.co/jonatasgrosman/wav2vec2-xls-r-1b-portuguese}}, year={2022} } ```

laion/CLIP-ViT-H-14-laion2B-s32B-b79K

laion

open_clip

zero-shot-image-classification

--- license: mit widget: - src: >- https://huggingface.co/datasets/mishig/sample_images/resolve/main/cat-dog-music.png candidate_labels: playing music, playing sports example_title: Cat & Dog library_name: open_clip pipeline_tag: zero-shot-image-classification --- # Model Card for CLIP ViT-H/14 - LAION-2B # Table of Contents 1. [Model Details](#model-details) 2. [Uses](#uses) 3. [Training Details](#training-details) 4. [Evaluation](#evaluation) 5. [Acknowledgements](#acknowledgements) 6. [Citation](#citation) 7. [How To Get Started With the Model](#how-to-get-started-with-the-model) # Model Details ## Model Description A CLIP ViT-H/14 model trained with the LAION-2B English subset of LAION-5B (https://laion.ai/blog/laion-5b/) using OpenCLIP (https://github.com/mlfoundations/open_clip). Model training done by Romain Beaumont on the [stability.ai](https://stability.ai/) cluster. # Uses As per the original [OpenAI CLIP model card](https://github.com/openai/CLIP/blob/d50d76daa670286dd6cacf3bcd80b5e4823fc8e1/model-card.md), this model is intended as a research output for research communities. We hope that this model will enable researchers to better understand and explore zero-shot, arbitrary image classification. We also hope it can be used for interdisciplinary studies of the potential impact of such model. The OpenAI CLIP paper includes a discussion of potential downstream impacts to provide an example for this sort of analysis. Additionally, the LAION-5B blog (https://laion.ai/blog/laion-5b/) and upcoming paper include additional discussion as it relates specifically to the training dataset. ## Direct Use Zero-shot image classification, image and text retrieval, among others. ## Downstream Use Image classification and other image task fine-tuning, linear probe image classification, image generation guiding and conditioning, among others. ## Out-of-Scope Use As per the OpenAI models, **Any** deployed use case of the model - whether commercial or not - is currently out of scope. Non-deployed use cases such as image search in a constrained environment, are also not recommended unless there is thorough in-domain testing of the model with a specific, fixed class taxonomy. This is because our safety assessment demonstrated a high need for task specific testing especially given the variability of CLIP’s performance with different class taxonomies. This makes untested and unconstrained deployment of the model in any use case currently potentially harmful. Certain use cases which would fall under the domain of surveillance and facial recognition are always out-of-scope regardless of performance of the model. This is because the use of artificial intelligence for tasks such as these can be premature currently given the lack of testing norms and checks to ensure its fair use. Since the model has not been purposefully trained in or evaluated on any languages other than English, its use should be limited to English language use cases. Further the above notice, the LAION-5B dataset used in training of these models has additional considerations, see below. # Training Details ## Training Data This model was trained with the 2 Billion sample English subset of LAION-5B (https://laion.ai/blog/laion-5b/). **IMPORTANT NOTE:** The motivation behind dataset creation is to democratize research and experimentation around large-scale multi-modal model training and handling of uncurated, large-scale datasets crawled from publically available internet. Our recommendation is therefore to use the dataset for research purposes. Be aware that this large-scale dataset is uncurated. Keep in mind that the uncurated nature of the dataset means that collected links may lead to strongly discomforting and disturbing content for a human viewer. Therefore, please use the demo links with caution and at your own risk. It is possible to extract a “safe” subset by filtering out samples based on the safety tags (using a customized trained NSFW classifier that we built). While this strongly reduces the chance for encountering potentially harmful content when viewing, we cannot entirely exclude the possibility for harmful content being still present in safe mode, so that the warning holds also there. We think that providing the dataset openly to broad research and other interested communities will allow for transparent investigation of benefits that come along with training large-scale models as well as pitfalls and dangers that may stay unreported or unnoticed when working with closed large datasets that remain restricted to a small community. Providing our dataset openly, we however do not recommend using it for creating ready-to-go industrial products, as the basic research about general properties and safety of such large-scale models, which we would like to encourage with this release, is still in progress. ## Training Procedure Please see [training notes](https://docs.google.com/document/d/1EFbMLRWSSV0LUf9Du1pWzWqgeiIRPwEWX2s1C6mAk5c) and [wandb logs](https://wandb.ai/rom1504/eval_openclip/reports/H-14--VmlldzoyNDAxODQ3). # Evaluation Evaluation done with code in the [LAION CLIP Benchmark suite](https://github.com/LAION-AI/CLIP_benchmark). ## Testing Data, Factors & Metrics ### Testing Data The testing is performed with VTAB+ (A combination of VTAB (https://arxiv.org/abs/1910.04867) w/ additional robustness datasets) for classification and COCO and Flickr for retrieval. **TODO** - more detail ## Results The model achieves a 78.0 zero-shot top-1 accuracy on ImageNet-1k. An initial round of benchmarks have been performed on a wider range of datasets, currently viewable at https://github.com/LAION-AI/CLIP_benchmark/blob/main/benchmark/results.ipynb **TODO** - create table for just this model's metrics. # Acknowledgements Acknowledging [stability.ai](https://stability.ai/) for the compute used to train this model. # Citation **BibTeX:** LAION-5B ```bibtex @inproceedings{schuhmann2022laionb, title={{LAION}-5B: An open large-scale dataset for training next generation image-text models}, author={Christoph Schuhmann and Romain Beaumont and Richard Vencu and Cade W Gordon and Ross Wightman and Mehdi Cherti and Theo Coombes and Aarush Katta and Clayton Mullis and Mitchell Wortsman and Patrick Schramowski and Srivatsa R Kundurthy and Katherine Crowson and Ludwig Schmidt and Robert Kaczmarczyk and Jenia Jitsev}, booktitle={Thirty-sixth Conference on Neural Information Processing Systems Datasets and Benchmarks Track}, year={2022}, url={https://openreview.net/forum?id=M3Y74vmsMcY} } ``` OpenAI CLIP paper ``` @inproceedings{Radford2021LearningTV, title={Learning Transferable Visual Models From Natural Language Supervision}, author={Alec Radford and Jong Wook Kim and Chris Hallacy and A. Ramesh and Gabriel Goh and Sandhini Agarwal and Girish Sastry and Amanda Askell and Pamela Mishkin and Jack Clark and Gretchen Krueger and Ilya Sutskever}, booktitle={ICML}, year={2021} } ``` OpenCLIP software ``` @software{ilharco_gabriel_2021_5143773, author = {Ilharco, Gabriel and Wortsman, Mitchell and Wightman, Ross and Gordon, Cade and Carlini, Nicholas and Taori, Rohan and Dave, Achal and Shankar, Vaishaal and Namkoong, Hongseok and Miller, John and Hajishirzi, Hannaneh and Farhadi, Ali and Schmidt, Ludwig}, title = {OpenCLIP}, month = jul, year = 2021, note = {If you use this software, please cite it as below.}, publisher = {Zenodo}, version = {0.1}, doi = {10.5281/zenodo.5143773}, url = {https://doi.org/10.5281/zenodo.5143773} } ``` # How to Get Started with the Model Use the code below to get started with the model. ** TODO ** - Hugging Face transformers, OpenCLIP, and timm getting started snippets

unslothai/1

unslothai

transformers

feature-extraction

--- library_name: transformers tags: [] ---

pyannote/voice-activity-detection

pyannote

pyannote-audio

automatic-speech-recognition

--- tags: - pyannote - pyannote-audio - pyannote-audio-pipeline - audio - voice - speech - speaker - voice-activity-detection - automatic-speech-recognition datasets: - ami - dihard - voxconverse license: mit extra_gated_prompt: "The collected information will help acquire a better knowledge of pyannote.audio userbase and help its maintainers apply for grants to improve it further. If you are an academic researcher, please cite the relevant papers in your own publications using the model. If you work for a company, please consider contributing back to pyannote.audio development (e.g. through unrestricted gifts). We also provide scientific consulting services around speaker diarization and machine listening." extra_gated_fields: Company/university: text Website: text I plan to use this model for (task, type of audio data, etc): text --- Using this open-source model in production? Consider switching to [pyannoteAI](https://www.pyannote.ai) for better and faster options. # 🎹 Voice activity detection Relies on pyannote.audio 2.1: see [installation instructions](https://github.com/pyannote/pyannote-audio#installation). ```python # 1. visit hf.co/pyannote/segmentation and accept user conditions # 2. visit hf.co/settings/tokens to create an access token # 3. instantiate pretrained voice activity detection pipeline from pyannote.audio import Pipeline pipeline = Pipeline.from_pretrained("pyannote/voice-activity-detection", use_auth_token="ACCESS_TOKEN_GOES_HERE") output = pipeline("audio.wav") for speech in output.get_timeline().support(): # active speech between speech.start and speech.end ... ``` ## Citation ```bibtex @inproceedings{Bredin2021, Title = {{End-to-end speaker segmentation for overlap-aware resegmentation}}, Author = {{Bredin}, Herv{\'e} and {Laurent}, Antoine}, Booktitle = {Proc. Interspeech 2021}, Address = {Brno, Czech Republic}, Month = {August}, Year = {2021}, } ``` ```bibtex @inproceedings{Bredin2020, Title = {{pyannote.audio: neural building blocks for speaker diarization}}, Author = {{Bredin}, Herv{\'e} and {Yin}, Ruiqing and {Coria}, Juan Manuel and {Gelly}, Gregory and {Korshunov}, Pavel and {Lavechin}, Marvin and {Fustes}, Diego and {Titeux}, Hadrien and {Bouaziz}, Wassim and {Gill}, Marie-Philippe}, Booktitle = {ICASSP 2020, IEEE International Conference on Acoustics, Speech, and Signal Processing}, Address = {Barcelona, Spain}, Month = {May}, Year = {2020}, } ```

michellejieli/emotion_text_classifier

michellejieli

transformers

text-classification

--- language: "en" tags: - distilroberta - sentiment - emotion - twitter - reddit widget: - text: "Oh my God, he's lost it. He's totally lost it." - text: "What?" - text: "Wow, congratulations! So excited for you!" --- # Fine-tuned DistilRoBERTa-base for Emotion Classification 🤬🤢😀😐😭😲 # Model Description DistilRoBERTa-base is a transformer model that performs sentiment analysis. I fine-tuned the model on transcripts from the Friends show with the goal of classifying emotions from text data, specifically dialogue from Netflix shows or movies. The model predicts 6 Ekman emotions and a neutral class. These emotions include anger, disgust, fear, joy, neutrality, sadness, and surprise. The model is a fine-tuned version of [Emotion English DistilRoBERTa-base](https://huggingface.co/j-hartmann/emotion-english-distilroberta-base/) and [DistilRoBERTa-base](https://huggingface.co/j-hartmann/emotion-english-distilroberta-base). This model was initially trained on the following table from [Emotion English DistilRoBERTa-base](https://huggingface.co/j-hartmann/emotion-english-distilroberta-base/): |Name|anger|disgust|fear|joy|neutral|sadness|surprise| |---|---|---|---|---|---|---|---| |Crowdflower (2016)|Yes|-|-|Yes|Yes|Yes|Yes| |Emotion Dataset, Elvis et al. (2018)|Yes|-|Yes|Yes|-|Yes|Yes| |GoEmotions, Demszky et al. (2020)|Yes|Yes|Yes|Yes|Yes|Yes|Yes| |ISEAR, Vikash (2018)|Yes|Yes|Yes|Yes|-|Yes|-| |MELD, Poria et al. (2019)|Yes|Yes|Yes|Yes|Yes|Yes|Yes| |SemEval-2018, EI-reg, Mohammad et al. (2018) |Yes|-|Yes|Yes|-|Yes|-| It was fine-tuned on: |Name|anger|disgust|fear|joy|neutral|sadness|surprise| |---|---|---|---|---|---|---|---| |Emotion Lines (Friends)|Yes|Yes|Yes|Yes|Yes|Yes|Yes| # How to Use ```python from transformers import pipeline classifier = pipeline("sentiment-analysis", model="michellejieli/emotion_text_classifier") classifier("I love this!") ``` ```python Output: [{'label': 'joy', 'score': 0.9887555241584778}] ``` # Contact Please reach out to [michelleli1999@gmail.com](mailto:michelleli1999@gmail.com) if you have any questions or feedback. # Reference ``` Jochen Hartmann, "Emotion English DistilRoBERTa-base". https://huggingface.co/j-hartmann/emotion-english-distilroberta-base/, 2022. Ashritha R Murthy and K M Anil Kumar 2021 IOP Conf. Ser.: Mater. Sci. Eng. 1110 012009 ```

ai-forever/sbert_large_nlu_ru

ai-forever

transformers

feature-extraction

--- language: - ru tags: - PyTorch - Transformers --- # BERT large model (uncased) for Sentence Embeddings in Russian language. The model is described [in this article](https://habr.com/ru/company/sberdevices/blog/527576/) For better quality, use mean token embeddings. ## Usage (HuggingFace Models Repository) You can use the model directly from the model repository to compute sentence embeddings: ```python from transformers import AutoTokenizer, AutoModel import torch #Mean Pooling - Take attention mask into account for correct averaging def mean_pooling(model_output, attention_mask): token_embeddings = model_output[0] #First element of model_output contains all token embeddings input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() sum_embeddings = torch.sum(token_embeddings * input_mask_expanded, 1) sum_mask = torch.clamp(input_mask_expanded.sum(1), min=1e-9) return sum_embeddings / sum_mask #Sentences we want sentence embeddings for sentences = ['Привет! Как твои дела?', 'А правда, что 42 твое любимое число?'] #Load AutoModel from huggingface model repository tokenizer = AutoTokenizer.from_pretrained("ai-forever/sbert_large_nlu_ru") model = AutoModel.from_pretrained("ai-forever/sbert_large_nlu_ru") #Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, max_length=24, return_tensors='pt') #Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) #Perform pooling. In this case, mean pooling sentence_embeddings = mean_pooling(model_output, encoded_input['attention_mask']) ``` # Authors + [SberDevices](https://sberdevices.ru/) Team. + Aleksandr Abramov: [HF profile](https://huggingface.co/Andrilko), [Github](https://github.com/Ab1992ao), [Kaggle Competitions Master](https://www.kaggle.com/andrilko); + Denis Antykhov: [Github](https://github.com/gaphex);

pysentimiento/robertuito-emotion-analysis

pysentimiento

pysentimiento

--- language: - es library_name: pysentimiento tags: - emotion-analysis - twitter --- # Emotion Analysis in Spanish ## robertuito-emotion-analysis Repository: [https://github.com/pysentimiento/pysentimiento/](https://github.com/finiteautomata/pysentimiento/) Model trained with TASS 2020 Task 2 corpus for Emotion detection in Spanish. Base model is [RoBERTuito](https://github.com/pysentimiento/robertuito), a RoBERTa model trained in Spanish tweets. Contains the six Ekman emotions plus a neutral class: - anger - disgust - fear - joy - sadness - surprise ## Results Results for the four tasks evaluated in `pysentimiento`. Results are expressed as Macro F1 scores | model | emotion | hate_speech | irony | sentiment | |:--------------|:--------------|:--------------|:--------------|:--------------| | robertuito | 0.560 ± 0.010 | 0.759 ± 0.007 | 0.739 ± 0.005 | 0.705 ± 0.003 | | roberta | 0.527 ± 0.015 | 0.741 ± 0.012 | 0.721 ± 0.008 | 0.670 ± 0.006 | | bertin | 0.524 ± 0.007 | 0.738 ± 0.007 | 0.713 ± 0.012 | 0.666 ± 0.005 | | beto_uncased | 0.532 ± 0.012 | 0.727 ± 0.016 | 0.701 ± 0.007 | 0.651 ± 0.006 | | beto_cased | 0.516 ± 0.012 | 0.724 ± 0.012 | 0.705 ± 0.009 | 0.662 ± 0.005 | | mbert_uncased | 0.493 ± 0.010 | 0.718 ± 0.011 | 0.681 ± 0.010 | 0.617 ± 0.003 | | biGRU | 0.264 ± 0.007 | 0.592 ± 0.018 | 0.631 ± 0.011 | 0.585 ± 0.011 | Note that for Hate Speech, these are the results for Semeval 2019, Task 5 Subtask B (HS+TR+AG detection) ## Citation If you use this model in your research, please cite pysentimiento, RoBERTuito and EmoEvent papers: ``` @misc{perez2021pysentimiento, title={pysentimiento: A Python Toolkit for Sentiment Analysis and SocialNLP tasks}, author={Juan Manuel Pérez and Juan Carlos Giudici and Franco Luque}, year={2021}, eprint={2106.09462}, archivePrefix={arXiv}, primaryClass={cs.CL} } @inproceedings{del2020emoevent, title={EmoEvent: A multilingual emotion corpus based on different events}, author={del Arco, Flor Miriam Plaza and Strapparava, Carlo and Lopez, L Alfonso Urena and Mart{\'\i}n-Valdivia, M Teresa}, booktitle={Proceedings of the 12th Language Resources and Evaluation Conference}, pages={1492--1498}, year={2020} } @inproceedings{perez-etal-2022-robertuito, title = "{R}o{BERT}uito: a pre-trained language model for social media text in {S}panish", author = "P{\'e}rez, Juan Manuel and Furman, Dami{\'a}n Ariel and Alonso Alemany, Laura and Luque, Franco M.", booktitle = "Proceedings of the Thirteenth Language Resources and Evaluation Conference", month = jun, year = "2022", address = "Marseille, France", publisher = "European Language Resources Association", url = "https://aclanthology.org/2022.lrec-1.785", pages = "7235--7243", abstract = "Since BERT appeared, Transformer language models and transfer learning have become state-of-the-art for natural language processing tasks. Recently, some works geared towards pre-training specially-crafted models for particular domains, such as scientific papers, medical documents, user-generated texts, among others. These domain-specific models have been shown to improve performance significantly in most tasks; however, for languages other than English, such models are not widely available. In this work, we present RoBERTuito, a pre-trained language model for user-generated text in Spanish, trained on over 500 million tweets. Experiments on a benchmark of tasks involving user-generated text showed that RoBERTuito outperformed other pre-trained language models in Spanish. In addition to this, our model has some cross-lingual abilities, achieving top results for English-Spanish tasks of the Linguistic Code-Switching Evaluation benchmark (LinCE) and also competitive performance against monolingual models in English Twitter tasks. To facilitate further research, we make RoBERTuito publicly available at the HuggingFace model hub together with the dataset used to pre-train it.", } ```

dunzhang/stella_en_400M_v5

dunzhang

sentence-transformers

sentence-similarity

--- model-index: - name: stella_en_400M_v5 results: - dataset: config: en name: MTEB AmazonCounterfactualClassification (en) revision: e8379541af4e31359cca9fbcf4b00f2671dba205 split: test type: mteb/amazon_counterfactual metrics: - type: accuracy value: 92.35820895522387 - type: ap value: 70.81322736988783 - type: ap_weighted value: 70.81322736988783 - type: f1 value: 88.9505466159595 - type: f1_weighted value: 92.68630932872613 - type: main_score value: 92.35820895522387 task: type: Classification - dataset: config: default name: MTEB AmazonPolarityClassification revision: e2d317d38cd51312af73b3d32a06d1a08b442046 split: test type: mteb/amazon_polarity metrics: - type: accuracy value: 97.1945 - type: ap value: 96.08192192244094 - type: ap_weighted value: 96.08192192244094 - type: f1 value: 97.1936887167346 - type: f1_weighted value: 97.1936887167346 - type: main_score value: 97.1945 task: type: Classification - dataset: config: en name: MTEB AmazonReviewsClassification (en) revision: 1399c76144fd37290681b995c656ef9b2e06e26d split: test type: mteb/amazon_reviews_multi metrics: - type: accuracy value: 59.528000000000006 - type: f1 value: 59.21016819840188 - type: f1_weighted value: 59.21016819840188 - type: main_score value: 59.528000000000006 task: type: Classification - dataset: config: default name: MTEB ArguAna revision: c22ab2a51041ffd869aaddef7af8d8215647e41a split: test type: mteb/arguana metrics: - type: main_score value: 64.24 - type: map_at_1 value: 40.398 - type: map_at_10 value: 56.215 - type: map_at_100 value: 56.833999999999996 - type: map_at_1000 value: 56.835 - type: map_at_20 value: 56.747 - type: map_at_3 value: 52.181 - type: map_at_5 value: 54.628 - type: mrr_at_1 value: 41.25177809388336 - type: mrr_at_10 value: 56.570762491815216 - type: mrr_at_100 value: 57.17548614361504 - type: mrr_at_1000 value: 57.176650626377466 - type: mrr_at_20 value: 57.08916253512566 - type: mrr_at_3 value: 52.47747747747754 - type: mrr_at_5 value: 54.94547178757718 - type: nauc_map_at_1000_diff1 value: 22.408086887100158 - type: nauc_map_at_1000_max value: -8.730419096847543 - type: nauc_map_at_1000_std value: -17.789262741255737 - type: nauc_map_at_100_diff1 value: 22.407371684274025 - type: nauc_map_at_100_max value: -8.732263549026266 - type: nauc_map_at_100_std value: -17.79550515579994 - type: nauc_map_at_10_diff1 value: 21.925005073301246 - type: nauc_map_at_10_max value: -8.990323944492134 - type: nauc_map_at_10_std value: -18.199246301671458 - type: nauc_map_at_1_diff1 value: 26.23276644969203 - type: nauc_map_at_1_max value: -12.376511389571245 - type: nauc_map_at_1_std value: -18.11411715207284 - type: nauc_map_at_20_diff1 value: 22.32455790850922 - type: nauc_map_at_20_max value: -8.664671547236034 - type: nauc_map_at_20_std value: -17.8290016125137 - type: nauc_map_at_3_diff1 value: 22.395462147465064 - type: nauc_map_at_3_max value: -8.206580750918844 - type: nauc_map_at_3_std value: -17.604490446911484 - type: nauc_map_at_5_diff1 value: 21.95307379904799 - type: nauc_map_at_5_max value: -8.03958102978443 - type: nauc_map_at_5_std value: -17.36578866595004 - type: nauc_mrr_at_1000_diff1 value: 20.124236798365587 - type: nauc_mrr_at_1000_max value: -9.587376069575898 - type: nauc_mrr_at_1000_std value: -17.79191612151833 - type: nauc_mrr_at_100_diff1 value: 20.123612603474033 - type: nauc_mrr_at_100_max value: -9.589187218607831 - type: nauc_mrr_at_100_std value: -17.7981617777748 - type: nauc_mrr_at_10_diff1 value: 19.723683875738075 - type: nauc_mrr_at_10_max value: -9.774151729178815 - type: nauc_mrr_at_10_std value: -18.168668675495162 - type: nauc_mrr_at_1_diff1 value: 23.945332059908132 - type: nauc_mrr_at_1_max value: -12.260461466152819 - type: nauc_mrr_at_1_std value: -18.007194922921148 - type: nauc_mrr_at_20_diff1 value: 20.04819461810257 - type: nauc_mrr_at_20_max value: -9.518368283588936 - type: nauc_mrr_at_20_std value: -17.831608149836136 - type: nauc_mrr_at_3_diff1 value: 19.8571785245832 - type: nauc_mrr_at_3_max value: -9.464375021240478 - type: nauc_mrr_at_3_std value: -17.728533927330453 - type: nauc_mrr_at_5_diff1 value: 19.670313652167827 - type: nauc_mrr_at_5_max value: -8.966372585728434 - type: nauc_mrr_at_5_std value: -17.468955834324817 - type: nauc_ndcg_at_1000_diff1 value: 21.863049281767417 - type: nauc_ndcg_at_1000_max value: -8.18698520924057 - type: nauc_ndcg_at_1000_std value: -17.634483364794804 - type: nauc_ndcg_at_100_diff1 value: 21.849924385738586 - type: nauc_ndcg_at_100_max value: -8.226437560889345 - type: nauc_ndcg_at_100_std value: -17.774648478087002 - type: nauc_ndcg_at_10_diff1 value: 19.888395590413573 - type: nauc_ndcg_at_10_max value: -8.968706085632382 - type: nauc_ndcg_at_10_std value: -19.31386964628115 - type: nauc_ndcg_at_1_diff1 value: 26.23276644969203 - type: nauc_ndcg_at_1_max value: -12.376511389571245 - type: nauc_ndcg_at_1_std value: -18.11411715207284 - type: nauc_ndcg_at_20_diff1 value: 21.38413342416933 - type: nauc_ndcg_at_20_max value: -7.636238194084164 - type: nauc_ndcg_at_20_std value: -17.946390844693028 - type: nauc_ndcg_at_3_diff1 value: 21.29169165029195 - type: nauc_ndcg_at_3_max value: -6.793840499730093 - type: nauc_ndcg_at_3_std value: -17.52359001586737 - type: nauc_ndcg_at_5_diff1 value: 20.238297656671364 - type: nauc_ndcg_at_5_max value: -6.424992706950072 - type: nauc_ndcg_at_5_std value: -17.082391132291356 - type: nauc_precision_at_1000_diff1 value: -7.05195108528572 - type: nauc_precision_at_1000_max value: 34.439879624882145 - type: nauc_precision_at_1000_std value: 68.72436351659353 - type: nauc_precision_at_100_diff1 value: -2.769464113932605 - type: nauc_precision_at_100_max value: 9.89562961226698 - type: nauc_precision_at_100_std value: -0.5880967482224028 - type: nauc_precision_at_10_diff1 value: 2.1371544726832323 - type: nauc_precision_at_10_max value: -11.93051325147756 - type: nauc_precision_at_10_std value: -30.83144187392059 - type: nauc_precision_at_1_diff1 value: 26.23276644969203 - type: nauc_precision_at_1_max value: -12.376511389571245 - type: nauc_precision_at_1_std value: -18.11411715207284 - type: nauc_precision_at_20_diff1 value: 3.780146814257504 - type: nauc_precision_at_20_max value: 17.06527540214615 - type: nauc_precision_at_20_std value: -20.36832563035565 - type: nauc_precision_at_3_diff1 value: 17.63894384012077 - type: nauc_precision_at_3_max value: -2.0220490624638887 - type: nauc_precision_at_3_std value: -17.285601413493918 - type: nauc_precision_at_5_diff1 value: 12.557855071944601 - type: nauc_precision_at_5_max value: 0.5840236463956658 - type: nauc_precision_at_5_std value: -15.827224420217846 - type: nauc_recall_at_1000_diff1 value: -7.051951085286463 - type: nauc_recall_at_1000_max value: 34.43987962487738 - type: nauc_recall_at_1000_std value: 68.724363516591 - type: nauc_recall_at_100_diff1 value: -2.769464113930314 - type: nauc_recall_at_100_max value: 9.895629612270017 - type: nauc_recall_at_100_std value: -0.58809674821745 - type: nauc_recall_at_10_diff1 value: 2.1371544726834495 - type: nauc_recall_at_10_max value: -11.930513251477253 - type: nauc_recall_at_10_std value: -30.83144187392047 - type: nauc_recall_at_1_diff1 value: 26.23276644969203 - type: nauc_recall_at_1_max value: -12.376511389571245 - type: nauc_recall_at_1_std value: -18.11411715207284 - type: nauc_recall_at_20_diff1 value: 3.7801468142575922 - type: nauc_recall_at_20_max value: 17.0652754021456 - type: nauc_recall_at_20_std value: -20.36832563035559 - type: nauc_recall_at_3_diff1 value: 17.63894384012074 - type: nauc_recall_at_3_max value: -2.02204906246383 - type: nauc_recall_at_3_std value: -17.28560141349386 - type: nauc_recall_at_5_diff1 value: 12.55785507194463 - type: nauc_recall_at_5_max value: 0.5840236463957296 - type: nauc_recall_at_5_std value: -15.827224420217856 - type: ndcg_at_1 value: 40.398 - type: ndcg_at_10 value: 64.24 - type: ndcg_at_100 value: 66.631 - type: ndcg_at_1000 value: 66.65100000000001 - type: ndcg_at_20 value: 66.086 - type: ndcg_at_3 value: 55.938 - type: ndcg_at_5 value: 60.370000000000005 - type: precision_at_1 value: 40.398 - type: precision_at_10 value: 8.962 - type: precision_at_100 value: 0.9950000000000001 - type: precision_at_1000 value: 0.1 - type: precision_at_20 value: 4.836 - type: precision_at_3 value: 22.262 - type: precision_at_5 value: 15.519 - type: recall_at_1 value: 40.398 - type: recall_at_10 value: 89.616 - type: recall_at_100 value: 99.502 - type: recall_at_1000 value: 99.644 - type: recall_at_20 value: 96.72800000000001 - type: recall_at_3 value: 66.78500000000001 - type: recall_at_5 value: 77.596 task: type: Retrieval - dataset: config: default name: MTEB ArxivClusteringP2P revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d split: test type: mteb/arxiv-clustering-p2p metrics: - type: main_score value: 55.1564333205451 - type: v_measure value: 55.1564333205451 - type: v_measure_std value: 14.696883012214512 task: type: Clustering - dataset: config: default name: MTEB ArxivClusteringS2S revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 split: test type: mteb/arxiv-clustering-s2s metrics: - type: main_score value: 49.823698316694795 - type: v_measure value: 49.823698316694795 - type: v_measure_std value: 14.951660654298186 task: type: Clustering - dataset: config: default name: MTEB AskUbuntuDupQuestions revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 split: test type: mteb/askubuntudupquestions-reranking metrics: - type: main_score value: 66.15294503553424 - type: map value: 66.15294503553424 - type: mrr value: 78.53438420612935 - type: nAUC_map_diff1 value: 12.569697092717997 - type: nAUC_map_max value: 21.50670312412572 - type: nAUC_map_std value: 16.943786429229064 - type: nAUC_mrr_diff1 value: 15.590272897361238 - type: nAUC_mrr_max value: 34.96072022474653 - type: nAUC_mrr_std value: 21.649217605241045 task: type: Reranking - dataset: config: default name: MTEB BIOSSES revision: d3fb88f8f02e40887cd149695127462bbcf29b4a split: test type: mteb/biosses-sts metrics: - type: cosine_pearson value: 85.7824546319275 - type: cosine_spearman value: 83.29587385660628 - type: euclidean_pearson value: 84.58764190565167 - type: euclidean_spearman value: 83.30069324352772 - type: main_score value: 83.29587385660628 - type: manhattan_pearson value: 84.95996839947179 - type: manhattan_spearman value: 83.87480271054358 - type: pearson value: 85.7824546319275 - type: spearman value: 83.29587385660628 task: type: STS - dataset: config: default name: MTEB Banking77Classification revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 split: test type: mteb/banking77 metrics: - type: accuracy value: 89.30194805194806 - type: f1 value: 89.26182507266391 - type: f1_weighted value: 89.26182507266391 - type: main_score value: 89.30194805194806 task: type: Classification - dataset: config: default name: MTEB BiorxivClusteringP2P revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 split: test type: mteb/biorxiv-clustering-p2p metrics: - type: main_score value: 50.67972171889736 - type: v_measure value: 50.67972171889736 - type: v_measure_std value: 0.7687409980036303 task: type: Clustering - dataset: config: default name: MTEB BiorxivClusteringS2S revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 split: test type: mteb/biorxiv-clustering-s2s metrics: - type: main_score value: 45.80539715556144 - type: v_measure value: 45.80539715556144 - type: v_measure_std value: 0.9601346216579142 task: type: Clustering - dataset: config: default name: MTEB CQADupstackRetrieval revision: 4ffe81d471b1924886b33c7567bfb200e9eec5c4 split: test type: mteb/cqadupstack metrics: - type: main_score value: 44.361250000000005 - type: map_at_1 value: 28.304499999999997 - type: map_at_10 value: 38.54841666666666 - type: map_at_100 value: 39.83141666666667 - type: map_at_1000 value: 39.944750000000006 - type: map_at_20 value: 39.25341666666667 - type: map_at_3 value: 35.406749999999995 - type: map_at_5 value: 37.15558333333333 - type: mrr_at_1 value: 34.09077232860122 - type: mrr_at_10 value: 43.15445393211421 - type: mrr_at_100 value: 43.98645286848257 - type: mrr_at_1000 value: 44.037631313469404 - type: mrr_at_20 value: 43.64045813249614 - type: mrr_at_3 value: 40.674138648480486 - type: mrr_at_5 value: 42.106251182620255 - type: nauc_map_at_1000_diff1 value: 46.250011739434996 - type: nauc_map_at_1000_max value: 30.13664446260598 - type: nauc_map_at_1000_std value: 5.422301791618935 - type: nauc_map_at_100_diff1 value: 46.253631351999395 - type: nauc_map_at_100_max value: 30.12612918885181 - type: nauc_map_at_100_std value: 5.367077019987172 - type: nauc_map_at_10_diff1 value: 46.328171341741346 - type: nauc_map_at_10_max value: 29.80274612581464 - type: nauc_map_at_10_std value: 4.62996685176396 - type: nauc_map_at_1_diff1 value: 51.56118117729493 - type: nauc_map_at_1_max value: 27.94885243863768 - type: nauc_map_at_1_std value: 1.700366508927356 - type: nauc_map_at_20_diff1 value: 46.286750260299094 - type: nauc_map_at_20_max value: 29.979205290353278 - type: nauc_map_at_20_std value: 5.010588412441873 - type: nauc_map_at_3_diff1 value: 47.10018183619064 - type: nauc_map_at_3_max value: 29.062318206078753 - type: nauc_map_at_3_std value: 3.2235696254694197 - type: nauc_map_at_5_diff1 value: 46.41971733050039 - type: nauc_map_at_5_max value: 29.456798617695657 - type: nauc_map_at_5_std value: 4.0921691023077145 - type: nauc_mrr_at_1000_diff1 value: 45.88888977975723 - type: nauc_mrr_at_1000_max value: 32.162138978089544 - type: nauc_mrr_at_1000_std value: 6.2811943424217915 - type: nauc_mrr_at_100_diff1 value: 45.87480433011124 - type: nauc_mrr_at_100_max value: 32.16011334212834 - type: nauc_mrr_at_100_std value: 6.2865717772421785 - type: nauc_mrr_at_10_diff1 value: 45.849652904658825 - type: nauc_mrr_at_10_max value: 32.13847916232293 - type: nauc_mrr_at_10_std value: 6.105718728141999 - type: nauc_mrr_at_1_diff1 value: 51.013730325062156 - type: nauc_mrr_at_1_max value: 32.77457396492779 - type: nauc_mrr_at_1_std value: 4.415684893471724 - type: nauc_mrr_at_20_diff1 value: 45.86663046255274 - type: nauc_mrr_at_20_max value: 32.15219360697865 - type: nauc_mrr_at_20_std value: 6.19603046412763 - type: nauc_mrr_at_3_diff1 value: 46.522376582423185 - type: nauc_mrr_at_3_max value: 32.18259009733714 - type: nauc_mrr_at_3_std value: 5.288000648220897 - type: nauc_mrr_at_5_diff1 value: 45.86611481369745 - type: nauc_mrr_at_5_max value: 32.14261639054921 - type: nauc_mrr_at_5_std value: 5.8811238177073735 - type: nauc_ndcg_at_1000_diff1 value: 44.5055097547565 - type: nauc_ndcg_at_1000_max value: 31.149682057975458 - type: nauc_ndcg_at_1000_std value: 8.157937194901333 - type: nauc_ndcg_at_100_diff1 value: 44.12398363638596 - type: nauc_ndcg_at_100_max value: 30.878064321409994 - type: nauc_ndcg_at_100_std value: 8.40493441452808 - type: nauc_ndcg_at_10_diff1 value: 44.200093505221474 - type: nauc_ndcg_at_10_max value: 30.15267107733158 - type: nauc_ndcg_at_10_std value: 6.407495361566107 - type: nauc_ndcg_at_1_diff1 value: 51.013730325062156 - type: nauc_ndcg_at_1_max value: 32.77457396492779 - type: nauc_ndcg_at_1_std value: 4.415684893471724 - type: nauc_ndcg_at_20_diff1 value: 44.16988321564116 - type: nauc_ndcg_at_20_max value: 30.333532500651213 - type: nauc_ndcg_at_20_std value: 7.10024701386895 - type: nauc_ndcg_at_3_diff1 value: 45.35982873879988 - type: nauc_ndcg_at_3_max value: 30.288312457948702 - type: nauc_ndcg_at_3_std value: 4.653900898293395 - type: nauc_ndcg_at_5_diff1 value: 44.324558115380185 - type: nauc_ndcg_at_5_max value: 30.048149698941373 - type: nauc_ndcg_at_5_std value: 5.6684459618413205 - type: nauc_precision_at_1000_diff1 value: -7.282175798304458 - type: nauc_precision_at_1000_max value: 7.820142031765352 - type: nauc_precision_at_1000_std value: 11.736131836431172 - type: nauc_precision_at_100_diff1 value: 1.0222940256506976 - type: nauc_precision_at_100_max value: 16.12346497070298 - type: nauc_precision_at_100_std value: 18.202607395247874 - type: nauc_precision_at_10_diff1 value: 18.289439185857837 - type: nauc_precision_at_10_max value: 26.116517399154375 - type: nauc_precision_at_10_std value: 13.921214069982302 - type: nauc_precision_at_1_diff1 value: 51.013730325062156 - type: nauc_precision_at_1_max value: 32.77457396492779 - type: nauc_precision_at_1_std value: 4.415684893471724 - type: nauc_precision_at_20_diff1 value: 12.365165405210886 - type: nauc_precision_at_20_max value: 22.946297258937367 - type: nauc_precision_at_20_std value: 16.13862870358933 - type: nauc_precision_at_3_diff1 value: 32.063423642849685 - type: nauc_precision_at_3_max value: 30.140965811989407 - type: nauc_precision_at_3_std value: 8.501746262550146 - type: nauc_precision_at_5_diff1 value: 24.777203357717948 - type: nauc_precision_at_5_max value: 28.401579566848472 - type: nauc_precision_at_5_std value: 11.643246774390914 - type: nauc_recall_at_1000_diff1 value: 30.04216463401409 - type: nauc_recall_at_1000_max value: 34.98067760563842 - type: nauc_recall_at_1000_std value: 48.01453905250591 - type: nauc_recall_at_100_diff1 value: 31.193415507513972 - type: nauc_recall_at_100_max value: 28.69740149270981 - type: nauc_recall_at_100_std value: 25.20960758920368 - type: nauc_recall_at_10_diff1 value: 36.18870823636506 - type: nauc_recall_at_10_max value: 26.005625231341238 - type: nauc_recall_at_10_std value: 8.891983977041376 - type: nauc_recall_at_1_diff1 value: 51.56118117729493 - type: nauc_recall_at_1_max value: 27.94885243863768 - type: nauc_recall_at_1_std value: 1.700366508927356 - type: nauc_recall_at_20_diff1 value: 34.93996118564803 - type: nauc_recall_at_20_max value: 26.149961715956138 - type: nauc_recall_at_20_std value: 12.0657502367633 - type: nauc_recall_at_3_diff1 value: 40.80743946709512 - type: nauc_recall_at_3_max value: 26.443127773025783 - type: nauc_recall_at_3_std value: 3.7011448604241477 - type: nauc_recall_at_5_diff1 value: 37.608535157055776 - type: nauc_recall_at_5_max value: 26.168016189725822 - type: nauc_recall_at_5_std value: 6.344191564595316 - type: ndcg_at_1 value: 34.09083333333333 - type: ndcg_at_10 value: 44.361250000000005 - type: ndcg_at_100 value: 49.586166666666664 - type: ndcg_at_1000 value: 51.623583333333336 - type: ndcg_at_20 value: 46.40158333333333 - type: ndcg_at_3 value: 39.27733333333333 - type: ndcg_at_5 value: 41.662333333333336 - type: precision_at_1 value: 34.09083333333333 - type: precision_at_10 value: 7.957000000000002 - type: precision_at_100 value: 1.2521666666666669 - type: precision_at_1000 value: 0.16125 - type: precision_at_20 value: 4.6755 - type: precision_at_3 value: 18.402083333333334 - type: precision_at_5 value: 13.104333333333335 - type: recall_at_1 value: 28.304499999999997 - type: recall_at_10 value: 56.80666666666667 - type: recall_at_100 value: 79.66208333333334 - type: recall_at_1000 value: 93.6455 - type: recall_at_20 value: 64.2495 - type: recall_at_3 value: 42.431333333333335 - type: recall_at_5 value: 48.665416666666665 task: type: Retrieval - dataset: config: default name: MTEB ClimateFEVER revision: 47f2ac6acb640fc46020b02a5b59fdda04d39380 split: test type: mteb/climate-fever metrics: - type: main_score value: 43.525999999999996 - type: map_at_1 value: 19.291 - type: map_at_10 value: 33.471000000000004 - type: map_at_100 value: 35.388999999999996 - type: map_at_1000 value: 35.568 - type: map_at_20 value: 34.496 - type: map_at_3 value: 28.713 - type: map_at_5 value: 31.384 - type: mrr_at_1 value: 43.77850162866449 - type: mrr_at_10 value: 56.28576598934912 - type: mrr_at_100 value: 56.8588518168194 - type: mrr_at_1000 value: 56.878236725973544 - type: mrr_at_20 value: 56.6409328120183 - type: mrr_at_3 value: 53.56134636264935 - type: mrr_at_5 value: 55.27795874049956 - type: nauc_map_at_1000_diff1 value: 27.262513153363876 - type: nauc_map_at_1000_max value: 40.099398684385584 - type: nauc_map_at_1000_std value: 18.847812394005512 - type: nauc_map_at_100_diff1 value: 27.238993503030745 - type: nauc_map_at_100_max value: 40.07730434492169 - type: nauc_map_at_100_std value: 18.795349250833684 - type: nauc_map_at_10_diff1 value: 27.70929180366227 - type: nauc_map_at_10_max value: 39.55987024970173 - type: nauc_map_at_10_std value: 17.214881544648996 - type: nauc_map_at_1_diff1 value: 43.34155892182403 - type: nauc_map_at_1_max value: 38.23324890148018 - type: nauc_map_at_1_std value: 6.0781444393516075 - type: nauc_map_at_20_diff1 value: 27.311577477800103 - type: nauc_map_at_20_max value: 39.624414083413456 - type: nauc_map_at_20_std value: 18.149811054163287 - type: nauc_map_at_3_diff1 value: 30.475965062734367 - type: nauc_map_at_3_max value: 38.49324825043695 - type: nauc_map_at_3_std value: 13.357656038648487 - type: nauc_map_at_5_diff1 value: 28.425110095017747 - type: nauc_map_at_5_max value: 39.017894870747796 - type: nauc_map_at_5_std value: 15.543817194122564 - type: nauc_mrr_at_1000_diff1 value: 33.16689354701644 - type: nauc_mrr_at_1000_max value: 41.70755363247148 - type: nauc_mrr_at_1000_std value: 24.61667417463176 - type: nauc_mrr_at_100_diff1 value: 33.147229262917506 - type: nauc_mrr_at_100_max value: 41.712455697170725 - type: nauc_mrr_at_100_std value: 24.6418922043652 - type: nauc_mrr_at_10_diff1 value: 32.94185191112572 - type: nauc_mrr_at_10_max value: 41.64272730141954 - type: nauc_mrr_at_10_std value: 24.663391015702707 - type: nauc_mrr_at_1_diff1 value: 39.571969559016395 - type: nauc_mrr_at_1_max value: 39.396249211263495 - type: nauc_mrr_at_1_std value: 16.984149923258357 - type: nauc_mrr_at_20_diff1 value: 33.10040770334742 - type: nauc_mrr_at_20_max value: 41.807565560083034 - type: nauc_mrr_at_20_std value: 24.8064180365271 - type: nauc_mrr_at_3_diff1 value: 33.065406161485704 - type: nauc_mrr_at_3_max value: 41.049510969934694 - type: nauc_mrr_at_3_std value: 23.18371458928609 - type: nauc_mrr_at_5_diff1 value: 33.2389593543916 - type: nauc_mrr_at_5_max value: 41.629486918949915 - type: nauc_mrr_at_5_std value: 24.5777253036149 - type: nauc_ndcg_at_1000_diff1 value: 25.868840609197637 - type: nauc_ndcg_at_1000_max value: 42.79564910784761 - type: nauc_ndcg_at_1000_std value: 27.035091271680113 - type: nauc_ndcg_at_100_diff1 value: 25.019789319579942 - type: nauc_ndcg_at_100_max value: 42.482345143533735 - type: nauc_ndcg_at_100_std value: 26.76872010731345 - type: nauc_ndcg_at_10_diff1 value: 25.949464660653238 - type: nauc_ndcg_at_10_max value: 40.79769544643906 - type: nauc_ndcg_at_10_std value: 22.486116508973204 - type: nauc_ndcg_at_1_diff1 value: 39.571969559016395 - type: nauc_ndcg_at_1_max value: 39.396249211263495 - type: nauc_ndcg_at_1_std value: 16.984149923258357 - type: nauc_ndcg_at_20_diff1 value: 25.173455685962214 - type: nauc_ndcg_at_20_max value: 40.88873540662413 - type: nauc_ndcg_at_20_std value: 24.4451041955519 - type: nauc_ndcg_at_3_diff1 value: 28.185416070726333 - type: nauc_ndcg_at_3_max value: 39.10600031163912 - type: nauc_ndcg_at_3_std value: 18.42694044215541 - type: nauc_ndcg_at_5_diff1 value: 27.112647584005583 - type: nauc_ndcg_at_5_max value: 40.154045682322526 - type: nauc_ndcg_at_5_std value: 20.26822517176828 - type: nauc_precision_at_1000_diff1 value: -16.42087927044017 - type: nauc_precision_at_1000_max value: 3.5326295053913 - type: nauc_precision_at_1000_std value: 24.406810708493197 - type: nauc_precision_at_100_diff1 value: -12.17648135724982 - type: nauc_precision_at_100_max value: 15.895489260126183 - type: nauc_precision_at_100_std value: 32.48346122610907 - type: nauc_precision_at_10_diff1 value: -1.2493131347748072 - type: nauc_precision_at_10_max value: 26.409459305604376 - type: nauc_precision_at_10_std value: 31.115432019300016 - type: nauc_precision_at_1_diff1 value: 39.571969559016395 - type: nauc_precision_at_1_max value: 39.396249211263495 - type: nauc_precision_at_1_std value: 16.984149923258357 - type: nauc_precision_at_20_diff1 value: -6.597509397240593 - type: nauc_precision_at_20_max value: 21.461984620659695 - type: nauc_precision_at_20_std value: 32.9450259748889 - type: nauc_precision_at_3_diff1 value: 9.46378764865453 - type: nauc_precision_at_3_max value: 32.03650819375425 - type: nauc_precision_at_3_std value: 26.489382638510765 - type: nauc_precision_at_5_diff1 value: 3.5987036728169537 - type: nauc_precision_at_5_max value: 30.633955978579703 - type: nauc_precision_at_5_std value: 30.532430088014443 - type: nauc_recall_at_1000_diff1 value: 10.714633106872254 - type: nauc_recall_at_1000_max value: 43.94958623961 - type: nauc_recall_at_1000_std value: 51.78914468954123 - type: nauc_recall_at_100_diff1 value: 9.63781472255557 - type: nauc_recall_at_100_max value: 38.50917465255336 - type: nauc_recall_at_100_std value: 37.78623984642377 - type: nauc_recall_at_10_diff1 value: 16.480342820841688 - type: nauc_recall_at_10_max value: 35.982566867357406 - type: nauc_recall_at_10_std value: 23.30688188788895 - type: nauc_recall_at_1_diff1 value: 43.34155892182403 - type: nauc_recall_at_1_max value: 38.23324890148018 - type: nauc_recall_at_1_std value: 6.0781444393516075 - type: nauc_recall_at_20_diff1 value: 13.521048985146367 - type: nauc_recall_at_20_max value: 34.62462209239834 - type: nauc_recall_at_20_std value: 27.85924191501618 - type: nauc_recall_at_3_diff1 value: 23.57032748533523 - type: nauc_recall_at_3_max value: 36.32703197635613 - type: nauc_recall_at_3_std value: 15.730238734014337 - type: nauc_recall_at_5_diff1 value: 19.61387036368584 - type: nauc_recall_at_5_max value: 36.22030835529556 - type: nauc_recall_at_5_std value: 19.76310648649897 - type: ndcg_at_1 value: 43.779 - type: ndcg_at_10 value: 43.525999999999996 - type: ndcg_at_100 value: 50.138000000000005 - type: ndcg_at_1000 value: 52.991 - type: ndcg_at_20 value: 46.083 - type: ndcg_at_3 value: 38.002 - type: ndcg_at_5 value: 39.842 - type: precision_at_1 value: 43.779 - type: precision_at_10 value: 13.205 - type: precision_at_100 value: 2.051 - type: precision_at_1000 value: 0.259 - type: precision_at_20 value: 7.722999999999999 - type: precision_at_3 value: 28.903000000000002 - type: precision_at_5 value: 21.368000000000002 - type: recall_at_1 value: 19.291 - type: recall_at_10 value: 48.754 - type: recall_at_100 value: 70.97200000000001 - type: recall_at_1000 value: 86.611 - type: recall_at_20 value: 55.884 - type: recall_at_3 value: 34.101 - type: recall_at_5 value: 40.784 task: type: Retrieval - dataset: config: default name: MTEB DBPedia revision: c0f706b76e590d620bd6618b3ca8efdd34e2d659 split: test type: mteb/dbpedia metrics: - type: main_score value: 49.884 - type: map_at_1 value: 9.913 - type: map_at_10 value: 23.186999999999998 - type: map_at_100 value: 34.207 - type: map_at_1000 value: 36.318 - type: map_at_20 value: 27.419 - type: map_at_3 value: 15.656 - type: map_at_5 value: 18.945999999999998 - type: mrr_at_1 value: 75.75 - type: mrr_at_10 value: 82.16279761904761 - type: mrr_at_100 value: 82.48445635330299 - type: mrr_at_1000 value: 82.4870246719901 - type: mrr_at_20 value: 82.36203632968338 - type: mrr_at_3 value: 81.29166666666666 - type: mrr_at_5 value: 82.02916666666667 - type: nauc_map_at_1000_diff1 value: 17.0739966990996 - type: nauc_map_at_1000_max value: 28.440065298437133 - type: nauc_map_at_1000_std value: 20.83498154003865 - type: nauc_map_at_100_diff1 value: 17.75982086107111 - type: nauc_map_at_100_max value: 26.87850835673573 - type: nauc_map_at_100_std value: 18.350282298599275 - type: nauc_map_at_10_diff1 value: 17.15984258564116 - type: nauc_map_at_10_max value: 10.846179132675553 - type: nauc_map_at_10_std value: -6.263534464094614 - type: nauc_map_at_1_diff1 value: 24.014897777973694 - type: nauc_map_at_1_max value: -4.556638938723358 - type: nauc_map_at_1_std value: -22.7844467526989 - type: nauc_map_at_20_diff1 value: 16.3179372493187 - type: nauc_map_at_20_max value: 17.176378915498915 - type: nauc_map_at_20_std value: 1.9378637630340372 - type: nauc_map_at_3_diff1 value: 19.12786794046792 - type: nauc_map_at_3_max value: 0.09063919305677291 - type: nauc_map_at_3_std value: -16.713143158330492 - type: nauc_map_at_5_diff1 value: 18.76504725420023 - type: nauc_map_at_5_max value: 5.040867712207419 - type: nauc_map_at_5_std value: -12.382578318931165 - type: nauc_mrr_at_1000_diff1 value: 54.61266255011247 - type: nauc_mrr_at_1000_max value: 60.83961280977112 - type: nauc_mrr_at_1000_std value: 32.70429260443016 - type: nauc_mrr_at_100_diff1 value: 54.61346236538542 - type: nauc_mrr_at_100_max value: 60.8407974416647 - type: nauc_mrr_at_100_std value: 32.69272843993462 - type: nauc_mrr_at_10_diff1 value: 54.74633685810871 - type: nauc_mrr_at_10_max value: 61.084525933097865 - type: nauc_mrr_at_10_std value: 33.001220210025565 - type: nauc_mrr_at_1_diff1 value: 56.12708423835806 - type: nauc_mrr_at_1_max value: 58.9314540998289 - type: nauc_mrr_at_1_std value: 27.39422607651012 - type: nauc_mrr_at_20_diff1 value: 54.58896150245695 - type: nauc_mrr_at_20_max value: 60.890929983464815 - type: nauc_mrr_at_20_std value: 32.65559641276393 - type: nauc_mrr_at_3_diff1 value: 54.38229071443791 - type: nauc_mrr_at_3_max value: 59.987849044098596 - type: nauc_mrr_at_3_std value: 33.439813880719974 - type: nauc_mrr_at_5_diff1 value: 54.961790262449824 - type: nauc_mrr_at_5_max value: 61.17705173908951 - type: nauc_mrr_at_5_std value: 33.30939850734856 - type: nauc_ndcg_at_1000_diff1 value: 29.27465932507067 - type: nauc_ndcg_at_1000_max value: 47.952543312315214 - type: nauc_ndcg_at_1000_std value: 36.17132236391485 - type: nauc_ndcg_at_100_diff1 value: 28.63072328980134 - type: nauc_ndcg_at_100_max value: 41.460833419186564 - type: nauc_ndcg_at_100_std value: 27.157100358988135 - type: nauc_ndcg_at_10_diff1 value: 23.41488013023301 - type: nauc_ndcg_at_10_max value: 39.27798133072349 - type: nauc_ndcg_at_10_std value: 21.979241438928312 - type: nauc_ndcg_at_1_diff1 value: 46.12120543657642 - type: nauc_ndcg_at_1_max value: 47.28452124039853 - type: nauc_ndcg_at_1_std value: 19.799884708952543 - type: nauc_ndcg_at_20_diff1 value: 23.627669045115574 - type: nauc_ndcg_at_20_max value: 35.88225062457673 - type: nauc_ndcg_at_20_std value: 18.218628030529498 - type: nauc_ndcg_at_3_diff1 value: 25.37309228946118 - type: nauc_ndcg_at_3_max value: 40.64426332992231 - type: nauc_ndcg_at_3_std value: 24.608330645901482 - type: nauc_ndcg_at_5_diff1 value: 24.055798594999654 - type: nauc_ndcg_at_5_max value: 41.16180524175431 - type: nauc_ndcg_at_5_std value: 24.048305528761315 - type: nauc_precision_at_1000_diff1 value: -18.234943251015576 - type: nauc_precision_at_1000_max value: 0.48708502364659184 - type: nauc_precision_at_1000_std value: 2.4473601543134027 - type: nauc_precision_at_100_diff1 value: -3.0077810947381227 - type: nauc_precision_at_100_max value: 25.27249321108913 - type: nauc_precision_at_100_std value: 37.36575792126928 - type: nauc_precision_at_10_diff1 value: -0.2393778190297635 - type: nauc_precision_at_10_max value: 36.40513293547299 - type: nauc_precision_at_10_std value: 37.4827885766009 - type: nauc_precision_at_1_diff1 value: 56.12708423835806 - type: nauc_precision_at_1_max value: 58.9314540998289 - type: nauc_precision_at_1_std value: 27.39422607651012 - type: nauc_precision_at_20_diff1 value: -1.2010133229402933 - type: nauc_precision_at_20_max value: 34.117541814385966 - type: nauc_precision_at_20_std value: 39.13273254177449 - type: nauc_precision_at_3_diff1 value: 11.757378092198486 - type: nauc_precision_at_3_max value: 42.637962482588875 - type: nauc_precision_at_3_std value: 37.42465077352342 - type: nauc_precision_at_5_diff1 value: 7.233177203405101 - type: nauc_precision_at_5_max value: 43.1663582897407 - type: nauc_precision_at_5_std value: 38.848449220750055 - type: nauc_recall_at_1000_diff1 value: 27.33938551969145 - type: nauc_recall_at_1000_max value: 45.5614254479334 - type: nauc_recall_at_1000_std value: 50.58528916250458 - type: nauc_recall_at_100_diff1 value: 23.610383761920097 - type: nauc_recall_at_100_max value: 31.422168485847184 - type: nauc_recall_at_100_std value: 25.58649926458304 - type: nauc_recall_at_10_diff1 value: 14.62495111808408 - type: nauc_recall_at_10_max value: 7.4295041277681095 - type: nauc_recall_at_10_std value: -9.32297089600654 - type: nauc_recall_at_1_diff1 value: 24.014897777973694 - type: nauc_recall_at_1_max value: -4.556638938723358 - type: nauc_recall_at_1_std value: -22.7844467526989 - type: nauc_recall_at_20_diff1 value: 14.027862330014662 - type: nauc_recall_at_20_max value: 12.437478731690844 - type: nauc_recall_at_20_std value: -3.0740743798103676 - type: nauc_recall_at_3_diff1 value: 16.354018356566712 - type: nauc_recall_at_3_max value: -2.9812231240997917 - type: nauc_recall_at_3_std value: -18.27746460743442 - type: nauc_recall_at_5_diff1 value: 16.81486583473587 - type: nauc_recall_at_5_max value: 2.420128513974744 - type: nauc_recall_at_5_std value: -14.441820321214108 - type: ndcg_at_1 value: 63.87500000000001 - type: ndcg_at_10 value: 49.884 - type: ndcg_at_100 value: 54.738 - type: ndcg_at_1000 value: 61.635 - type: ndcg_at_20 value: 48.894999999999996 - type: ndcg_at_3 value: 54.287 - type: ndcg_at_5 value: 52.40899999999999 - type: precision_at_1 value: 75.75 - type: precision_at_10 value: 40.9 - type: precision_at_100 value: 13.139999999999999 - type: precision_at_1000 value: 2.533 - type: precision_at_20 value: 30.8 - type: precision_at_3 value: 57.667 - type: precision_at_5 value: 51.05 - type: recall_at_1 value: 9.913 - type: recall_at_10 value: 28.591 - type: recall_at_100 value: 61.017999999999994 - type: recall_at_1000 value: 83.383 - type: recall_at_20 value: 37.834 - type: recall_at_3 value: 17.049 - type: recall_at_5 value: 21.685 task: type: Retrieval - dataset: config: default name: MTEB EmotionClassification revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 split: test type: mteb/emotion metrics: - type: accuracy value: 78.77499999999999 - type: f1 value: 73.74058240799386 - type: f1_weighted value: 79.78804377638227 - type: main_score value: 78.77499999999999 task: type: Classification - dataset: config: default name: MTEB FEVER revision: bea83ef9e8fb933d90a2f1d5515737465d613e12 split: test type: mteb/fever metrics: - type: main_score value: 90.986 - type: map_at_1 value: 81.601 - type: map_at_10 value: 88.242 - type: map_at_100 value: 88.46000000000001 - type: map_at_1000 value: 88.472 - type: map_at_20 value: 88.375 - type: map_at_3 value: 87.237 - type: map_at_5 value: 87.85300000000001 - type: mrr_at_1 value: 87.81878187818782 - type: mrr_at_10 value: 92.20301196786335 - type: mrr_at_100 value: 92.24884236673292 - type: mrr_at_1000 value: 92.2496338899362 - type: mrr_at_20 value: 92.23112073283473 - type: mrr_at_3 value: 91.77417741774165 - type: mrr_at_5 value: 92.03970397039689 - type: nauc_map_at_1000_diff1 value: 56.54670664910505 - type: nauc_map_at_1000_max value: 33.08375749975477 - type: nauc_map_at_1000_std value: 2.7491595418252865 - type: nauc_map_at_100_diff1 value: 56.50887688686924 - type: nauc_map_at_100_max value: 33.075487189958494 - type: nauc_map_at_100_std value: 2.7675869969253375 - type: nauc_map_at_10_diff1 value: 56.08080806610569 - type: nauc_map_at_10_max value: 32.776972098819066 - type: nauc_map_at_10_std value: 2.5904846711290097 - type: nauc_map_at_1_diff1 value: 60.645344065853145 - type: nauc_map_at_1_max value: 31.232776777514797 - type: nauc_map_at_1_std value: -1.1946138176109171 - type: nauc_map_at_20_diff1 value: 56.28378454162355 - type: nauc_map_at_20_max value: 32.98207150385811 - type: nauc_map_at_20_std value: 2.8469814040214025 - type: nauc_map_at_3_diff1 value: 55.81958007095375 - type: nauc_map_at_3_max value: 31.602707711038313 - type: nauc_map_at_3_std value: 0.8117019292273401 - type: nauc_map_at_5_diff1 value: 55.706025752316535 - type: nauc_map_at_5_max value: 32.16032683604737 - type: nauc_map_at_5_std value: 1.8853201503498669 - type: nauc_mrr_at_1000_diff1 value: 75.4997173366251 - type: nauc_mrr_at_1000_max value: 41.49117135484116 - type: nauc_mrr_at_1000_std value: -2.0636172883680852 - type: nauc_mrr_at_100_diff1 value: 75.50118860648519 - type: nauc_mrr_at_100_max value: 41.49490161517194 - type: nauc_mrr_at_100_std value: -2.057024385178682 - type: nauc_mrr_at_10_diff1 value: 75.47295153099428 - type: nauc_mrr_at_10_max value: 41.55003304042536 - type: nauc_mrr_at_10_std value: -2.0353663198929253 - type: nauc_mrr_at_1_diff1 value: 76.632058433229 - type: nauc_mrr_at_1_max value: 39.754483718891656 - type: nauc_mrr_at_1_std value: -2.962241058101701 - type: nauc_mrr_at_20_diff1 value: 75.47221882396194 - type: nauc_mrr_at_20_max value: 41.50779280480839 - type: nauc_mrr_at_20_std value: -1.9620212266426307 - type: nauc_mrr_at_3_diff1 value: 75.5682297897137 - type: nauc_mrr_at_3_max value: 41.53543801506081 - type: nauc_mrr_at_3_std value: -3.391681195945978 - type: nauc_mrr_at_5_diff1 value: 75.37562775183947 - type: nauc_mrr_at_5_max value: 41.42028509006753 - type: nauc_mrr_at_5_std value: -2.418698675622726 - type: nauc_ndcg_at_1000_diff1 value: 59.364557011624 - type: nauc_ndcg_at_1000_max value: 35.4112238125149 - type: nauc_ndcg_at_1000_std value: 3.717516193303376 - type: nauc_ndcg_at_100_diff1 value: 58.55706703023122 - type: nauc_ndcg_at_100_max value: 35.352285999934594 - type: nauc_ndcg_at_100_std value: 4.273437944266781 - type: nauc_ndcg_at_10_diff1 value: 56.77422701267037 - type: nauc_ndcg_at_10_max value: 34.24909893882957 - type: nauc_ndcg_at_10_std value: 4.178151434006727 - type: nauc_ndcg_at_1_diff1 value: 76.632058433229 - type: nauc_ndcg_at_1_max value: 39.754483718891656 - type: nauc_ndcg_at_1_std value: -2.962241058101701 - type: nauc_ndcg_at_20_diff1 value: 57.27343398231262 - type: nauc_ndcg_at_20_max value: 34.7416626740278 - type: nauc_ndcg_at_20_std value: 4.955858766014002 - type: nauc_ndcg_at_3_diff1 value: 57.69267803121093 - type: nauc_ndcg_at_3_max value: 33.13744317023105 - type: nauc_ndcg_at_3_std value: 0.40380284030057023 - type: nauc_ndcg_at_5_diff1 value: 56.57461019113917 - type: nauc_ndcg_at_5_max value: 33.244657840804386 - type: nauc_ndcg_at_5_std value: 2.5121440827702046 - type: nauc_precision_at_1000_diff1 value: -14.54492513449718 - type: nauc_precision_at_1000_max value: -5.94552147573623 - type: nauc_precision_at_1000_std value: 1.2446209816057374 - type: nauc_precision_at_100_diff1 value: -15.452676132568344 - type: nauc_precision_at_100_max value: -3.760241749847617 - type: nauc_precision_at_100_std value: 4.623534605290865 - type: nauc_precision_at_10_diff1 value: -12.712908026086176 - type: nauc_precision_at_10_max value: 0.45241316994816805 - type: nauc_precision_at_10_std value: 7.849478570138391 - type: nauc_precision_at_1_diff1 value: 76.632058433229 - type: nauc_precision_at_1_max value: 39.754483718891656 - type: nauc_precision_at_1_std value: -2.962241058101701 - type: nauc_precision_at_20_diff1 value: -14.514618673172041 - type: nauc_precision_at_20_max value: -1.113635490621818 - type: nauc_precision_at_20_std value: 8.599811730457576 - type: nauc_precision_at_3_diff1 value: 6.1367799850003815 - type: nauc_precision_at_3_max value: 8.466271950897857 - type: nauc_precision_at_3_std value: 1.7458051543195068 - type: nauc_precision_at_5_diff1 value: -5.804548945783379 - type: nauc_precision_at_5_max value: 3.4060251839074818 - type: nauc_precision_at_5_std value: 5.583410511782371 - type: nauc_recall_at_1000_diff1 value: 19.329432953574095 - type: nauc_recall_at_1000_max value: 43.260442595158736 - type: nauc_recall_at_1000_std value: 53.89644660661804 - type: nauc_recall_at_100_diff1 value: 21.265326296051235 - type: nauc_recall_at_100_max value: 38.573000195373695 - type: nauc_recall_at_100_std value: 42.169391082152785 - type: nauc_recall_at_10_diff1 value: 29.785129558987432 - type: nauc_recall_at_10_max value: 28.379657867558034 - type: nauc_recall_at_10_std value: 21.132574624091973 - type: nauc_recall_at_1_diff1 value: 60.645344065853145 - type: nauc_recall_at_1_max value: 31.232776777514797 - type: nauc_recall_at_1_std value: -1.1946138176109171 - type: nauc_recall_at_20_diff1 value: 25.88845612373954 - type: nauc_recall_at_20_max value: 30.24785945821152 - type: nauc_recall_at_20_std value: 31.73911437468067 - type: nauc_recall_at_3_diff1 value: 42.2968464797395 - type: nauc_recall_at_3_max value: 26.494318009870018 - type: nauc_recall_at_3_std value: 2.6045977160467544 - type: nauc_recall_at_5_diff1 value: 35.81340094401374 - type: nauc_recall_at_5_max value: 25.91082947510634 - type: nauc_recall_at_5_std value: 9.759404930864779 - type: ndcg_at_1 value: 87.819 - type: ndcg_at_10 value: 90.986 - type: ndcg_at_100 value: 91.69 - type: ndcg_at_1000 value: 91.863 - type: ndcg_at_20 value: 91.293 - type: ndcg_at_3 value: 89.621 - type: ndcg_at_5 value: 90.333 - type: precision_at_1 value: 87.819 - type: precision_at_10 value: 10.753 - type: precision_at_100 value: 1.138 - type: precision_at_1000 value: 0.117 - type: precision_at_20 value: 5.4879999999999995 - type: precision_at_3 value: 33.703 - type: precision_at_5 value: 20.831 - type: recall_at_1 value: 81.601 - type: recall_at_10 value: 95.44200000000001 - type: recall_at_100 value: 98.14399999999999 - type: recall_at_1000 value: 99.157 - type: recall_at_20 value: 96.43 - type: recall_at_3 value: 91.729 - type: recall_at_5 value: 93.552 task: type: Retrieval - dataset: config: default name: MTEB FiQA2018 revision: 27a168819829fe9bcd655c2df245fb19452e8e06 split: test type: mteb/fiqa metrics: - type: main_score value: 56.056 - type: map_at_1 value: 28.666000000000004 - type: map_at_10 value: 47.437000000000005 - type: map_at_100 value: 49.537 - type: map_at_1000 value: 49.665 - type: map_at_20 value: 48.618 - type: map_at_3 value: 41.355 - type: map_at_5 value: 44.525 - type: mrr_at_1 value: 55.55555555555556 - type: mrr_at_10 value: 63.705173427395614 - type: mrr_at_100 value: 64.25449940779741 - type: mrr_at_1000 value: 64.27635581092147 - type: mrr_at_20 value: 64.03796029079103 - type: mrr_at_3 value: 61.49691358024688 - type: mrr_at_5 value: 62.73148148148143 - type: nauc_map_at_1000_diff1 value: 43.24282910397747 - type: nauc_map_at_1000_max value: 28.506093180265644 - type: nauc_map_at_1000_std value: -13.040508386155054 - type: nauc_map_at_100_diff1 value: 43.23650442904607 - type: nauc_map_at_100_max value: 28.470565635459156 - type: nauc_map_at_100_std value: -12.988098780714935 - type: nauc_map_at_10_diff1 value: 43.393840733087686 - type: nauc_map_at_10_max value: 26.637302062720153 - type: nauc_map_at_10_std value: -14.47500292113762 - type: nauc_map_at_1_diff1 value: 47.705150227211725 - type: nauc_map_at_1_max value: 15.354189686550129 - type: nauc_map_at_1_std value: -14.559819859039067 - type: nauc_map_at_20_diff1 value: 43.14121075706104 - type: nauc_map_at_20_max value: 27.811170590408395 - type: nauc_map_at_20_std value: -13.459413585283583 - type: nauc_map_at_3_diff1 value: 44.33938667720801 - type: nauc_map_at_3_max value: 21.785619884549398 - type: nauc_map_at_3_std value: -15.569980103071593 - type: nauc_map_at_5_diff1 value: 43.39280905665027 - type: nauc_map_at_5_max value: 25.021492190645017 - type: nauc_map_at_5_std value: -14.48856622187443 - type: nauc_mrr_at_1000_diff1 value: 52.971563939946286 - type: nauc_mrr_at_1000_max value: 38.88019486172324 - type: nauc_mrr_at_1000_std value: -12.412991642381616 - type: nauc_mrr_at_100_diff1 value: 52.978468139876945 - type: nauc_mrr_at_100_max value: 38.89751787948751 - type: nauc_mrr_at_100_std value: -12.3677876252269 - type: nauc_mrr_at_10_diff1 value: 52.78507148048174 - type: nauc_mrr_at_10_max value: 38.55079809310022 - type: nauc_mrr_at_10_std value: -12.944127025078755 - type: nauc_mrr_at_1_diff1 value: 55.52626805861546 - type: nauc_mrr_at_1_max value: 40.49306809164979 - type: nauc_mrr_at_1_std value: -12.886607701317681 - type: nauc_mrr_at_20_diff1 value: 52.9592152665678 - type: nauc_mrr_at_20_max value: 38.88514014589964 - type: nauc_mrr_at_20_std value: -12.434464359819444 - type: nauc_mrr_at_3_diff1 value: 52.73696844091174 - type: nauc_mrr_at_3_max value: 38.61018727252859 - type: nauc_mrr_at_3_std value: -13.123989867364166 - type: nauc_mrr_at_5_diff1 value: 53.037110010188 - type: nauc_mrr_at_5_max value: 38.44770729849151 - type: nauc_mrr_at_5_std value: -13.49318771828972 - type: nauc_ndcg_at_1000_diff1 value: 44.73813840091289 - type: nauc_ndcg_at_1000_max value: 33.70113904685389 - type: nauc_ndcg_at_1000_std value: -10.328687058192742 - type: nauc_ndcg_at_100_diff1 value: 44.595174119928835 - type: nauc_ndcg_at_100_max value: 33.4788285112467 - type: nauc_ndcg_at_100_std value: -8.695355259716946 - type: nauc_ndcg_at_10_diff1 value: 44.39837225263 - type: nauc_ndcg_at_10_max value: 29.188289725593393 - type: nauc_ndcg_at_10_std value: -13.67608323673103 - type: nauc_ndcg_at_1_diff1 value: 55.52626805861546 - type: nauc_ndcg_at_1_max value: 40.49306809164979 - type: nauc_ndcg_at_1_std value: -12.886607701317681 - type: nauc_ndcg_at_20_diff1 value: 44.24661739902305 - type: nauc_ndcg_at_20_max value: 31.667868318249965 - type: nauc_ndcg_at_20_std value: -10.65470780066342 - type: nauc_ndcg_at_3_diff1 value: 43.39857166975522 - type: nauc_ndcg_at_3_max value: 31.764668313577495 - type: nauc_ndcg_at_3_std value: -14.494866954678152 - type: nauc_ndcg_at_5_diff1 value: 43.16976647347281 - type: nauc_ndcg_at_5_max value: 29.878329062643143 - type: nauc_ndcg_at_5_std value: -13.987689089179739 - type: nauc_precision_at_1000_diff1 value: -9.807973252625484 - type: nauc_precision_at_1000_max value: 26.6279603849494 - type: nauc_precision_at_1000_std value: 7.113187103520632 - type: nauc_precision_at_100_diff1 value: -4.777149603323976 - type: nauc_precision_at_100_max value: 31.03410463692187 - type: nauc_precision_at_100_std value: 10.463144150275435 - type: nauc_precision_at_10_diff1 value: 8.691528703215962 - type: nauc_precision_at_10_max value: 33.329579434123374 - type: nauc_precision_at_10_std value: -0.8002015226329403 - type: nauc_precision_at_1_diff1 value: 55.52626805861546 - type: nauc_precision_at_1_max value: 40.49306809164979 - type: nauc_precision_at_1_std value: -12.886607701317681 - type: nauc_precision_at_20_diff1 value: 3.4564653474184284 - type: nauc_precision_at_20_max value: 34.401070158471136 - type: nauc_precision_at_20_std value: 5.813431200164549 - type: nauc_precision_at_3_diff1 value: 22.463219705462187 - type: nauc_precision_at_3_max value: 34.77413976546924 - type: nauc_precision_at_3_std value: -7.083890789741479 - type: nauc_precision_at_5_diff1 value: 14.011006004883154 - type: nauc_precision_at_5_max value: 35.73655466853702 - type: nauc_precision_at_5_std value: -2.8395172077771598 - type: nauc_recall_at_1000_diff1 value: 16.478046357391555 - type: nauc_recall_at_1000_max value: 43.231704288282344 - type: nauc_recall_at_1000_std value: 38.430684937573645 - type: nauc_recall_at_100_diff1 value: 30.764718344602436 - type: nauc_recall_at_100_max value: 31.769050487166655 - type: nauc_recall_at_100_std value: 23.48468311677149 - type: nauc_recall_at_10_diff1 value: 34.47339565324045 - type: nauc_recall_at_10_max value: 19.054212335800454 - type: nauc_recall_at_10_std value: -11.039734015330437 - type: nauc_recall_at_1_diff1 value: 47.705150227211725 - type: nauc_recall_at_1_max value: 15.354189686550129 - type: nauc_recall_at_1_std value: -14.559819859039067 - type: nauc_recall_at_20_diff1 value: 32.1011474016873 - type: nauc_recall_at_20_max value: 25.546372988304423 - type: nauc_recall_at_20_std value: -0.007233471152482897 - type: nauc_recall_at_3_diff1 value: 37.5708138019065 - type: nauc_recall_at_3_max value: 16.66410785756736 - type: nauc_recall_at_3_std value: -15.404817020108966 - type: nauc_recall_at_5_diff1 value: 35.714519648479595 - type: nauc_recall_at_5_max value: 19.02075233009296 - type: nauc_recall_at_5_std value: -13.180963359760725 - type: ndcg_at_1 value: 55.556000000000004 - type: ndcg_at_10 value: 56.056 - type: ndcg_at_100 value: 62.44 - type: ndcg_at_1000 value: 64.263 - type: ndcg_at_20 value: 58.638999999999996 - type: ndcg_at_3 value: 51.722 - type: ndcg_at_5 value: 52.701 - type: precision_at_1 value: 55.556000000000004 - type: precision_at_10 value: 15.679000000000002 - type: precision_at_100 value: 2.252 - type: precision_at_1000 value: 0.257 - type: precision_at_20 value: 9.02 - type: precision_at_3 value: 34.619 - type: precision_at_5 value: 25.093 - type: recall_at_1 value: 28.666000000000004 - type: recall_at_10 value: 63.717999999999996 - type: recall_at_100 value: 86.938 - type: recall_at_1000 value: 97.603 - type: recall_at_20 value: 71.649 - type: recall_at_3 value: 46.663 - type: recall_at_5 value: 53.313 task: type: Retrieval - dataset: config: default name: MTEB HotpotQA revision: ab518f4d6fcca38d87c25209f94beba119d02014 split: test type: mteb/hotpotqa metrics: - type: main_score value: 71.74199999999999 - type: map_at_1 value: 41.729 - type: map_at_10 value: 63.168 - type: map_at_100 value: 64.132 - type: map_at_1000 value: 64.199 - type: map_at_20 value: 63.736000000000004 - type: map_at_3 value: 59.826 - type: map_at_5 value: 61.882000000000005 - type: mrr_at_1 value: 83.45712356515868 - type: mrr_at_10 value: 87.850342432719 - type: mrr_at_100 value: 88.0016320691113 - type: mrr_at_1000 value: 88.00576596968136 - type: mrr_at_20 value: 87.94463253190389 - type: mrr_at_3 value: 87.13706954760278 - type: mrr_at_5 value: 87.59419311276136 - type: nauc_map_at_1000_diff1 value: 13.635446621095054 - type: nauc_map_at_1000_max value: 18.670632529445633 - type: nauc_map_at_1000_std value: 10.444842636150575 - type: nauc_map_at_100_diff1 value: 13.599262398010783 - type: nauc_map_at_100_max value: 18.636389405484806 - type: nauc_map_at_100_std value: 10.460027483576043 - type: nauc_map_at_10_diff1 value: 13.235053919323942 - type: nauc_map_at_10_max value: 18.252140477080047 - type: nauc_map_at_10_std value: 9.9075337042203 - type: nauc_map_at_1_diff1 value: 76.51940497836482 - type: nauc_map_at_1_max value: 51.251419487235474 - type: nauc_map_at_1_std value: 0.16714896857146574 - type: nauc_map_at_20_diff1 value: 13.4178245722222 - type: nauc_map_at_20_max value: 18.40988771210718 - type: nauc_map_at_20_std value: 10.216685163366282 - type: nauc_map_at_3_diff1 value: 13.38370761663418 - type: nauc_map_at_3_max value: 17.760962555456537 - type: nauc_map_at_3_std value: 7.15741965624388 - type: nauc_map_at_5_diff1 value: 13.138133309724855 - type: nauc_map_at_5_max value: 17.871761295251044 - type: nauc_map_at_5_std value: 8.475147426940074 - type: nauc_mrr_at_1000_diff1 value: 75.82650818891959 - type: nauc_mrr_at_1000_max value: 53.6736100668434 - type: nauc_mrr_at_1000_std value: 1.8025016349213916 - type: nauc_mrr_at_100_diff1 value: 75.82530574210111 - type: nauc_mrr_at_100_max value: 53.68067545829002 - type: nauc_mrr_at_100_std value: 1.8147470536495791 - type: nauc_mrr_at_10_diff1 value: 75.8330135686799 - type: nauc_mrr_at_10_max value: 53.78626885349077 - type: nauc_mrr_at_10_std value: 1.7975782717226636 - type: nauc_mrr_at_1_diff1 value: 76.51940497836482 - type: nauc_mrr_at_1_max value: 51.251419487235474 - type: nauc_mrr_at_1_std value: 0.16714896857146574 - type: nauc_mrr_at_20_diff1 value: 75.82783382464166 - type: nauc_mrr_at_20_max value: 53.68364567043885 - type: nauc_mrr_at_20_std value: 1.742037904463963 - type: nauc_mrr_at_3_diff1 value: 75.6944609768663 - type: nauc_mrr_at_3_max value: 53.803941340341666 - type: nauc_mrr_at_3_std value: 1.1849945458077804 - type: nauc_mrr_at_5_diff1 value: 75.73006960604903 - type: nauc_mrr_at_5_max value: 53.62223096420106 - type: nauc_mrr_at_5_std value: 1.6144067563410909 - type: nauc_ndcg_at_1000_diff1 value: 21.58025241642726 - type: nauc_ndcg_at_1000_max value: 24.675747527001153 - type: nauc_ndcg_at_1000_std value: 13.075943547492718 - type: nauc_ndcg_at_100_diff1 value: 20.30260137544846 - type: nauc_ndcg_at_100_max value: 23.757528813872018 - type: nauc_ndcg_at_100_std value: 13.648994687574062 - type: nauc_ndcg_at_10_diff1 value: 18.995052360997818 - type: nauc_ndcg_at_10_max value: 22.254260808196037 - type: nauc_ndcg_at_10_std value: 11.27212390633054 - type: nauc_ndcg_at_1_diff1 value: 76.51940497836482 - type: nauc_ndcg_at_1_max value: 51.251419487235474 - type: nauc_ndcg_at_1_std value: 0.16714896857146574 - type: nauc_ndcg_at_20_diff1 value: 19.333742380695757 - type: nauc_ndcg_at_20_max value: 22.527779834633364 - type: nauc_ndcg_at_20_std value: 12.161009000707917 - type: nauc_ndcg_at_3_diff1 value: 20.013329040965534 - type: nauc_ndcg_at_3_max value: 21.99692460311921 - type: nauc_ndcg_at_3_std value: 6.8076290638386165 - type: nauc_ndcg_at_5_diff1 value: 19.08226315942471 - type: nauc_ndcg_at_5_max value: 21.71185964294168 - type: nauc_ndcg_at_5_std value: 8.671911269518214 - type: nauc_precision_at_1000_diff1 value: 2.4462475489446764 - type: nauc_precision_at_1000_max value: 29.145662064268578 - type: nauc_precision_at_1000_std value: 49.20704909525856 - type: nauc_precision_at_100_diff1 value: 0.11271196725540299 - type: nauc_precision_at_100_max value: 17.37584606388067 - type: nauc_precision_at_100_std value: 34.66099346244071 - type: nauc_precision_at_10_diff1 value: 2.9923183951227825 - type: nauc_precision_at_10_max value: 14.261884731124264 - type: nauc_precision_at_10_std value: 18.084188795498378 - type: nauc_precision_at_1_diff1 value: 76.51940497836482 - type: nauc_precision_at_1_max value: 51.251419487235474 - type: nauc_precision_at_1_std value: 0.16714896857146574 - type: nauc_precision_at_20_diff1 value: 1.9180293008303761 - type: nauc_precision_at_20_max value: 13.832269193468512 - type: nauc_precision_at_20_std value: 21.65284406055607 - type: nauc_precision_at_3_diff1 value: 7.226609484731811 - type: nauc_precision_at_3_max value: 15.162908526977272 - type: nauc_precision_at_3_std value: 8.451859972962776 - type: nauc_precision_at_5_diff1 value: 4.705236845538159 - type: nauc_precision_at_5_max value: 14.022910843582666 - type: nauc_precision_at_5_std value: 11.777269322821605 - type: nauc_recall_at_1000_diff1 value: 2.446247548945172 - type: nauc_recall_at_1000_max value: 29.14566206426889 - type: nauc_recall_at_1000_std value: 49.20704909525879 - type: nauc_recall_at_100_diff1 value: 0.1127119672553316 - type: nauc_recall_at_100_max value: 17.37584606388062 - type: nauc_recall_at_100_std value: 34.660993462440686 - type: nauc_recall_at_10_diff1 value: 2.9923183951227927 - type: nauc_recall_at_10_max value: 14.261884731124299 - type: nauc_recall_at_10_std value: 18.08418879549837 - type: nauc_recall_at_1_diff1 value: 76.51940497836482 - type: nauc_recall_at_1_max value: 51.251419487235474 - type: nauc_recall_at_1_std value: 0.16714896857146574 - type: nauc_recall_at_20_diff1 value: 1.918029300830432 - type: nauc_recall_at_20_max value: 13.832269193468566 - type: nauc_recall_at_20_std value: 21.65284406055605 - type: nauc_recall_at_3_diff1 value: 7.226609484731802 - type: nauc_recall_at_3_max value: 15.162908526977182 - type: nauc_recall_at_3_std value: 8.451859972962634 - type: nauc_recall_at_5_diff1 value: 4.705236845538197 - type: nauc_recall_at_5_max value: 14.02291084358265 - type: nauc_recall_at_5_std value: 11.777269322821638 - type: ndcg_at_1 value: 83.45700000000001 - type: ndcg_at_10 value: 71.74199999999999 - type: ndcg_at_100 value: 75.008 - type: ndcg_at_1000 value: 76.242 - type: ndcg_at_20 value: 73.114 - type: ndcg_at_3 value: 67.128 - type: ndcg_at_5 value: 69.645 - type: precision_at_1 value: 83.45700000000001 - type: precision_at_10 value: 14.747 - type: precision_at_100 value: 1.73 - type: precision_at_1000 value: 0.189 - type: precision_at_20 value: 7.8149999999999995 - type: precision_at_3 value: 42.323 - type: precision_at_5 value: 27.381 - type: recall_at_1 value: 41.729 - type: recall_at_10 value: 73.734 - type: recall_at_100 value: 86.502 - type: recall_at_1000 value: 94.60499999999999 - type: recall_at_20 value: 78.14999999999999 - type: recall_at_3 value: 63.483999999999995 - type: recall_at_5 value: 68.45400000000001 task: type: Retrieval - dataset: config: default name: MTEB ImdbClassification revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 split: test type: mteb/imdb metrics: - type: accuracy value: 96.4904 - type: ap value: 94.85481918794709 - type: ap_weighted value: 94.85481918794709 - type: f1 value: 96.4898592305707 - type: f1_weighted value: 96.4898592305707 - type: main_score value: 96.4904 task: type: Classification - dataset: config: default name: MTEB MSMARCO revision: c5a29a104738b98a9e76336939199e264163d4a0 split: dev type: mteb/msmarco metrics: - type: main_score value: 43.692 - type: map_at_1 value: 23.751 - type: map_at_10 value: 36.553999999999995 - type: map_at_100 value: 37.721 - type: map_at_1000 value: 37.763999999999996 - type: map_at_20 value: 37.289 - type: map_at_3 value: 32.643 - type: map_at_5 value: 34.851 - type: mrr_at_1 value: 24.455587392550143 - type: mrr_at_10 value: 37.18388706963206 - type: mrr_at_100 value: 38.28330737932916 - type: mrr_at_1000 value: 38.32054399710817 - type: mrr_at_20 value: 37.8818001216278 - type: mrr_at_3 value: 33.35721107927405 - type: mrr_at_5 value: 35.52483285577843 - type: nauc_map_at_1000_diff1 value: 36.3576177260684 - type: nauc_map_at_1000_max value: 7.854511605962703 - type: nauc_map_at_1000_std value: -17.701121059746878 - type: nauc_map_at_100_diff1 value: 36.356075649230505 - type: nauc_map_at_100_max value: 7.862168042999533 - type: nauc_map_at_100_std value: -17.670102459097233 - type: nauc_map_at_10_diff1 value: 36.22122978875574 - type: nauc_map_at_10_max value: 7.80848606967416 - type: nauc_map_at_10_std value: -18.3265151386167 - type: nauc_map_at_1_diff1 value: 39.28605466408357 - type: nauc_map_at_1_max value: 6.20202977590459 - type: nauc_map_at_1_std value: -15.734334090045026 - type: nauc_map_at_20_diff1 value: 36.33637880909657 - type: nauc_map_at_20_max value: 7.843437969476022 - type: nauc_map_at_20_std value: -17.917533363025996 - type: nauc_map_at_3_diff1 value: 36.24864976076741 - type: nauc_map_at_3_max value: 7.420345251835957 - type: nauc_map_at_3_std value: -18.71678497722944 - type: nauc_map_at_5_diff1 value: 36.0789619291824 - type: nauc_map_at_5_max value: 7.7314285669514495 - type: nauc_map_at_5_std value: -18.748688764538706 - type: nauc_mrr_at_1000_diff1 value: 36.23912675623378 - type: nauc_mrr_at_1000_max value: 7.690553436255147 - type: nauc_mrr_at_1000_std value: -17.609526070212304 - type: nauc_mrr_at_100_diff1 value: 36.23782651189002 - type: nauc_mrr_at_100_max value: 7.70075095171647 - type: nauc_mrr_at_100_std value: -17.575714144960184 - type: nauc_mrr_at_10_diff1 value: 36.125229472534215 - type: nauc_mrr_at_10_max value: 7.635472248755658 - type: nauc_mrr_at_10_std value: -18.208166616511086 - type: nauc_mrr_at_1_diff1 value: 39.20986875554532 - type: nauc_mrr_at_1_max value: 6.062668487561363 - type: nauc_mrr_at_1_std value: -16.04130340817602 - type: nauc_mrr_at_20_diff1 value: 36.21207088739667 - type: nauc_mrr_at_20_max value: 7.699610250145951 - type: nauc_mrr_at_20_std value: -17.778245221724028 - type: nauc_mrr_at_3_diff1 value: 36.03957583885305 - type: nauc_mrr_at_3_max value: 7.225515576504581 - type: nauc_mrr_at_3_std value: -18.74478742943741 - type: nauc_mrr_at_5_diff1 value: 35.969152496648974 - type: nauc_mrr_at_5_max value: 7.584059789018233 - type: nauc_mrr_at_5_std value: -18.569374723129332 - type: nauc_ndcg_at_1000_diff1 value: 35.894655529841806 - type: nauc_ndcg_at_1000_max value: 8.579327424366236 - type: nauc_ndcg_at_1000_std value: -16.359677367747896 - type: nauc_ndcg_at_100_diff1 value: 35.89861902483983 - type: nauc_ndcg_at_100_max value: 8.830873623962242 - type: nauc_ndcg_at_100_std value: -15.173125564722978 - type: nauc_ndcg_at_10_diff1 value: 35.36499811105169 - type: nauc_ndcg_at_10_max value: 8.449267180956992 - type: nauc_ndcg_at_10_std value: -18.41978802362402 - type: nauc_ndcg_at_1_diff1 value: 39.15422481210622 - type: nauc_ndcg_at_1_max value: 6.055515791928331 - type: nauc_ndcg_at_1_std value: -16.042779610876252 - type: nauc_ndcg_at_20_diff1 value: 35.73402868264468 - type: nauc_ndcg_at_20_max value: 8.695705518210847 - type: nauc_ndcg_at_20_std value: -16.7735829470466 - type: nauc_ndcg_at_3_diff1 value: 35.31358242856231 - type: nauc_ndcg_at_3_max value: 7.645692789058997 - type: nauc_ndcg_at_3_std value: -19.460003734786874 - type: nauc_ndcg_at_5_diff1 value: 35.05216588927143 - type: nauc_ndcg_at_5_max value: 8.216690520604715 - type: nauc_ndcg_at_5_std value: -19.3982054492159 - type: nauc_precision_at_1000_diff1 value: -4.440002625111349 - type: nauc_precision_at_1000_max value: 7.886988951901723 - type: nauc_precision_at_1000_std value: 9.88111187048247 - type: nauc_precision_at_100_diff1 value: 15.728286119463325 - type: nauc_precision_at_100_max value: 13.218650824470654 - type: nauc_precision_at_100_std value: 16.113245895522553 - type: nauc_precision_at_10_diff1 value: 29.51218489610567 - type: nauc_precision_at_10_max value: 10.197432401942912 - type: nauc_precision_at_10_std value: -16.950603431359493 - type: nauc_precision_at_1_diff1 value: 39.15422481210622 - type: nauc_precision_at_1_max value: 6.055515791928331 - type: nauc_precision_at_1_std value: -16.042779610876252 - type: nauc_precision_at_20_diff1 value: 27.825993070397338 - type: nauc_precision_at_20_max value: 11.437632287846007 - type: nauc_precision_at_20_std value: -7.450353566405601 - type: nauc_precision_at_3_diff1 value: 32.14135556796588 - type: nauc_precision_at_3_max value: 7.989252443574163 - type: nauc_precision_at_3_std value: -21.566254595671055 - type: nauc_precision_at_5_diff1 value: 30.68778685307082 - type: nauc_precision_at_5_max value: 9.332160758499892 - type: nauc_precision_at_5_std value: -20.928554713448914 - type: nauc_recall_at_1000_diff1 value: 25.00810478716878 - type: nauc_recall_at_1000_max value: 46.518165765201644 - type: nauc_recall_at_1000_std value: 61.4734635576085 - type: nauc_recall_at_100_diff1 value: 33.895581318261726 - type: nauc_recall_at_100_max value: 20.10706035872801 - type: nauc_recall_at_100_std value: 24.204226584457047 - type: nauc_recall_at_10_diff1 value: 32.363127359576296 - type: nauc_recall_at_10_max value: 10.729923804989545 - type: nauc_recall_at_10_std value: -18.1335370184202 - type: nauc_recall_at_1_diff1 value: 39.28605466408357 - type: nauc_recall_at_1_max value: 6.20202977590459 - type: nauc_recall_at_1_std value: -15.734334090045026 - type: nauc_recall_at_20_diff1 value: 33.47804003169795 - type: nauc_recall_at_20_max value: 12.781494765263382 - type: nauc_recall_at_20_std value: -9.263970132202658 - type: nauc_recall_at_3_diff1 value: 32.71001429428999 - type: nauc_recall_at_3_max value: 8.353439197382693 - type: nauc_recall_at_3_std value: -21.235097744366954 - type: nauc_recall_at_5_diff1 value: 31.87451464963415 - type: nauc_recall_at_5_max value: 9.635051450907305 - type: nauc_recall_at_5_std value: -21.113235357132794 - type: ndcg_at_1 value: 24.47 - type: ndcg_at_10 value: 43.692 - type: ndcg_at_100 value: 49.211 - type: ndcg_at_1000 value: 50.244 - type: ndcg_at_20 value: 46.278000000000006 - type: ndcg_at_3 value: 35.719 - type: ndcg_at_5 value: 39.652 - type: precision_at_1 value: 24.47 - type: precision_at_10 value: 6.857 - type: precision_at_100 value: 0.9610000000000001 - type: precision_at_1000 value: 0.105 - type: precision_at_20 value: 3.968 - type: precision_at_3 value: 15.181000000000001 - type: precision_at_5 value: 11.117 - type: recall_at_1 value: 23.751 - type: recall_at_10 value: 65.64 - type: recall_at_100 value: 90.967 - type: recall_at_1000 value: 98.738 - type: recall_at_20 value: 75.639 - type: recall_at_3 value: 43.927 - type: recall_at_5 value: 53.366 task: type: Retrieval - dataset: config: en name: MTEB MTOPDomainClassification (en) revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf split: test type: mteb/mtop_domain metrics: - type: accuracy value: 98.82580939352485 - type: f1 value: 98.75201754333801 - type: f1_weighted value: 98.82795205108245 - type: main_score value: 98.82580939352485 task: type: Classification - dataset: config: en name: MTEB MTOPIntentClassification (en) revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba split: test type: mteb/mtop_intent metrics: - type: accuracy value: 92.29822161422709 - type: f1 value: 77.75210224871594 - type: f1_weighted value: 93.58661422540348 - type: main_score value: 92.29822161422709 task: type: Classification - dataset: config: en name: MTEB MassiveIntentClassification (en) revision: 4672e20407010da34463acc759c162ca9734bca6 split: test type: mteb/amazon_massive_intent metrics: - type: accuracy value: 85.17484868863484 - type: f1 value: 81.94484244487094 - type: f1_weighted value: 85.21022593423332 - type: main_score value: 85.17484868863484 task: type: Classification - dataset: config: en name: MTEB MassiveScenarioClassification (en) revision: fad2c6e8459f9e1c45d9315f4953d921437d70f8 split: test type: mteb/amazon_massive_scenario metrics: - type: accuracy value: 89.61667787491594 - type: f1 value: 89.02701927621264 - type: f1_weighted value: 89.56306982022801 - type: main_score value: 89.61667787491594 task: type: Classification - dataset: config: default name: MTEB MedrxivClusteringP2P revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 split: test type: mteb/medrxiv-clustering-p2p metrics: - type: main_score value: 46.318282423948574 - type: v_measure value: 46.318282423948574 - type: v_measure_std value: 0.9729055662461538 task: type: Clustering - dataset: config: default name: MTEB MedrxivClusteringS2S revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 split: test type: mteb/medrxiv-clustering-s2s metrics: - type: main_score value: 44.29033625273981 - type: v_measure value: 44.29033625273981 - type: v_measure_std value: 1.0596383629128594 task: type: Clustering - dataset: config: default name: MTEB MindSmallReranking revision: 59042f120c80e8afa9cdbb224f67076cec0fc9a7 split: test type: mteb/mind_small metrics: - type: main_score value: 33.0526129239962 - type: map value: 33.0526129239962 - type: mrr value: 34.29260046890935 - type: nAUC_map_diff1 value: 12.579738077238032 - type: nAUC_map_max value: -20.936629344962 - type: nAUC_map_std value: -1.6096805784945216 - type: nAUC_mrr_diff1 value: 11.597584463580807 - type: nAUC_mrr_max value: -15.723702838537504 - type: nAUC_mrr_std value: 0.2719172965777737 task: type: Reranking - dataset: config: default name: MTEB NFCorpus revision: ec0fa4fe99da2ff19ca1214b7966684033a58814 split: test type: mteb/nfcorpus metrics: - type: main_score value: 41.486000000000004 - type: map_at_1 value: 6.866 - type: map_at_10 value: 15.895999999999999 - type: map_at_100 value: 21.093 - type: map_at_1000 value: 23.067 - type: map_at_20 value: 18.125 - type: map_at_3 value: 11.421000000000001 - type: map_at_5 value: 13.415 - type: mrr_at_1 value: 52.63157894736842 - type: mrr_at_10 value: 61.486805248415166 - type: mrr_at_100 value: 62.08211009182091 - type: mrr_at_1000 value: 62.10828701365016 - type: mrr_at_20 value: 61.904411187915784 - type: mrr_at_3 value: 59.90712074303407 - type: mrr_at_5 value: 60.91331269349847 - type: nauc_map_at_1000_diff1 value: 25.484625278529403 - type: nauc_map_at_1000_max value: 31.206600396418853 - type: nauc_map_at_1000_std value: 15.569448072357156 - type: nauc_map_at_100_diff1 value: 27.636750226316764 - type: nauc_map_at_100_max value: 29.66992681250722 - type: nauc_map_at_100_std value: 10.570600484002671 - type: nauc_map_at_10_diff1 value: 32.76642525548697 - type: nauc_map_at_10_max value: 21.459225397237663 - type: nauc_map_at_10_std value: -3.546494734209264 - type: nauc_map_at_1_diff1 value: 48.8002894871328 - type: nauc_map_at_1_max value: 5.7236722609868815 - type: nauc_map_at_1_std value: -13.283554044471352 - type: nauc_map_at_20_diff1 value: 30.57169701502308 - type: nauc_map_at_20_max value: 25.79666139518404 - type: nauc_map_at_20_std value: 1.781732492989651 - type: nauc_map_at_3_diff1 value: 40.076315947201095 - type: nauc_map_at_3_max value: 12.862524429140054 - type: nauc_map_at_3_std value: -9.188349777126817 - type: nauc_map_at_5_diff1 value: 36.9918718052938 - type: nauc_map_at_5_max value: 16.74234374361876 - type: nauc_map_at_5_std value: -7.818523349307494 - type: nauc_mrr_at_1000_diff1 value: 26.88183002609805 - type: nauc_mrr_at_1000_max value: 47.10209348428658 - type: nauc_mrr_at_1000_std value: 32.067825924992924 - type: nauc_mrr_at_100_diff1 value: 26.871482491566745 - type: nauc_mrr_at_100_max value: 47.11303868498556 - type: nauc_mrr_at_100_std value: 32.08961428818868 - type: nauc_mrr_at_10_diff1 value: 26.6356914977722 - type: nauc_mrr_at_10_max value: 47.091624558810366 - type: nauc_mrr_at_10_std value: 31.942424120660164 - type: nauc_mrr_at_1_diff1 value: 28.19774198483673 - type: nauc_mrr_at_1_max value: 41.44380927834253 - type: nauc_mrr_at_1_std value: 25.18222691885917 - type: nauc_mrr_at_20_diff1 value: 26.86487347109452 - type: nauc_mrr_at_20_max value: 47.1987778214726 - type: nauc_mrr_at_20_std value: 32.143517921610034 - type: nauc_mrr_at_3_diff1 value: 27.34340373236422 - type: nauc_mrr_at_3_max value: 46.358726506276646 - type: nauc_mrr_at_3_std value: 31.74924155572593 - type: nauc_mrr_at_5_diff1 value: 27.209667205060672 - type: nauc_mrr_at_5_max value: 46.79883369072009 - type: nauc_mrr_at_5_std value: 31.655605306670758 - type: nauc_ndcg_at_1000_diff1 value: 18.940195769769687 - type: nauc_ndcg_at_1000_max value: 46.48551313937331 - type: nauc_ndcg_at_1000_std value: 33.64819502089232 - type: nauc_ndcg_at_100_diff1 value: 19.50885253809146 - type: nauc_ndcg_at_100_max value: 40.53174462354878 - type: nauc_ndcg_at_100_std value: 28.516152877751118 - type: nauc_ndcg_at_10_diff1 value: 16.01699218096564 - type: nauc_ndcg_at_10_max value: 41.17322878314514 - type: nauc_ndcg_at_10_std value: 29.002233224832196 - type: nauc_ndcg_at_1_diff1 value: 27.443547710102205 - type: nauc_ndcg_at_1_max value: 40.66529763309582 - type: nauc_ndcg_at_1_std value: 24.15016766225869 - type: nauc_ndcg_at_20_diff1 value: 17.541197675685062 - type: nauc_ndcg_at_20_max value: 40.53231266973844 - type: nauc_ndcg_at_20_std value: 29.54096347876548 - type: nauc_ndcg_at_3_diff1 value: 18.649628357473716 - type: nauc_ndcg_at_3_max value: 41.18603570171764 - type: nauc_ndcg_at_3_std value: 27.125524188420396 - type: nauc_ndcg_at_5_diff1 value: 17.519593751448483 - type: nauc_ndcg_at_5_max value: 42.715997890377345 - type: nauc_ndcg_at_5_std value: 27.902627839899868 - type: nauc_precision_at_1000_diff1 value: -15.528797630565155 - type: nauc_precision_at_1000_max value: 13.741640921778671 - type: nauc_precision_at_1000_std value: 44.50896053788372 - type: nauc_precision_at_100_diff1 value: -14.491464489721887 - type: nauc_precision_at_100_max value: 23.136434418999457 - type: nauc_precision_at_100_std value: 49.73145147863128 - type: nauc_precision_at_10_diff1 value: -4.829188942994277 - type: nauc_precision_at_10_max value: 40.327612559528866 - type: nauc_precision_at_10_std value: 39.34919529635044 - type: nauc_precision_at_1_diff1 value: 28.19774198483673 - type: nauc_precision_at_1_max value: 41.44380927834253 - type: nauc_precision_at_1_std value: 25.18222691885917 - type: nauc_precision_at_20_diff1 value: -7.210726293112847 - type: nauc_precision_at_20_max value: 37.195679576636984 - type: nauc_precision_at_20_std value: 45.4597096418357 - type: nauc_precision_at_3_diff1 value: 7.578219537774854 - type: nauc_precision_at_3_max value: 41.59775233475654 - type: nauc_precision_at_3_std value: 30.764584790895118 - type: nauc_precision_at_5_diff1 value: 1.655451789039598 - type: nauc_precision_at_5_max value: 43.435739407610455 - type: nauc_precision_at_5_std value: 33.42552263325999 - type: nauc_recall_at_1000_diff1 value: 5.030705700690516 - type: nauc_recall_at_1000_max value: 19.108072570815583 - type: nauc_recall_at_1000_std value: 14.697734974217308 - type: nauc_recall_at_100_diff1 value: 14.746540318132407 - type: nauc_recall_at_100_max value: 21.798705033854795 - type: nauc_recall_at_100_std value: 11.416195108842587 - type: nauc_recall_at_10_diff1 value: 25.548642427860486 - type: nauc_recall_at_10_max value: 18.711677681987474 - type: nauc_recall_at_10_std value: -5.988904818971677 - type: nauc_recall_at_1_diff1 value: 48.8002894871328 - type: nauc_recall_at_1_max value: 5.7236722609868815 - type: nauc_recall_at_1_std value: -13.283554044471352 - type: nauc_recall_at_20_diff1 value: 23.39140739154809 - type: nauc_recall_at_20_max value: 19.351150636155474 - type: nauc_recall_at_20_std value: -2.757280266915132 - type: nauc_recall_at_3_diff1 value: 38.17453576012812 - type: nauc_recall_at_3_max value: 13.47003839643972 - type: nauc_recall_at_3_std value: -8.75780163862688 - type: nauc_recall_at_5_diff1 value: 33.02812855226899 - type: nauc_recall_at_5_max value: 15.477626408978477 - type: nauc_recall_at_5_std value: -9.072206441070708 - type: ndcg_at_1 value: 50.773999999999994 - type: ndcg_at_10 value: 41.486000000000004 - type: ndcg_at_100 value: 39.051 - type: ndcg_at_1000 value: 48.106 - type: ndcg_at_20 value: 39.432 - type: ndcg_at_3 value: 47.428 - type: ndcg_at_5 value: 45.227000000000004 - type: precision_at_1 value: 52.632 - type: precision_at_10 value: 31.146 - type: precision_at_100 value: 10.328 - type: precision_at_1000 value: 2.432 - type: precision_at_20 value: 23.793 - type: precision_at_3 value: 45.201 - type: precision_at_5 value: 39.876 - type: recall_at_1 value: 6.866 - type: recall_at_10 value: 20.447000000000003 - type: recall_at_100 value: 40.607 - type: recall_at_1000 value: 73.411 - type: recall_at_20 value: 26.082 - type: recall_at_3 value: 12.484 - type: recall_at_5 value: 15.847 task: type: Retrieval - dataset: config: default name: MTEB NQ revision: b774495ed302d8c44a3a7ea25c90dbce03968f31 split: test type: mteb/nq metrics: - type: main_score value: 69.072 - type: map_at_1 value: 45.483000000000004 - type: map_at_10 value: 62.050000000000004 - type: map_at_100 value: 62.693 - type: map_at_1000 value: 62.702999999999996 - type: map_at_20 value: 62.498 - type: map_at_3 value: 58.285 - type: map_at_5 value: 60.711000000000006 - type: mrr_at_1 value: 50.840092699884124 - type: mrr_at_10 value: 64.54635224116673 - type: mrr_at_100 value: 64.9526548702289 - type: mrr_at_1000 value: 64.95908460752281 - type: mrr_at_20 value: 64.82949565799959 - type: mrr_at_3 value: 61.89165701042856 - type: mrr_at_5 value: 63.632676709154026 - type: nauc_map_at_1000_diff1 value: 43.187285304185224 - type: nauc_map_at_1000_max value: 32.39921659632756 - type: nauc_map_at_1000_std value: -5.780901333066553 - type: nauc_map_at_100_diff1 value: 43.184487221204456 - type: nauc_map_at_100_max value: 32.41176116347982 - type: nauc_map_at_100_std value: -5.76422606662383 - type: nauc_map_at_10_diff1 value: 42.967066814031746 - type: nauc_map_at_10_max value: 32.489617364418514 - type: nauc_map_at_10_std value: -6.029045531102664 - type: nauc_map_at_1_diff1 value: 46.16376563218624 - type: nauc_map_at_1_max value: 26.342624776802232 - type: nauc_map_at_1_std value: -7.142171388751972 - type: nauc_map_at_20_diff1 value: 43.15894358608328 - type: nauc_map_at_20_max value: 32.46492198956245 - type: nauc_map_at_20_std value: -5.788373305449195 - type: nauc_map_at_3_diff1 value: 43.231752344608545 - type: nauc_map_at_3_max value: 31.68003009949564 - type: nauc_map_at_3_std value: -8.015235132765458 - type: nauc_map_at_5_diff1 value: 42.86197608819917 - type: nauc_map_at_5_max value: 32.363857571094485 - type: nauc_map_at_5_std value: -6.780487416387977 - type: nauc_mrr_at_1000_diff1 value: 43.40542912045782 - type: nauc_mrr_at_1000_max value: 32.8461770324533 - type: nauc_mrr_at_1000_std value: -3.6505425530008204 - type: nauc_mrr_at_100_diff1 value: 43.40233508014468 - type: nauc_mrr_at_100_max value: 32.85598538385942 - type: nauc_mrr_at_100_std value: -3.637477352635459 - type: nauc_mrr_at_10_diff1 value: 43.260179162806054 - type: nauc_mrr_at_10_max value: 32.942643527040474 - type: nauc_mrr_at_10_std value: -3.712052825320437 - type: nauc_mrr_at_1_diff1 value: 46.354919460881206 - type: nauc_mrr_at_1_max value: 29.1760258591106 - type: nauc_mrr_at_1_std value: -4.107225031227406 - type: nauc_mrr_at_20_diff1 value: 43.37092385434311 - type: nauc_mrr_at_20_max value: 32.93390254712846 - type: nauc_mrr_at_20_std value: -3.5719056112132006 - type: nauc_mrr_at_3_diff1 value: 43.1744474040527 - type: nauc_mrr_at_3_max value: 32.741290559777994 - type: nauc_mrr_at_3_std value: -4.72677925120697 - type: nauc_mrr_at_5_diff1 value: 43.108396819975674 - type: nauc_mrr_at_5_max value: 32.970519514893084 - type: nauc_mrr_at_5_std value: -4.090906158975974 - type: nauc_ndcg_at_1000_diff1 value: 42.786664193638714 - type: nauc_ndcg_at_1000_max value: 33.65554095609296 - type: nauc_ndcg_at_1000_std value: -4.024030130584482 - type: nauc_ndcg_at_100_diff1 value: 42.691246775210814 - type: nauc_ndcg_at_100_max value: 34.063232335110875 - type: nauc_ndcg_at_100_std value: -3.477813807415248 - type: nauc_ndcg_at_10_diff1 value: 41.90988990571757 - type: nauc_ndcg_at_10_max value: 34.58934812881633 - type: nauc_ndcg_at_10_std value: -4.3295110195497655 - type: nauc_ndcg_at_1_diff1 value: 46.354919460881206 - type: nauc_ndcg_at_1_max value: 29.1760258591106 - type: nauc_ndcg_at_1_std value: -4.107225031227406 - type: nauc_ndcg_at_20_diff1 value: 42.493206675867114 - type: nauc_ndcg_at_20_max value: 34.562441307459544 - type: nauc_ndcg_at_20_std value: -3.4456116866749107 - type: nauc_ndcg_at_3_diff1 value: 42.24180336502808 - type: nauc_ndcg_at_3_max value: 33.064267018100594 - type: nauc_ndcg_at_3_std value: -7.786248093572142 - type: nauc_ndcg_at_5_diff1 value: 41.692714787779565 - type: nauc_ndcg_at_5_max value: 34.20502498949156 - type: nauc_ndcg_at_5_std value: -5.979557859282785 - type: nauc_precision_at_1000_diff1 value: -13.779832506640702 - type: nauc_precision_at_1000_max value: 1.243001688631421 - type: nauc_precision_at_1000_std value: 17.351623398622323 - type: nauc_precision_at_100_diff1 value: -11.310526816290297 - type: nauc_precision_at_100_max value: 5.771669506192959 - type: nauc_precision_at_100_std value: 19.917795079540113 - type: nauc_precision_at_10_diff1 value: 2.163699384635286 - type: nauc_precision_at_10_max value: 19.66440698458386 - type: nauc_precision_at_10_std value: 13.689876348315726 - type: nauc_precision_at_1_diff1 value: 46.354919460881206 - type: nauc_precision_at_1_max value: 29.1760258591106 - type: nauc_precision_at_1_std value: -4.107225031227406 - type: nauc_precision_at_20_diff1 value: -3.038735879584471 - type: nauc_precision_at_20_max value: 14.132968299701695 - type: nauc_precision_at_20_std value: 17.78069734664346 - type: nauc_precision_at_3_diff1 value: 21.783760758070095 - type: nauc_precision_at_3_max value: 30.244127986404497 - type: nauc_precision_at_3_std value: -0.12411163467738723 - type: nauc_precision_at_5_diff1 value: 10.980635723302418 - type: nauc_precision_at_5_max value: 25.302293738975575 - type: nauc_precision_at_5_std value: 6.4740817488722024 - type: nauc_recall_at_1000_diff1 value: 34.10343772356593 - type: nauc_recall_at_1000_max value: 80.72497340357538 - type: nauc_recall_at_1000_std value: 69.54564103264093 - type: nauc_recall_at_100_diff1 value: 33.427719956774126 - type: nauc_recall_at_100_max value: 71.54086768335449 - type: nauc_recall_at_100_std value: 49.66157377654885 - type: nauc_recall_at_10_diff1 value: 33.70139560054039 - type: nauc_recall_at_10_max value: 45.47878072860151 - type: nauc_recall_at_10_std value: 1.4188516615716378 - type: nauc_recall_at_1_diff1 value: 46.16376563218624 - type: nauc_recall_at_1_max value: 26.342624776802232 - type: nauc_recall_at_1_std value: -7.142171388751972 - type: nauc_recall_at_20_diff1 value: 35.805379874970086 - type: nauc_recall_at_20_max value: 51.80479822253392 - type: nauc_recall_at_20_std value: 13.531467576460143 - type: nauc_recall_at_3_diff1 value: 37.288500141631616 - type: nauc_recall_at_3_max value: 35.07078243516728 - type: nauc_recall_at_3_std value: -10.452926441410405 - type: nauc_recall_at_5_diff1 value: 34.83186104526897 - type: nauc_recall_at_5_max value: 39.58488976496973 - type: nauc_recall_at_5_std value: -6.3049292065708835 - type: ndcg_at_1 value: 50.839999999999996 - type: ndcg_at_10 value: 69.072 - type: ndcg_at_100 value: 71.538 - type: ndcg_at_1000 value: 71.77799999999999 - type: ndcg_at_20 value: 70.41 - type: ndcg_at_3 value: 62.544999999999995 - type: ndcg_at_5 value: 66.33099999999999 - type: precision_at_1 value: 50.839999999999996 - type: precision_at_10 value: 10.495000000000001 - type: precision_at_100 value: 1.1900000000000002 - type: precision_at_1000 value: 0.121 - type: precision_at_20 value: 5.5809999999999995 - type: precision_at_3 value: 27.636 - type: precision_at_5 value: 18.864 - type: recall_at_1 value: 45.483000000000004 - type: recall_at_10 value: 87.483 - type: recall_at_100 value: 97.844 - type: recall_at_1000 value: 99.66199999999999 - type: recall_at_20 value: 92.294 - type: recall_at_3 value: 71.2 - type: recall_at_5 value: 79.753 task: type: Retrieval - dataset: config: default name: MTEB QuoraRetrieval revision: e4e08e0b7dbe3c8700f0daef558ff32256715259 split: test type: mteb/quora metrics: - type: main_score value: 89.58 - type: map_at_1 value: 71.819 - type: map_at_10 value: 86.04899999999999 - type: map_at_100 value: 86.648 - type: map_at_1000 value: 86.66199999999999 - type: map_at_20 value: 86.441 - type: map_at_3 value: 83.114 - type: map_at_5 value: 84.981 - type: mrr_at_1 value: 82.62 - type: mrr_at_10 value: 88.62899999999979 - type: mrr_at_100 value: 88.70918591324215 - type: mrr_at_1000 value: 88.70973091492397 - type: mrr_at_20 value: 88.68914765317221 - type: mrr_at_3 value: 87.74999999999979 - type: mrr_at_5 value: 88.36799999999974 - type: nauc_map_at_1000_diff1 value: 77.89207709760448 - type: nauc_map_at_1000_max value: 29.63371361495422 - type: nauc_map_at_1000_std value: -48.628180385874344 - type: nauc_map_at_100_diff1 value: 77.89592179104915 - type: nauc_map_at_100_max value: 29.617171506130756 - type: nauc_map_at_100_std value: -48.66057170774648 - type: nauc_map_at_10_diff1 value: 78.0618161228185 - type: nauc_map_at_10_max value: 29.178490609366737 - type: nauc_map_at_10_std value: -50.74755004592002 - type: nauc_map_at_1_diff1 value: 81.64335579973574 - type: nauc_map_at_1_max value: 21.813832226652174 - type: nauc_map_at_1_std value: -42.57570978190876 - type: nauc_map_at_20_diff1 value: 77.9299081005938 - type: nauc_map_at_20_max value: 29.458718470003888 - type: nauc_map_at_20_std value: -49.63337236763102 - type: nauc_map_at_3_diff1 value: 78.72941448509229 - type: nauc_map_at_3_max value: 26.600997896960056 - type: nauc_map_at_3_std value: -51.889002227479885 - type: nauc_map_at_5_diff1 value: 78.31466610917171 - type: nauc_map_at_5_max value: 28.09863984582896 - type: nauc_map_at_5_std value: -52.14058096096497 - type: nauc_mrr_at_1000_diff1 value: 78.42667263739992 - type: nauc_mrr_at_1000_max value: 31.98996235127974 - type: nauc_mrr_at_1000_std value: -44.380439148429296 - type: nauc_mrr_at_100_diff1 value: 78.42661032698115 - type: nauc_mrr_at_100_max value: 31.991652631740102 - type: nauc_mrr_at_100_std value: -44.37854108460535 - type: nauc_mrr_at_10_diff1 value: 78.39126022544136 - type: nauc_mrr_at_10_max value: 32.02023484451197 - type: nauc_mrr_at_10_std value: -44.561252349176954 - type: nauc_mrr_at_1_diff1 value: 79.21630894647448 - type: nauc_mrr_at_1_max value: 31.526303156060177 - type: nauc_mrr_at_1_std value: -41.887504422443136 - type: nauc_mrr_at_20_diff1 value: 78.42548039170424 - type: nauc_mrr_at_20_max value: 31.99588275070137 - type: nauc_mrr_at_20_std value: -44.44957722627042 - type: nauc_mrr_at_3_diff1 value: 78.26165151833735 - type: nauc_mrr_at_3_max value: 32.18028826126801 - type: nauc_mrr_at_3_std value: -44.6998237213182 - type: nauc_mrr_at_5_diff1 value: 78.34786430903962 - type: nauc_mrr_at_5_max value: 32.168476272879566 - type: nauc_mrr_at_5_std value: -44.7915919956712 - type: nauc_ndcg_at_1000_diff1 value: 77.79198355957816 - type: nauc_ndcg_at_1000_max value: 31.14363511518406 - type: nauc_ndcg_at_1000_std value: -46.69335151274275 - type: nauc_ndcg_at_100_diff1 value: 77.79898090286419 - type: nauc_ndcg_at_100_max value: 31.115103811629215 - type: nauc_ndcg_at_100_std value: -46.73078913421965 - type: nauc_ndcg_at_10_diff1 value: 77.74856635461343 - type: nauc_ndcg_at_10_max value: 30.279584686212747 - type: nauc_ndcg_at_10_std value: -50.23514662356807 - type: nauc_ndcg_at_1_diff1 value: 79.17833000040999 - type: nauc_ndcg_at_1_max value: 31.703788144510746 - type: nauc_ndcg_at_1_std value: -41.854817402870715 - type: nauc_ndcg_at_20_diff1 value: 77.7380353804671 - type: nauc_ndcg_at_20_max value: 30.622294129001553 - type: nauc_ndcg_at_20_std value: -49.035794761065254 - type: nauc_ndcg_at_3_diff1 value: 77.41476880573593 - type: nauc_ndcg_at_3_max value: 29.015949978243032 - type: nauc_ndcg_at_3_std value: -49.78627087622648 - type: nauc_ndcg_at_5_diff1 value: 77.64439137502896 - type: nauc_ndcg_at_5_max value: 29.444684897492206 - type: nauc_ndcg_at_5_std value: -51.21908400252501 - type: nauc_precision_at_1000_diff1 value: -44.92396459446822 - type: nauc_precision_at_1000_max value: -3.674153720989045 - type: nauc_precision_at_1000_std value: 39.56552468277785 - type: nauc_precision_at_100_diff1 value: -44.75143023259094 - type: nauc_precision_at_100_max value: -3.705280025140011 - type: nauc_precision_at_100_std value: 39.433619999113326 - type: nauc_precision_at_10_diff1 value: -41.0651074726579 - type: nauc_precision_at_10_max value: -0.21097985601783667 - type: nauc_precision_at_10_std value: 26.24652824589493 - type: nauc_precision_at_1_diff1 value: 79.17833000040999 - type: nauc_precision_at_1_max value: 31.703788144510746 - type: nauc_precision_at_1_std value: -41.854817402870715 - type: nauc_precision_at_20_diff1 value: -43.368001340920294 - type: nauc_precision_at_20_max value: -2.036990010399129 - type: nauc_precision_at_20_std value: 32.37747041406297 - type: nauc_precision_at_3_diff1 value: -22.089307548346877 - type: nauc_precision_at_3_max value: 6.2280973175296 - type: nauc_precision_at_3_std value: 5.323992514036145 - type: nauc_precision_at_5_diff1 value: -34.07115055244003 - type: nauc_precision_at_5_max value: 2.5955315789198834 - type: nauc_precision_at_5_std value: 16.26096689407332 - type: nauc_recall_at_1000_diff1 value: 58.27703860947467 - type: nauc_recall_at_1000_max value: 68.59835835315768 - type: nauc_recall_at_1000_std value: 77.96687006056064 - type: nauc_recall_at_100_diff1 value: 73.24371223081737 - type: nauc_recall_at_100_max value: 39.55925344664591 - type: nauc_recall_at_100_std value: -32.25605030215798 - type: nauc_recall_at_10_diff1 value: 73.41261201339202 - type: nauc_recall_at_10_max value: 26.822979434062926 - type: nauc_recall_at_10_std value: -74.2909332592806 - type: nauc_recall_at_1_diff1 value: 81.64335579973574 - type: nauc_recall_at_1_max value: 21.813832226652174 - type: nauc_recall_at_1_std value: -42.57570978190876 - type: nauc_recall_at_20_diff1 value: 72.7621297920656 - type: nauc_recall_at_20_max value: 26.02492304096079 - type: nauc_recall_at_20_std value: -77.8724532438279 - type: nauc_recall_at_3_diff1 value: 75.25149312810714 - type: nauc_recall_at_3_max value: 23.20545662481487 - type: nauc_recall_at_3_std value: -59.69689982140521 - type: nauc_recall_at_5_diff1 value: 73.69807273001406 - type: nauc_recall_at_5_max value: 24.073666798066057 - type: nauc_recall_at_5_std value: -67.91121268130719 - type: ndcg_at_1 value: 82.64 - type: ndcg_at_10 value: 89.58 - type: ndcg_at_100 value: 90.606 - type: ndcg_at_1000 value: 90.676 - type: ndcg_at_20 value: 90.132 - type: ndcg_at_3 value: 86.88 - type: ndcg_at_5 value: 88.40299999999999 - type: precision_at_1 value: 82.64 - type: precision_at_10 value: 13.604 - type: precision_at_100 value: 1.539 - type: precision_at_1000 value: 0.157 - type: precision_at_20 value: 7.188 - type: precision_at_3 value: 38.083 - type: precision_at_5 value: 25.018 - type: recall_at_1 value: 71.819 - type: recall_at_10 value: 96.34700000000001 - type: recall_at_100 value: 99.715 - type: recall_at_1000 value: 99.995 - type: recall_at_20 value: 98.073 - type: recall_at_3 value: 88.57300000000001 - type: recall_at_5 value: 92.908 task: type: Retrieval - dataset: config: default name: MTEB RedditClustering revision: 24640382cdbf8abc73003fb0fa6d111a705499eb split: test type: mteb/reddit-clustering metrics: - type: main_score value: 71.18966762070158 - type: v_measure value: 71.18966762070158 - type: v_measure_std value: 2.7498969054457048 task: type: Clustering - dataset: config: default name: MTEB RedditClusteringP2P revision: 385e3cb46b4cfa89021f56c4380204149d0efe33 split: test type: mteb/reddit-clustering-p2p metrics: - type: main_score value: 74.42014716862516 - type: v_measure value: 74.42014716862516 - type: v_measure_std value: 9.909739891410648 task: type: Clustering - dataset: config: default name: MTEB SCIDOCS revision: f8c2fcf00f625baaa80f62ec5bd9e1fff3b8ae88 split: test type: mteb/scidocs metrics: - type: main_score value: 25.041999999999998 - type: map_at_1 value: 5.893000000000001 - type: map_at_10 value: 15.260000000000002 - type: map_at_100 value: 18.084 - type: map_at_1000 value: 18.467 - type: map_at_20 value: 16.675 - type: map_at_3 value: 10.526 - type: map_at_5 value: 12.775 - type: mrr_at_1 value: 28.999999999999996 - type: mrr_at_10 value: 41.03575396825395 - type: mrr_at_100 value: 42.136771862785835 - type: mrr_at_1000 value: 42.16698555415099 - type: mrr_at_20 value: 41.707493696104315 - type: mrr_at_3 value: 37.34999999999998 - type: mrr_at_5 value: 39.59999999999995 - type: nauc_map_at_1000_diff1 value: 12.080002654911883 - type: nauc_map_at_1000_max value: 29.813563682286276 - type: nauc_map_at_1000_std value: 20.36659817908673 - type: nauc_map_at_100_diff1 value: 12.108735517749706 - type: nauc_map_at_100_max value: 29.76830671710955 - type: nauc_map_at_100_std value: 20.3433621032846 - type: nauc_map_at_10_diff1 value: 12.91575031185637 - type: nauc_map_at_10_max value: 29.427600958386318 - type: nauc_map_at_10_std value: 16.89867275177153 - type: nauc_map_at_1_diff1 value: 19.353069488987916 - type: nauc_map_at_1_max value: 17.093914951159693 - type: nauc_map_at_1_std value: 8.19886078055046 - type: nauc_map_at_20_diff1 value: 11.977233457943113 - type: nauc_map_at_20_max value: 29.171812822948805 - type: nauc_map_at_20_std value: 18.780517506173965 - type: nauc_map_at_3_diff1 value: 14.453129464176092 - type: nauc_map_at_3_max value: 25.801958649112077 - type: nauc_map_at_3_std value: 11.572823684429643 - type: nauc_map_at_5_diff1 value: 13.167155808104997 - type: nauc_map_at_5_max value: 27.355626948365792 - type: nauc_map_at_5_std value: 14.414151839192183 - type: nauc_mrr_at_1000_diff1 value: 17.262104643988636 - type: nauc_mrr_at_1000_max value: 23.991373837217058 - type: nauc_mrr_at_1000_std value: 12.44755488671623 - type: nauc_mrr_at_100_diff1 value: 17.267280132318703 - type: nauc_mrr_at_100_max value: 24.022189287889294 - type: nauc_mrr_at_100_std value: 12.480695500214788 - type: nauc_mrr_at_10_diff1 value: 17.012383998246268 - type: nauc_mrr_at_10_max value: 24.192637911171722 - type: nauc_mrr_at_10_std value: 12.524608847408917 - type: nauc_mrr_at_1_diff1 value: 19.43518811038007 - type: nauc_mrr_at_1_max value: 17.747482933395602 - type: nauc_mrr_at_1_std value: 8.410779775558684 - type: nauc_mrr_at_20_diff1 value: 17.202663281407446 - type: nauc_mrr_at_20_max value: 24.091991130543118 - type: nauc_mrr_at_20_std value: 12.503814263019908 - type: nauc_mrr_at_3_diff1 value: 17.52733013432995 - type: nauc_mrr_at_3_max value: 23.569459518780214 - type: nauc_mrr_at_3_std value: 11.770846827520726 - type: nauc_mrr_at_5_diff1 value: 17.10817561975543 - type: nauc_mrr_at_5_max value: 23.945141435234678 - type: nauc_mrr_at_5_std value: 12.034468615317719 - type: nauc_ndcg_at_1000_diff1 value: 12.317811393346936 - type: nauc_ndcg_at_1000_max value: 30.809991350156103 - type: nauc_ndcg_at_1000_std value: 24.517501065205067 - type: nauc_ndcg_at_100_diff1 value: 12.824804203182936 - type: nauc_ndcg_at_100_max value: 30.895499817010748 - type: nauc_ndcg_at_100_std value: 25.424376279745402 - type: nauc_ndcg_at_10_diff1 value: 13.32724552457439 - type: nauc_ndcg_at_10_max value: 30.409088666807456 - type: nauc_ndcg_at_10_std value: 18.216330475714113 - type: nauc_ndcg_at_1_diff1 value: 19.43518811038007 - type: nauc_ndcg_at_1_max value: 17.747482933395602 - type: nauc_ndcg_at_1_std value: 8.410779775558684 - type: nauc_ndcg_at_20_diff1 value: 12.224399111852902 - type: nauc_ndcg_at_20_max value: 29.86352330445272 - type: nauc_ndcg_at_20_std value: 21.196937851331807 - type: nauc_ndcg_at_3_diff1 value: 15.367489533734027 - type: nauc_ndcg_at_3_max value: 26.76486390741532 - type: nauc_ndcg_at_3_std value: 12.606077508789923 - type: nauc_ndcg_at_5_diff1 value: 13.831157482390935 - type: nauc_ndcg_at_5_max value: 28.070226983968904 - type: nauc_ndcg_at_5_std value: 15.236787943125435 - type: nauc_precision_at_1000_diff1 value: 0.016122957101357048 - type: nauc_precision_at_1000_max value: 24.380929903557334 - type: nauc_precision_at_1000_std value: 34.54045112720052 - type: nauc_precision_at_100_diff1 value: 7.255224788507301 - type: nauc_precision_at_100_max value: 27.98453788447542 - type: nauc_precision_at_100_std value: 35.38999555441665 - type: nauc_precision_at_10_diff1 value: 9.69185099834181 - type: nauc_precision_at_10_max value: 32.532315522580454 - type: nauc_precision_at_10_std value: 21.48948348473612 - type: nauc_precision_at_1_diff1 value: 19.43518811038007 - type: nauc_precision_at_1_max value: 17.747482933395602 - type: nauc_precision_at_1_std value: 8.410779775558684 - type: nauc_precision_at_20_diff1 value: 6.964076536695672 - type: nauc_precision_at_20_max value: 29.30087236410044 - type: nauc_precision_at_20_std value: 26.413625895571986 - type: nauc_precision_at_3_diff1 value: 14.145134359925155 - type: nauc_precision_at_3_max value: 29.915650960808303 - type: nauc_precision_at_3_std value: 14.095370019867797 - type: nauc_precision_at_5_diff1 value: 11.043933558522692 - type: nauc_precision_at_5_max value: 30.93016505807111 - type: nauc_precision_at_5_std value: 17.749256196062603 - type: nauc_recall_at_1000_diff1 value: -0.7776817772090345 - type: nauc_recall_at_1000_max value: 23.094717340324518 - type: nauc_recall_at_1000_std value: 37.189908681396425 - type: nauc_recall_at_100_diff1 value: 6.887748742013364 - type: nauc_recall_at_100_max value: 27.00798435230277 - type: nauc_recall_at_100_std value: 35.908147807345344 - type: nauc_recall_at_10_diff1 value: 9.605632017480751 - type: nauc_recall_at_10_max value: 31.845202901168655 - type: nauc_recall_at_10_std value: 21.497414586634683 - type: nauc_recall_at_1_diff1 value: 19.353069488987916 - type: nauc_recall_at_1_max value: 17.093914951159693 - type: nauc_recall_at_1_std value: 8.19886078055046 - type: nauc_recall_at_20_diff1 value: 6.927503731844782 - type: nauc_recall_at_20_max value: 28.611698183338202 - type: nauc_recall_at_20_std value: 26.69018660149911 - type: nauc_recall_at_3_diff1 value: 14.043724087062268 - type: nauc_recall_at_3_max value: 29.269835821380465 - type: nauc_recall_at_3_std value: 14.104419605998094 - type: nauc_recall_at_5_diff1 value: 11.017319452873336 - type: nauc_recall_at_5_max value: 30.295720628306228 - type: nauc_recall_at_5_std value: 17.758048545573825 - type: ndcg_at_1 value: 28.999999999999996 - type: ndcg_at_10 value: 25.041999999999998 - type: ndcg_at_100 value: 35.045 - type: ndcg_at_1000 value: 40.803 - type: ndcg_at_20 value: 28.584 - type: ndcg_at_3 value: 23.249 - type: ndcg_at_5 value: 20.533 - type: precision_at_1 value: 28.999999999999996 - type: precision_at_10 value: 13.120000000000001 - type: precision_at_100 value: 2.7470000000000003 - type: precision_at_1000 value: 0.41200000000000003 - type: precision_at_20 value: 8.584999999999999 - type: precision_at_3 value: 21.633 - type: precision_at_5 value: 18.099999999999998 - type: recall_at_1 value: 5.893000000000001 - type: recall_at_10 value: 26.567 - type: recall_at_100 value: 55.800000000000004 - type: recall_at_1000 value: 83.608 - type: recall_at_20 value: 34.86 - type: recall_at_3 value: 13.153 - type: recall_at_5 value: 18.323 task: type: Retrieval - dataset: config: default name: MTEB SICK-R revision: 20a6d6f312dd54037fe07a32d58e5e168867909d split: test type: mteb/sickr-sts metrics: - type: cosine_pearson value: 86.57284584320382 - type: cosine_spearman value: 82.20531642680812 - type: euclidean_pearson value: 83.94261758556554 - type: euclidean_spearman value: 82.20721497738559 - type: main_score value: 82.20531642680812 - type: manhattan_pearson value: 84.15902154703083 - type: manhattan_spearman value: 82.19506027155957 - type: pearson value: 86.57284584320382 - type: spearman value: 82.20531642680812 task: type: STS - dataset: config: default name: MTEB STS12 revision: a0d554a64d88156834ff5ae9920b964011b16384 split: test type: mteb/sts12-sts metrics: - type: cosine_pearson value: 86.28047602146931 - type: cosine_spearman value: 79.51504881448884 - type: euclidean_pearson value: 83.10545189967856 - type: euclidean_spearman value: 79.50586960492797 - type: main_score value: 79.51504881448884 - type: manhattan_pearson value: 83.44244457500889 - type: manhattan_spearman value: 79.730303339846 - type: pearson value: 86.28047602146931 - type: spearman value: 79.51504881448884 task: type: STS - dataset: config: default name: MTEB STS13 revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca split: test type: mteb/sts13-sts metrics: - type: cosine_pearson value: 88.74723553048702 - type: cosine_spearman value: 89.18936052329725 - type: euclidean_pearson value: 88.90400878928668 - type: euclidean_spearman value: 89.19174821431281 - type: main_score value: 89.18936052329725 - type: manhattan_pearson value: 88.81504628424054 - type: manhattan_spearman value: 89.18063294142597 - type: pearson value: 88.74723553048702 - type: spearman value: 89.18936052329725 task: type: STS - dataset: config: default name: MTEB STS14 revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 split: test type: mteb/sts14-sts metrics: - type: cosine_pearson value: 86.45403437836023 - type: cosine_spearman value: 85.14654611519086 - type: euclidean_pearson value: 85.87509624462743 - type: euclidean_spearman value: 85.1391108856681 - type: main_score value: 85.14654611519086 - type: manhattan_pearson value: 85.96635794953866 - type: manhattan_spearman value: 85.3271371527667 - type: pearson value: 86.45403437836023 - type: spearman value: 85.14654611519086 task: type: STS - dataset: config: default name: MTEB STS15 revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 split: test type: mteb/sts15-sts metrics: - type: cosine_pearson value: 87.84742260009705 - type: cosine_spearman value: 89.10215217191254 - type: euclidean_pearson value: 88.97393286325477 - type: euclidean_spearman value: 89.1014105509662 - type: main_score value: 89.10215217191254 - type: manhattan_pearson value: 89.31698781090151 - type: manhattan_spearman value: 89.53000001764433 - type: pearson value: 87.84742260009705 - type: spearman value: 89.10215217191254 task: type: STS - dataset: config: default name: MTEB STS16 revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 split: test type: mteb/sts16-sts metrics: - type: cosine_pearson value: 85.22397535461835 - type: cosine_spearman value: 87.14066355879785 - type: euclidean_pearson value: 86.31393364087295 - type: euclidean_spearman value: 87.14018892702765 - type: main_score value: 87.14066355879785 - type: manhattan_pearson value: 86.36366855248434 - type: manhattan_spearman value: 87.20858630423012 - type: pearson value: 85.22397535461835 - type: spearman value: 87.14066355879785 task: type: STS - dataset: config: en-en name: MTEB STS17 (en-en) revision: faeb762787bd10488a50c8b5be4a3b82e411949c split: test type: mteb/sts17-crosslingual-sts metrics: - type: cosine_pearson value: 90.66131612061355 - type: cosine_spearman value: 90.97082650129164 - type: euclidean_pearson value: 90.98181906744969 - type: euclidean_spearman value: 90.99008476850047 - type: main_score value: 90.97082650129164 - type: manhattan_pearson value: 90.75245040709021 - type: manhattan_spearman value: 90.6199877691265 - type: pearson value: 90.66131612061355 - type: spearman value: 90.97082650129164 task: type: STS - dataset: config: en name: MTEB STS22 (en) revision: de9d86b3b84231dc21f76c7b7af1f28e2f57f6e3 split: test type: mteb/sts22-crosslingual-sts metrics: - type: cosine_pearson value: 67.270656447085 - type: cosine_spearman value: 67.82870469746828 - type: euclidean_pearson value: 69.03857775285664 - type: euclidean_spearman value: 67.74455108773341 - type: main_score value: 67.82870469746828 - type: manhattan_pearson value: 69.25304172245812 - type: manhattan_spearman value: 68.00987097916055 - type: pearson value: 67.270656447085 - type: spearman value: 67.82870469746828 task: type: STS - dataset: config: default name: MTEB STSBenchmark revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 split: test type: mteb/stsbenchmark-sts metrics: - type: cosine_pearson value: 87.17245205384889 - type: cosine_spearman value: 87.7360146030987 - type: euclidean_pearson value: 87.48919412794656 - type: euclidean_spearman value: 87.7312047878383 - type: main_score value: 87.7360146030987 - type: manhattan_pearson value: 87.61476224354806 - type: manhattan_spearman value: 87.95220889254693 - type: pearson value: 87.17245205384889 - type: spearman value: 87.7360146030987 task: type: STS - dataset: config: default name: MTEB SciDocsRR revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab split: test type: mteb/scidocs-reranking metrics: - type: main_score value: 88.43547871921146 - type: map value: 88.43547871921146 - type: mrr value: 96.5564473652709 - type: nAUC_map_diff1 value: -13.66029392579231 - type: nAUC_map_max value: 50.325613574053506 - type: nAUC_map_std value: 60.02986231275796 - type: nAUC_mrr_diff1 value: 23.83821476411125 - type: nAUC_mrr_max value: 86.72643311769906 - type: nAUC_mrr_std value: 72.12741063469213 task: type: Reranking - dataset: config: default name: MTEB SciFact revision: 0228b52cf27578f30900b9e5271d331663a030d7 split: test type: mteb/scifact metrics: - type: main_score value: 78.233 - type: map_at_1 value: 61.49400000000001 - type: map_at_10 value: 73.30600000000001 - type: map_at_100 value: 73.719 - type: map_at_1000 value: 73.724 - type: map_at_20 value: 73.611 - type: map_at_3 value: 70.626 - type: map_at_5 value: 72.417 - type: mrr_at_1 value: 64.66666666666666 - type: mrr_at_10 value: 74.30357142857143 - type: mrr_at_100 value: 74.56950898079988 - type: mrr_at_1000 value: 74.57295833098681 - type: mrr_at_20 value: 74.46165223665226 - type: mrr_at_3 value: 72.3888888888889 - type: mrr_at_5 value: 73.60555555555557 - type: nauc_map_at_1000_diff1 value: 76.51524604780636 - type: nauc_map_at_1000_max value: 53.48521938401881 - type: nauc_map_at_1000_std value: -7.347799382158861 - type: nauc_map_at_100_diff1 value: 76.5122888096236 - type: nauc_map_at_100_max value: 53.49221847471618 - type: nauc_map_at_100_std value: -7.329683735681086 - type: nauc_map_at_10_diff1 value: 76.30928630674504 - type: nauc_map_at_10_max value: 53.00102977185941 - type: nauc_map_at_10_std value: -7.7467740085108705 - type: nauc_map_at_1_diff1 value: 79.54189281784247 - type: nauc_map_at_1_max value: 46.630071622109526 - type: nauc_map_at_1_std value: -14.395943134644112 - type: nauc_map_at_20_diff1 value: 76.41604361947962 - type: nauc_map_at_20_max value: 53.578883876146875 - type: nauc_map_at_20_std value: -7.403103451288041 - type: nauc_map_at_3_diff1 value: 76.25911617571941 - type: nauc_map_at_3_max value: 49.140287380513605 - type: nauc_map_at_3_std value: -11.35992449218983 - type: nauc_map_at_5_diff1 value: 76.35122077770336 - type: nauc_map_at_5_max value: 52.1744367901208 - type: nauc_map_at_5_std value: -7.85753955055384 - type: nauc_mrr_at_1000_diff1 value: 76.97223309515867 - type: nauc_mrr_at_1000_max value: 57.263787498613326 - type: nauc_mrr_at_1000_std value: -4.884090708840035 - type: nauc_mrr_at_100_diff1 value: 76.97312970894603 - type: nauc_mrr_at_100_max value: 57.26850730446478 - type: nauc_mrr_at_100_std value: -4.875200894216617 - type: nauc_mrr_at_10_diff1 value: 76.65927674223613 - type: nauc_mrr_at_10_max value: 57.30979763941454 - type: nauc_mrr_at_10_std value: -4.863331094022142 - type: nauc_mrr_at_1_diff1 value: 80.0454932568644 - type: nauc_mrr_at_1_max value: 56.76038421319305 - type: nauc_mrr_at_1_std value: -4.101939392632653 - type: nauc_mrr_at_20_diff1 value: 76.87237970440503 - type: nauc_mrr_at_20_max value: 57.33843605225869 - type: nauc_mrr_at_20_std value: -4.96248984417978 - type: nauc_mrr_at_3_diff1 value: 76.74130186666727 - type: nauc_mrr_at_3_max value: 56.19313244846155 - type: nauc_mrr_at_3_std value: -5.684365934009136 - type: nauc_mrr_at_5_diff1 value: 76.66406918799962 - type: nauc_mrr_at_5_max value: 57.56110093228628 - type: nauc_mrr_at_5_std value: -3.7464413085588073 - type: nauc_ndcg_at_1000_diff1 value: 76.19194173971773 - type: nauc_ndcg_at_1000_max value: 55.57464600170693 - type: nauc_ndcg_at_1000_std value: -6.0761689532372625 - type: nauc_ndcg_at_100_diff1 value: 76.14631273843654 - type: nauc_ndcg_at_100_max value: 55.72246565373382 - type: nauc_ndcg_at_100_std value: -5.595160698860595 - type: nauc_ndcg_at_10_diff1 value: 75.0108223611192 - type: nauc_ndcg_at_10_max value: 55.27894212877493 - type: nauc_ndcg_at_10_std value: -6.968331740214591 - type: nauc_ndcg_at_1_diff1 value: 80.0454932568644 - type: nauc_ndcg_at_1_max value: 56.76038421319305 - type: nauc_ndcg_at_1_std value: -4.101939392632653 - type: nauc_ndcg_at_20_diff1 value: 75.54887755702472 - type: nauc_ndcg_at_20_max value: 56.406879417251496 - type: nauc_ndcg_at_20_std value: -6.495231061329629 - type: nauc_ndcg_at_3_diff1 value: 75.03620356688509 - type: nauc_ndcg_at_3_max value: 52.147381077773424 - type: nauc_ndcg_at_3_std value: -8.448005688956199 - type: nauc_ndcg_at_5_diff1 value: 75.1195898074229 - type: nauc_ndcg_at_5_max value: 54.2321033861173 - type: nauc_ndcg_at_5_std value: -5.882690780895338 - type: nauc_precision_at_1000_diff1 value: -28.081979732100532 - type: nauc_precision_at_1000_max value: 35.055348014832916 - type: nauc_precision_at_1000_std value: 59.61280468927384 - type: nauc_precision_at_100_diff1 value: -25.112740730587458 - type: nauc_precision_at_100_max value: 38.26331300116496 - type: nauc_precision_at_100_std value: 62.46316222328831 - type: nauc_precision_at_10_diff1 value: -2.6766206473658833 - type: nauc_precision_at_10_max value: 45.95321867204845 - type: nauc_precision_at_10_std value: 45.07212468670564 - type: nauc_precision_at_1_diff1 value: 80.0454932568644 - type: nauc_precision_at_1_max value: 56.76038421319305 - type: nauc_precision_at_1_std value: -4.101939392632653 - type: nauc_precision_at_20_diff1 value: -10.698911116738385 - type: nauc_precision_at_20_max value: 43.467275950182994 - type: nauc_precision_at_20_std value: 48.00467321991766 - type: nauc_precision_at_3_diff1 value: 33.6344708541193 - type: nauc_precision_at_3_max value: 49.309242331670504 - type: nauc_precision_at_3_std value: 21.02940391379915 - type: nauc_precision_at_5_diff1 value: 13.560415600596318 - type: nauc_precision_at_5_max value: 48.918726500100085 - type: nauc_precision_at_5_std value: 39.940930429172184 - type: nauc_recall_at_1000_diff1 value: .nan - type: nauc_recall_at_1000_max value: .nan - type: nauc_recall_at_1000_std value: .nan - type: nauc_recall_at_100_diff1 value: 70.82166199813196 - type: nauc_recall_at_100_max value: 76.6106442577042 - type: nauc_recall_at_100_std value: 66.47992530345513 - type: nauc_recall_at_10_diff1 value: 62.68908885556092 - type: nauc_recall_at_10_max value: 58.14262437741839 - type: nauc_recall_at_10_std value: -12.946717875063369 - type: nauc_recall_at_1_diff1 value: 79.54189281784247 - type: nauc_recall_at_1_max value: 46.630071622109526 - type: nauc_recall_at_1_std value: -14.395943134644112 - type: nauc_recall_at_20_diff1 value: 65.79470497876567 - type: nauc_recall_at_20_max value: 71.68308183488456 - type: nauc_recall_at_20_std value: -12.556850697268453 - type: nauc_recall_at_3_diff1 value: 68.3240211318129 - type: nauc_recall_at_3_max value: 45.05998217275036 - type: nauc_recall_at_3_std value: -14.23179772593869 - type: nauc_recall_at_5_diff1 value: 67.53366869904056 - type: nauc_recall_at_5_max value: 53.57935627081027 - type: nauc_recall_at_5_std value: -3.3271112904853393 - type: ndcg_at_1 value: 64.667 - type: ndcg_at_10 value: 78.233 - type: ndcg_at_100 value: 79.806 - type: ndcg_at_1000 value: 79.92099999999999 - type: ndcg_at_20 value: 79.006 - type: ndcg_at_3 value: 74.018 - type: ndcg_at_5 value: 76.334 - type: precision_at_1 value: 64.667 - type: precision_at_10 value: 10.4 - type: precision_at_100 value: 1.1199999999999999 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_20 value: 5.383 - type: precision_at_3 value: 29.444 - type: precision_at_5 value: 19.467000000000002 - type: recall_at_1 value: 61.49400000000001 - type: recall_at_10 value: 92.156 - type: recall_at_100 value: 99.167 - type: recall_at_1000 value: 100.0 - type: recall_at_20 value: 94.833 - type: recall_at_3 value: 80.833 - type: recall_at_5 value: 86.6 task: type: Retrieval - dataset: config: default name: MTEB SprintDuplicateQuestions revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 split: test type: mteb/sprintduplicatequestions-pairclassification metrics: - type: cosine_accuracy value: 99.8039603960396 - type: cosine_accuracy_threshold value: 84.54211950302124 - type: cosine_ap value: 95.59056372734358 - type: cosine_f1 value: 90.1394422310757 - type: cosine_f1_threshold value: 84.54211950302124 - type: cosine_precision value: 89.78174603174604 - type: cosine_recall value: 90.5 - type: dot_accuracy value: 99.80594059405941 - type: dot_accuracy_threshold value: 85.57180166244507 - type: dot_ap value: 95.53453431914399 - type: dot_f1 value: 90.10442565887618 - type: dot_f1_threshold value: 84.59715843200684 - type: dot_precision value: 89.61424332344214 - type: dot_recall value: 90.60000000000001 - type: euclidean_accuracy value: 99.8039603960396 - type: euclidean_accuracy_threshold value: 53.253382444381714 - type: euclidean_ap value: 95.5850992402159 - type: euclidean_f1 value: 90.09457441513192 - type: euclidean_f1_threshold value: 55.725520849227905 - type: euclidean_precision value: 89.69276511397423 - type: euclidean_recall value: 90.5 - type: main_score value: 95.7485189884476 - type: manhattan_accuracy value: 99.81485148514851 - type: manhattan_accuracy_threshold value: 3491.29638671875 - type: manhattan_ap value: 95.7485189884476 - type: manhattan_f1 value: 90.464048954615 - type: manhattan_f1_threshold value: 3491.29638671875 - type: manhattan_precision value: 92.2996878251821 - type: manhattan_recall value: 88.7 - type: max_ap value: 95.7485189884476 - type: max_f1 value: 90.464048954615 - type: max_precision value: 92.2996878251821 - type: max_recall value: 90.60000000000001 - type: similarity_accuracy value: 99.8039603960396 - type: similarity_accuracy_threshold value: 84.54211950302124 - type: similarity_ap value: 95.59056372734358 - type: similarity_f1 value: 90.1394422310757 - type: similarity_f1_threshold value: 84.54211950302124 - type: similarity_precision value: 89.78174603174604 - type: similarity_recall value: 90.5 task: type: PairClassification - dataset: config: default name: MTEB StackExchangeClustering revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 split: test type: mteb/stackexchange-clustering metrics: - type: main_score value: 78.49205191950675 - type: v_measure value: 78.49205191950675 - type: v_measure_std value: 2.84869550699959 task: type: Clustering - dataset: config: default name: MTEB StackExchangeClusteringP2P revision: 815ca46b2622cec33ccafc3735d572c266efdb44 split: test type: mteb/stackexchange-clustering-p2p metrics: - type: main_score value: 48.90421736513028 - type: v_measure value: 48.90421736513028 - type: v_measure_std value: 1.6875865714471023 task: type: Clustering - dataset: config: default name: MTEB StackOverflowDupQuestions revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 split: test type: mteb/stackoverflowdupquestions-reranking metrics: - type: main_score value: 52.9874730481696 - type: map value: 52.9874730481696 - type: mrr value: 53.85867604617604 - type: nAUC_map_diff1 value: 39.633429293407616 - type: nAUC_map_max value: 10.236807988858546 - type: nAUC_map_std value: 10.276522217929674 - type: nAUC_mrr_diff1 value: 40.0543079218377 - type: nAUC_mrr_max value: 10.96209807382042 - type: nAUC_mrr_std value: 10.524400196109918 task: type: Reranking - dataset: config: default name: MTEB SummEval revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c split: test type: mteb/summeval metrics: - type: cosine_pearson value: 30.727801109114232 - type: cosine_spearman value: 31.66058223980157 - type: dot_pearson value: 30.78818248622866 - type: dot_spearman value: 31.525158776890265 - type: main_score value: 31.66058223980157 - type: pearson value: 30.727801109114232 - type: spearman value: 31.66058223980157 task: type: Summarization - dataset: config: default name: MTEB TRECCOVID revision: bb9466bac8153a0349341eb1b22e06409e78ef4e split: test type: mteb/trec-covid metrics: - type: main_score value: 85.206 - type: map_at_1 value: 0.246 - type: map_at_10 value: 2.1950000000000003 - type: map_at_100 value: 14.179 - type: map_at_1000 value: 35.037 - type: map_at_20 value: 4.143 - type: map_at_3 value: 0.7100000000000001 - type: map_at_5 value: 1.135 - type: mrr_at_1 value: 94.0 - type: mrr_at_10 value: 96.66666666666666 - type: mrr_at_100 value: 96.66666666666666 - type: mrr_at_1000 value: 96.66666666666666 - type: mrr_at_20 value: 96.66666666666666 - type: mrr_at_3 value: 96.66666666666666 - type: mrr_at_5 value: 96.66666666666666 - type: nauc_map_at_1000_diff1 value: -4.6264497624527525 - type: nauc_map_at_1000_max value: 44.594457564749355 - type: nauc_map_at_1000_std value: 73.17642341400133 - type: nauc_map_at_100_diff1 value: 23.451335157405726 - type: nauc_map_at_100_max value: 25.426398857299525 - type: nauc_map_at_100_std value: 64.07416694472633 - type: nauc_map_at_10_diff1 value: 46.57568738568346 - type: nauc_map_at_10_max value: 9.693233249079238 - type: nauc_map_at_10_std value: 28.549530265164357 - type: nauc_map_at_1_diff1 value: 53.48238396620123 - type: nauc_map_at_1_max value: 0.33476619393733076 - type: nauc_map_at_1_std value: 8.906362219128463 - type: nauc_map_at_20_diff1 value: 39.40719602207749 - type: nauc_map_at_20_max value: 9.635915072074045 - type: nauc_map_at_20_std value: 35.15634791346394 - type: nauc_map_at_3_diff1 value: 53.11784737840137 - type: nauc_map_at_3_max value: 3.059682761072153 - type: nauc_map_at_3_std value: 21.310633086556617 - type: nauc_map_at_5_diff1 value: 49.91570701185436 - type: nauc_map_at_5_max value: 8.045082896244576 - type: nauc_map_at_5_std value: 20.597686235051647 - type: nauc_mrr_at_1000_diff1 value: 41.98412698412726 - type: nauc_mrr_at_1000_max value: 78.24463118580779 - type: nauc_mrr_at_1000_std value: 0.30812324930028195 - type: nauc_mrr_at_100_diff1 value: 41.98412698412726 - type: nauc_mrr_at_100_max value: 78.24463118580779 - type: nauc_mrr_at_100_std value: 0.30812324930028195 - type: nauc_mrr_at_10_diff1 value: 41.98412698412726 - type: nauc_mrr_at_10_max value: 78.24463118580779 - type: nauc_mrr_at_10_std value: 0.30812324930028195 - type: nauc_mrr_at_1_diff1 value: 38.62433862433873 - type: nauc_mrr_at_1_max value: 80.78120136943666 - type: nauc_mrr_at_1_std value: -10.768751945222197 - type: nauc_mrr_at_20_diff1 value: 41.98412698412726 - type: nauc_mrr_at_20_max value: 78.24463118580779 - type: nauc_mrr_at_20_std value: 0.30812324930028195 - type: nauc_mrr_at_3_diff1 value: 41.98412698412726 - type: nauc_mrr_at_3_max value: 78.24463118580779 - type: nauc_mrr_at_3_std value: 0.30812324930028195 - type: nauc_mrr_at_5_diff1 value: 41.98412698412726 - type: nauc_mrr_at_5_max value: 78.24463118580779 - type: nauc_mrr_at_5_std value: 0.30812324930028195 - type: nauc_ndcg_at_1000_diff1 value: 0.5174948602880207 - type: nauc_ndcg_at_1000_max value: 48.60686602077053 - type: nauc_ndcg_at_1000_std value: 75.72456343175277 - type: nauc_ndcg_at_100_diff1 value: -20.747252137999254 - type: nauc_ndcg_at_100_max value: 49.985132618254994 - type: nauc_ndcg_at_100_std value: 61.096383293836574 - type: nauc_ndcg_at_10_diff1 value: 6.791377920463332 - type: nauc_ndcg_at_10_max value: 57.50019332833286 - type: nauc_ndcg_at_10_std value: 49.201028841219426 - type: nauc_ndcg_at_1_diff1 value: 54.92683440362145 - type: nauc_ndcg_at_1_max value: 83.8667228129276 - type: nauc_ndcg_at_1_std value: 1.6738604063586122 - type: nauc_ndcg_at_20_diff1 value: -5.1948699196314925 - type: nauc_ndcg_at_20_max value: 54.483087684806556 - type: nauc_ndcg_at_20_std value: 50.54823818118781 - type: nauc_ndcg_at_3_diff1 value: 26.267246500164372 - type: nauc_ndcg_at_3_max value: 63.0173212926611 - type: nauc_ndcg_at_3_std value: 41.025597406368256 - type: nauc_ndcg_at_5_diff1 value: 16.910185454343036 - type: nauc_ndcg_at_5_max value: 60.9328683868778 - type: nauc_ndcg_at_5_std value: 36.70169905857712 - type: nauc_precision_at_1000_diff1 value: -46.374447765983525 - type: nauc_precision_at_1000_max value: 35.36052337813863 - type: nauc_precision_at_1000_std value: 14.219220668161018 - type: nauc_precision_at_100_diff1 value: -29.7838083657744 - type: nauc_precision_at_100_max value: 43.93589400385112 - type: nauc_precision_at_100_std value: 55.425045718579945 - type: nauc_precision_at_10_diff1 value: -12.016613405227687 - type: nauc_precision_at_10_max value: 57.79924427743131 - type: nauc_precision_at_10_std value: 49.022036703550675 - type: nauc_precision_at_1_diff1 value: 38.62433862433873 - type: nauc_precision_at_1_max value: 80.78120136943666 - type: nauc_precision_at_1_std value: -10.768751945222197 - type: nauc_precision_at_20_diff1 value: -23.95633847880195 - type: nauc_precision_at_20_max value: 48.34715917258276 - type: nauc_precision_at_20_std value: 48.82198285255887 - type: nauc_precision_at_3_diff1 value: 6.871296905858807 - type: nauc_precision_at_3_max value: 70.54805793285054 - type: nauc_precision_at_3_std value: 44.65108624094803 - type: nauc_precision_at_5_diff1 value: -9.074932448759695 - type: nauc_precision_at_5_max value: 67.41284242437573 - type: nauc_precision_at_5_std value: 23.876891983919577 - type: nauc_recall_at_1000_diff1 value: 8.142288830293255 - type: nauc_recall_at_1000_max value: 38.85182826835104 - type: nauc_recall_at_1000_std value: 68.60783819217335 - type: nauc_recall_at_100_diff1 value: 34.262914076287466 - type: nauc_recall_at_100_max value: 12.87009658528838 - type: nauc_recall_at_100_std value: 56.21330603762995 - type: nauc_recall_at_10_diff1 value: 49.33830945338758 - type: nauc_recall_at_10_max value: 0.3539875530671406 - type: nauc_recall_at_10_std value: 26.85864465557644 - type: nauc_recall_at_1_diff1 value: 53.48238396620123 - type: nauc_recall_at_1_max value: 0.33476619393733076 - type: nauc_recall_at_1_std value: 8.906362219128463 - type: nauc_recall_at_20_diff1 value: 44.21928181266254 - type: nauc_recall_at_20_max value: -0.9198356057088594 - type: nauc_recall_at_20_std value: 31.484376992896784 - type: nauc_recall_at_3_diff1 value: 53.038093080990876 - type: nauc_recall_at_3_max value: -1.4170895916973003 - type: nauc_recall_at_3_std value: 21.890202855574497 - type: nauc_recall_at_5_diff1 value: 49.39742214825278 - type: nauc_recall_at_5_max value: 2.8412267611894517 - type: nauc_recall_at_5_std value: 18.01598921859512 - type: ndcg_at_1 value: 91.0 - type: ndcg_at_10 value: 85.206 - type: ndcg_at_100 value: 67.29 - type: ndcg_at_1000 value: 60.584 - type: ndcg_at_20 value: 82.321 - type: ndcg_at_3 value: 88.642 - type: ndcg_at_5 value: 87.063 - type: precision_at_1 value: 94.0 - type: precision_at_10 value: 89.8 - type: precision_at_100 value: 69.78 - type: precision_at_1000 value: 26.738 - type: precision_at_20 value: 87.2 - type: precision_at_3 value: 92.0 - type: precision_at_5 value: 90.8 - type: recall_at_1 value: 0.246 - type: recall_at_10 value: 2.344 - type: recall_at_100 value: 16.962 - type: recall_at_1000 value: 57.325 - type: recall_at_20 value: 4.517 - type: recall_at_3 value: 0.731 - type: recall_at_5 value: 1.1780000000000002 task: type: Retrieval - dataset: config: default name: MTEB Touche2020 revision: a34f9a33db75fa0cbb21bb5cfc3dae8dc8bec93f split: test type: mteb/touche2020 metrics: - type: main_score value: 31.455 - type: map_at_1 value: 2.9739999999999998 - type: map_at_10 value: 12.183 - type: map_at_100 value: 18.772 - type: map_at_1000 value: 20.415 - type: map_at_20 value: 14.451 - type: map_at_3 value: 6.507000000000001 - type: map_at_5 value: 8.66 - type: mrr_at_1 value: 40.816326530612244 - type: mrr_at_10 value: 57.70975056689341 - type: mrr_at_100 value: 58.18379126542391 - type: mrr_at_1000 value: 58.18379126542391 - type: mrr_at_20 value: 57.85552316164561 - type: mrr_at_3 value: 54.08163265306123 - type: mrr_at_5 value: 56.42857142857143 - type: nauc_map_at_1000_diff1 value: 3.1567471051481437 - type: nauc_map_at_1000_max value: -1.5882060729791523 - type: nauc_map_at_1000_std value: 18.69622198722074 - type: nauc_map_at_100_diff1 value: 3.3449677678147536 - type: nauc_map_at_100_max value: -2.8928606866168405 - type: nauc_map_at_100_std value: 15.789984947653412 - type: nauc_map_at_10_diff1 value: 2.9696743570444264 - type: nauc_map_at_10_max value: -9.096749212011876 - type: nauc_map_at_10_std value: -5.38545817258353 - type: nauc_map_at_1_diff1 value: 20.680780404542546 - type: nauc_map_at_1_max value: -7.04722927447817 - type: nauc_map_at_1_std value: -7.062494733973898 - type: nauc_map_at_20_diff1 value: 4.070437790119271 - type: nauc_map_at_20_max value: -4.84491434686032 - type: nauc_map_at_20_std value: 0.5846341109021014 - type: nauc_map_at_3_diff1 value: 11.9634978045925 - type: nauc_map_at_3_max value: -8.27834591046608 - type: nauc_map_at_3_std value: -8.687615453381065 - type: nauc_map_at_5_diff1 value: 0.9195191526009436 - type: nauc_map_at_5_max value: -1.673813362719489 - type: nauc_map_at_5_std value: -6.67549753473631 - type: nauc_mrr_at_1000_diff1 value: 19.877993208719573 - type: nauc_mrr_at_1000_max value: -10.37776706406218 - type: nauc_mrr_at_1000_std value: 7.132169578056367 - type: nauc_mrr_at_100_diff1 value: 19.877993208719573 - type: nauc_mrr_at_100_max value: -10.37776706406218 - type: nauc_mrr_at_100_std value: 7.132169578056367 - type: nauc_mrr_at_10_diff1 value: 20.414285568401457 - type: nauc_mrr_at_10_max value: -9.677800295687861 - type: nauc_mrr_at_10_std value: 8.001103690180859 - type: nauc_mrr_at_1_diff1 value: 22.393284073955723 - type: nauc_mrr_at_1_max value: -5.889370191243167 - type: nauc_mrr_at_1_std value: -1.5183536173658247 - type: nauc_mrr_at_20_diff1 value: 20.455564720604055 - type: nauc_mrr_at_20_max value: -10.230642830103074 - type: nauc_mrr_at_20_std value: 7.863582453266621 - type: nauc_mrr_at_3_diff1 value: 17.554895390732618 - type: nauc_mrr_at_3_max value: -15.618463505555052 - type: nauc_mrr_at_3_std value: 5.913231577966864 - type: nauc_mrr_at_5_diff1 value: 18.393678507779914 - type: nauc_mrr_at_5_max value: -11.903593353147762 - type: nauc_mrr_at_5_std value: 7.580745996262831 - type: nauc_ndcg_at_1000_diff1 value: 13.746937095530473 - type: nauc_ndcg_at_1000_max value: -0.9319249687895838 - type: nauc_ndcg_at_1000_std value: 38.56328031451904 - type: nauc_ndcg_at_100_diff1 value: 13.854865944415895 - type: nauc_ndcg_at_100_max value: -7.142142012591404 - type: nauc_ndcg_at_100_std value: 35.61341954818848 - type: nauc_ndcg_at_10_diff1 value: 9.010144273248759 - type: nauc_ndcg_at_10_max value: -15.320014897424574 - type: nauc_ndcg_at_10_std value: 2.84883880489144 - type: nauc_ndcg_at_1_diff1 value: 20.939533945592967 - type: nauc_ndcg_at_1_max value: -6.387319972188946 - type: nauc_ndcg_at_1_std value: -0.5258673122126726 - type: nauc_ndcg_at_20_diff1 value: 14.660827309009496 - type: nauc_ndcg_at_20_max value: -13.476196120145994 - type: nauc_ndcg_at_20_std value: 8.22391881710838 - type: nauc_ndcg_at_3_diff1 value: 13.429985227235935 - type: nauc_ndcg_at_3_max value: -14.904544592570247 - type: nauc_ndcg_at_3_std value: 1.599779998183342 - type: nauc_ndcg_at_5_diff1 value: 8.085466231900622 - type: nauc_ndcg_at_5_max value: -9.09591969526831 - type: nauc_ndcg_at_5_std value: 3.5794092637248505 - type: nauc_precision_at_1000_diff1 value: -9.31941215946743 - type: nauc_precision_at_1000_max value: 31.52913520470716 - type: nauc_precision_at_1000_std value: 22.720784312185856 - type: nauc_precision_at_100_diff1 value: 8.958548406995279 - type: nauc_precision_at_100_max value: 15.100597910674104 - type: nauc_precision_at_100_std value: 71.04548238175113 - type: nauc_precision_at_10_diff1 value: 12.4698194690008 - type: nauc_precision_at_10_max value: -15.84870544871496 - type: nauc_precision_at_10_std value: 7.575297622501928 - type: nauc_precision_at_1_diff1 value: 22.393284073955723 - type: nauc_precision_at_1_max value: -5.889370191243167 - type: nauc_precision_at_1_std value: -1.5183536173658247 - type: nauc_precision_at_20_diff1 value: 15.393505718138758 - type: nauc_precision_at_20_max value: -3.70684298539384 - type: nauc_precision_at_20_std value: 29.426137824970304 - type: nauc_precision_at_3_diff1 value: 9.997768085465394 - type: nauc_precision_at_3_max value: -17.12224314347674 - type: nauc_precision_at_3_std value: -1.343018166772313 - type: nauc_precision_at_5_diff1 value: 3.8936997437913554 - type: nauc_precision_at_5_max value: -5.689104289687632 - type: nauc_precision_at_5_std value: 3.181098051304285 - type: nauc_recall_at_1000_diff1 value: 9.908303508158387 - type: nauc_recall_at_1000_max value: 6.174506592699848 - type: nauc_recall_at_1000_std value: 77.41931114780012 - type: nauc_recall_at_100_diff1 value: 10.286839241876192 - type: nauc_recall_at_100_max value: -6.6138697026666815 - type: nauc_recall_at_100_std value: 49.608313692633224 - type: nauc_recall_at_10_diff1 value: 2.215545846659851 - type: nauc_recall_at_10_max value: -17.83025802478445 - type: nauc_recall_at_10_std value: -3.3784768673705465 - type: nauc_recall_at_1_diff1 value: 20.680780404542546 - type: nauc_recall_at_1_max value: -7.04722927447817 - type: nauc_recall_at_1_std value: -7.062494733973898 - type: nauc_recall_at_20_diff1 value: 6.974410239251615 - type: nauc_recall_at_20_max value: -14.161147924731646 - type: nauc_recall_at_20_std value: 9.328412057721454 - type: nauc_recall_at_3_diff1 value: 7.904589805754212 - type: nauc_recall_at_3_max value: -12.1912388648593 - type: nauc_recall_at_3_std value: -9.221542013385555 - type: nauc_recall_at_5_diff1 value: -3.2604132752706914 - type: nauc_recall_at_5_max value: -6.886351441658915 - type: nauc_recall_at_5_std value: -7.014252851712789 - type: ndcg_at_1 value: 39.796 - type: ndcg_at_10 value: 31.455 - type: ndcg_at_100 value: 42.388999999999996 - type: ndcg_at_1000 value: 53.556000000000004 - type: ndcg_at_20 value: 30.808000000000003 - type: ndcg_at_3 value: 35.831 - type: ndcg_at_5 value: 32.845 - type: precision_at_1 value: 40.816 - type: precision_at_10 value: 27.143 - type: precision_at_100 value: 8.449 - type: precision_at_1000 value: 1.6179999999999999 - type: precision_at_20 value: 19.387999999999998 - type: precision_at_3 value: 35.374 - type: precision_at_5 value: 31.019999999999996 - type: recall_at_1 value: 2.9739999999999998 - type: recall_at_10 value: 19.39 - type: recall_at_100 value: 51.636 - type: recall_at_1000 value: 86.99900000000001 - type: recall_at_20 value: 26.478 - type: recall_at_3 value: 7.703 - type: recall_at_5 value: 11.42 task: type: Retrieval - dataset: config: default name: MTEB ToxicConversationsClassification revision: edfaf9da55d3dd50d43143d90c1ac476895ae6de split: test type: mteb/toxic_conversations_50k metrics: - type: accuracy value: 86.9384765625 - type: ap value: 31.737513704141552 - type: ap_weighted value: 31.737513704141552 - type: f1 value: 71.5490757306975 - type: f1_weighted value: 89.14632533489856 - type: main_score value: 86.9384765625 task: type: Classification - dataset: config: default name: MTEB TweetSentimentExtractionClassification revision: d604517c81ca91fe16a244d1248fc021f9ecee7a split: test type: mteb/tweet_sentiment_extraction metrics: - type: accuracy value: 73.57668364459535 - type: f1 value: 73.90467103648074 - type: f1_weighted value: 73.42158415034704 - type: main_score value: 73.57668364459535 task: type: Classification - dataset: config: default name: MTEB TwentyNewsgroupsClustering revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 split: test type: mteb/twentynewsgroups-clustering metrics: - type: main_score value: 58.574148097494685 - type: v_measure value: 58.574148097494685 - type: v_measure_std value: 0.9443161637490822 task: type: Clustering - dataset: config: default name: MTEB TwitterSemEval2015 revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 split: test type: mteb/twittersemeval2015-pairclassification metrics: - type: cosine_accuracy value: 88.1385229778864 - type: cosine_accuracy_threshold value: 83.86307954788208 - type: cosine_ap value: 80.17965893449055 - type: cosine_f1 value: 73.0614300100705 - type: cosine_f1_threshold value: 80.7942807674408 - type: cosine_precision value: 69.8603755416466 - type: cosine_recall value: 76.56992084432717 - type: dot_accuracy value: 88.2100494724921 - type: dot_accuracy_threshold value: 83.84793996810913 - type: dot_ap value: 80.18603932881858 - type: dot_f1 value: 73.07643714466204 - type: dot_f1_threshold value: 80.87586164474487 - type: dot_precision value: 70.10909090909091 - type: dot_recall value: 76.3060686015831 - type: euclidean_accuracy value: 88.1385229778864 - type: euclidean_accuracy_threshold value: 56.77661895751953 - type: euclidean_ap value: 80.1784070881624 - type: euclidean_f1 value: 73.04830369529574 - type: euclidean_f1_threshold value: 61.91838979721069 - type: euclidean_precision value: 69.96859144720948 - type: euclidean_recall value: 76.41160949868075 - type: main_score value: 80.18603932881858 - type: manhattan_accuracy value: 88.0431543184121 - type: manhattan_accuracy_threshold value: 3755.6137084960938 - type: manhattan_ap value: 79.98270453664578 - type: manhattan_f1 value: 72.68242015061023 - type: manhattan_f1_threshold value: 3892.494583129883 - type: manhattan_precision value: 71.54907975460122 - type: manhattan_recall value: 73.85224274406332 - type: max_ap value: 80.18603932881858 - type: max_f1 value: 73.07643714466204 - type: max_precision value: 71.54907975460122 - type: max_recall value: 76.56992084432717 - type: similarity_accuracy value: 88.1385229778864 - type: similarity_accuracy_threshold value: 83.86307954788208 - type: similarity_ap value: 80.17965893449055 - type: similarity_f1 value: 73.0614300100705 - type: similarity_f1_threshold value: 80.7942807674408 - type: similarity_precision value: 69.8603755416466 - type: similarity_recall value: 76.56992084432717 task: type: PairClassification - dataset: config: default name: MTEB TwitterURLCorpus revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf split: test type: mteb/twitterurlcorpus-pairclassification metrics: - type: cosine_accuracy value: 89.7892653393876 - type: cosine_accuracy_threshold value: 79.69566583633423 - type: cosine_ap value: 87.4579867302024 - type: cosine_f1 value: 79.91620843152658 - type: cosine_f1_threshold value: 78.53609323501587 - type: cosine_precision value: 77.7155329210622 - type: cosine_recall value: 82.24514936864799 - type: dot_accuracy value: 89.78732487289945 - type: dot_accuracy_threshold value: 80.05315661430359 - type: dot_ap value: 87.44916182456272 - type: dot_f1 value: 79.90419878751591 - type: dot_f1_threshold value: 78.57890725135803 - type: dot_precision value: 77.73409057812728 - type: dot_recall value: 82.19895287958116 - type: euclidean_accuracy value: 89.78538440641131 - type: euclidean_accuracy_threshold value: 62.29925751686096 - type: euclidean_ap value: 87.45904868911386 - type: euclidean_f1 value: 79.93127404474657 - type: euclidean_f1_threshold value: 65.61101078987122 - type: euclidean_precision value: 77.62060210373595 - type: euclidean_recall value: 82.38373883584848 - type: main_score value: 87.46554314325058 - type: manhattan_accuracy value: 89.76597974152986 - type: manhattan_accuracy_threshold value: 3988.5299682617188 - type: manhattan_ap value: 87.46554314325058 - type: manhattan_f1 value: 79.97181740645973 - type: manhattan_f1_threshold value: 4235.905838012695 - type: manhattan_precision value: 77.13713427283783 - type: manhattan_recall value: 83.02279026793964 - type: max_ap value: 87.46554314325058 - type: max_f1 value: 79.97181740645973 - type: max_precision value: 77.73409057812728 - type: max_recall value: 83.02279026793964 - type: similarity_accuracy value: 89.7892653393876 - type: similarity_accuracy_threshold value: 79.69566583633423 - type: similarity_ap value: 87.4579867302024 - type: similarity_f1 value: 79.91620843152658 - type: similarity_f1_threshold value: 78.53609323501587 - type: similarity_precision value: 77.7155329210622 - type: similarity_recall value: 82.24514936864799 task: type: PairClassification tags: - mteb - sentence-transformers - transformers - sentence-similarity license: mit --- # Updates New open-source models and ToDoList will be listed on https://github.com/DunZhang/Stella/blob/main/news_and_todo.md. You can also find these models on my [homepage](https://huggingface.co/infgrad). # Introduction The models are trained based on `Alibaba-NLP/gte-large-en-v1.5` and `Alibaba-NLP/gte-Qwen2-1.5B-instruct`. Thanks for their contributions! **We simplify usage of prompts, providing two prompts for most general tasks, one is for s2p, another one is for s2s.** Prompt of s2p task(e.g. retrieve task): ```text Instruct: Given a web search query, retrieve relevant passages that answer the query.\nQuery: {query} ``` Prompt of s2s task(e.g. semantic textual similarity task): ```text Instruct: Retrieve semantically similar text.\nQuery: {query} ``` The models are finally trained by [MRL]((https://arxiv.org/abs/2205.13147)), so they have multiple dimensions: 512, 768, 1024, 2048, 4096, 6144 and 8192. The higher the dimension, the better the performance. **Generally speaking, 1024d is good enough.** The MTEB score of 1024d is only 0.001 lower than 8192d. # Model directory structure The model directory structure is very simple, it is a standard SentenceTransformer directory **with a series of `2_Dense_{dims}` folders**, where `dims` represents the final vector dimension. For example, the `2_Dense_256` folder stores Linear weights that convert vector dimensions to 256 dimensions. Please refer to the following chapters for specific instructions on how to use them. # Usage You can use `SentenceTransformers` or `transformers` library to encode text. ## Sentence Transformers ```python from sentence_transformers import SentenceTransformer # This model supports two prompts: "s2p_query" and "s2s_query" for sentence-to-passage and sentence-to-sentence tasks, respectively. # They are defined in `config_sentence_transformers.json` query_prompt_name = "s2p_query" queries = [ "What are some ways to reduce stress?", "What are the benefits of drinking green tea?", ] # docs do not need any prompts docs = [ "There are many effective ways to reduce stress. Some common techniques include deep breathing, meditation, and physical activity. Engaging in hobbies, spending time in nature, and connecting with loved ones can also help alleviate stress. Additionally, setting boundaries, practicing self-care, and learning to say no can prevent stress from building up.", "Green tea has been consumed for centuries and is known for its potential health benefits. It contains antioxidants that may help protect the body against damage caused by free radicals. Regular consumption of green tea has been associated with improved heart health, enhanced cognitive function, and a reduced risk of certain types of cancer. The polyphenols in green tea may also have anti-inflammatory and weight loss properties.", ] # ！The default dimension is 1024, if you need other dimensions, please clone the model and modify `modules.json` to replace `2_Dense_1024` with another dimension, e.g. `2_Dense_256` or `2_Dense_8192` ! # on gpu model = SentenceTransformer("dunzhang/stella_en_400M_v5", trust_remote_code=True).cuda() # you can also use this model without the features of `use_memory_efficient_attention` and `unpad_inputs`. It can be worked in CPU. # model = SentenceTransformer( # "dunzhang/stella_en_400M_v5", # trust_remote_code=True, # device="cpu", # config_kwargs={"use_memory_efficient_attention": False, "unpad_inputs": False} # ) query_embeddings = model.encode(queries, prompt_name=query_prompt_name) doc_embeddings = model.encode(docs) print(query_embeddings.shape, doc_embeddings.shape) # (2, 1024) (2, 1024) similarities = model.similarity(query_embeddings, doc_embeddings) print(similarities) # tensor([[0.8398, 0.2990], # [0.3282, 0.8095]]) ``` ## Transformers ```python import os import torch from transformers import AutoModel, AutoTokenizer from sklearn.preprocessing import normalize query_prompt = "Instruct: Given a web search query, retrieve relevant passages that answer the query.\nQuery: " queries = [ "What are some ways to reduce stress?", "What are the benefits of drinking green tea?", ] queries = [query_prompt + query for query in queries] # docs do not need any prompts docs = [ "There are many effective ways to reduce stress. Some common techniques include deep breathing, meditation, and physical activity. Engaging in hobbies, spending time in nature, and connecting with loved ones can also help alleviate stress. Additionally, setting boundaries, practicing self-care, and learning to say no can prevent stress from building up.", "Green tea has been consumed for centuries and is known for its potential health benefits. It contains antioxidants that may help protect the body against damage caused by free radicals. Regular consumption of green tea has been associated with improved heart health, enhanced cognitive function, and a reduced risk of certain types of cancer. The polyphenols in green tea may also have anti-inflammatory and weight loss properties.", ] # The path of your model after cloning it model_dir = "{Your MODEL_PATH}" vector_dim = 1024 vector_linear_directory = f"2_Dense_{vector_dim}" model = AutoModel.from_pretrained(model_dir, trust_remote_code=True).cuda().eval() # you can also use this model without the features of `use_memory_efficient_attention` and `unpad_inputs`. It can be worked in CPU. # model = AutoModel.from_pretrained(model_dir, trust_remote_code=True,use_memory_efficient_attention=False,unpad_inputs=False).cuda().eval() tokenizer = AutoTokenizer.from_pretrained(model_dir, trust_remote_code=True) vector_linear = torch.nn.Linear(in_features=model.config.hidden_size, out_features=vector_dim) vector_linear_dict = { k.replace("linear.", ""): v for k, v in torch.load(os.path.join(model_dir, f"{vector_linear_directory}/pytorch_model.bin")).items() } vector_linear.load_state_dict(vector_linear_dict) vector_linear.cuda() # Embed the queries with torch.no_grad(): input_data = tokenizer(queries, padding="longest", truncation=True, max_length=512, return_tensors="pt") input_data = {k: v.cuda() for k, v in input_data.items()} attention_mask = input_data["attention_mask"] last_hidden_state = model(**input_data)[0] last_hidden = last_hidden_state.masked_fill(~attention_mask[..., None].bool(), 0.0) query_vectors = last_hidden.sum(dim=1) / attention_mask.sum(dim=1)[..., None] query_vectors = normalize(vector_linear(query_vectors).cpu().numpy()) # Embed the documents with torch.no_grad(): input_data = tokenizer(docs, padding="longest", truncation=True, max_length=512, return_tensors="pt") input_data = {k: v.cuda() for k, v in input_data.items()} attention_mask = input_data["attention_mask"] last_hidden_state = model(**input_data)[0] last_hidden = last_hidden_state.masked_fill(~attention_mask[..., None].bool(), 0.0) docs_vectors = last_hidden.sum(dim=1) / attention_mask.sum(dim=1)[..., None] docs_vectors = normalize(vector_linear(docs_vectors).cpu().numpy()) print(query_vectors.shape, docs_vectors.shape) # (2, 1024) (2, 1024) similarities = query_vectors @ docs_vectors.T print(similarities) # [[0.8397531 0.29900077] # [0.32818374 0.80954516]] ``` # FAQ Q: The details of training? A: The training method and datasets will be released in the future. (specific time unknown, may be provided in a paper) Q: How to choose a suitable prompt for my own task? A: In most cases, please use the s2p and s2s prompts. These two prompts account for the vast majority of the training data. Q: How to reproduce MTEB results? A: Please use evaluation scripts in `Alibaba-NLP/gte-Qwen2-1.5B-instruct` or `intfloat/e5-mistral-7b-instruct` Q: Why each dimension has a linear weight? A: MRL has multiple training methods, we choose this method which has the best performance. Q: What is the sequence length of models? A: 512 is recommended, in our experiments, almost all models perform poorly on specialized long text retrieval datasets. Besides, the model is trained on datasets of 512 length. This may be an optimization term. If you have any questions, please start a discussion on community.

amazon/chronos-t5-base

amazon

transformers

time-series-forecasting

--- license: apache-2.0 pipeline_tag: time-series-forecasting tags: - time series - forecasting - pretrained models - foundation models - time series foundation models - time-series --- # Chronos-T5 (Base) Chronos is a family of **pretrained time series forecasting models** based on language model architectures. A time series is transformed into a sequence of tokens via scaling and quantization, and a language model is trained on these tokens using the cross-entropy loss. Once trained, probabilistic forecasts are obtained by sampling multiple future trajectories given the historical context. Chronos models have been trained on a large corpus of publicly available time series data, as well as synthetic data generated using Gaussian processes. For details on Chronos models, training data and procedures, and experimental results, please refer to the paper [Chronos: Learning the Language of Time Series](https://arxiv.org/abs/2403.07815). <p align="center"> <img src="figures/main-figure.png" width="100%"> <br /> <span> Fig. 1: High-level depiction of Chronos. (<b>Left</b>) The input time series is scaled and quantized to obtain a sequence of tokens. (<b>Center</b>) The tokens are fed into a language model which may either be an encoder-decoder or a decoder-only model. The model is trained using the cross-entropy loss. (<b>Right</b>) During inference, we autoregressively sample tokens from the model and map them back to numerical values. Multiple trajectories are sampled to obtain a predictive distribution. </span> </p> --- ## Architecture The models in this repository are based on the [T5 architecture](https://arxiv.org/abs/1910.10683). The only difference is in the vocabulary size: Chronos-T5 models use 4096 different tokens, compared to 32128 of the original T5 models, resulting in fewer parameters. | Model | Parameters | Based on | | ---------------------------------------------------------------------- | ---------- | ---------------------------------------------------------------------- | | [**chronos-t5-tiny**](https://huggingface.co/amazon/chronos-t5-tiny) | 8M | [t5-efficient-tiny](https://huggingface.co/google/t5-efficient-tiny) | | [**chronos-t5-mini**](https://huggingface.co/amazon/chronos-t5-mini) | 20M | [t5-efficient-mini](https://huggingface.co/google/t5-efficient-mini) | | [**chronos-t5-small**](https://huggingface.co/amazon/chronos-t5-small) | 46M | [t5-efficient-small](https://huggingface.co/google/t5-efficient-small) | | [**chronos-t5-base**](https://huggingface.co/amazon/chronos-t5-base) | 200M | [t5-efficient-base](https://huggingface.co/google/t5-efficient-base) | | [**chronos-t5-large**](https://huggingface.co/amazon/chronos-t5-large) | 710M | [t5-efficient-large](https://huggingface.co/google/t5-efficient-large) | ## Usage To perform inference with Chronos models, install the package in the GitHub [companion repo](https://github.com/amazon-science/chronos-forecasting) by running: ``` pip install git+https://github.com/amazon-science/chronos-forecasting.git ``` A minimal example showing how to perform inference using Chronos models: ```python import matplotlib.pyplot as plt import numpy as np import pandas as pd import torch from chronos import ChronosPipeline pipeline = ChronosPipeline.from_pretrained( "amazon/chronos-t5-base", device_map="cuda", torch_dtype=torch.bfloat16, ) df = pd.read_csv("https://raw.githubusercontent.com/AileenNielsen/TimeSeriesAnalysisWithPython/master/data/AirPassengers.csv") # context must be either a 1D tensor, a list of 1D tensors, # or a left-padded 2D tensor with batch as the first dimension context = torch.tensor(df["#Passengers"]) prediction_length = 12 forecast = pipeline.predict(context, prediction_length) # shape [num_series, num_samples, prediction_length] # visualize the forecast forecast_index = range(len(df), len(df) + prediction_length) low, median, high = np.quantile(forecast[0].numpy(), [0.1, 0.5, 0.9], axis=0) plt.figure(figsize=(8, 4)) plt.plot(df["#Passengers"], color="royalblue", label="historical data") plt.plot(forecast_index, median, color="tomato", label="median forecast") plt.fill_between(forecast_index, low, high, color="tomato", alpha=0.3, label="80% prediction interval") plt.legend() plt.grid() plt.show() ``` ## Citation If you find Chronos models useful for your research, please consider citing the associated [paper](https://arxiv.org/abs/2403.07815): ``` @article{ansari2024chronos, author = {Ansari, Abdul Fatir and Stella, Lorenzo and Turkmen, Caner and Zhang, Xiyuan, and Mercado, Pedro and Shen, Huibin and Shchur, Oleksandr and Rangapuram, Syama Syndar and Pineda Arango, Sebastian and Kapoor, Shubham and Zschiegner, Jasper and Maddix, Danielle C. and Mahoney, Michael W. and Torkkola, Kari and Gordon Wilson, Andrew and Bohlke-Schneider, Michael and Wang, Yuyang}, title = {Chronos: Learning the Language of Time Series}, journal = {arXiv preprint arXiv:2403.07815}, year = {2024} } ``` ## Security See [CONTRIBUTING](CONTRIBUTING.md#security-issue-notifications) for more information. ## License This project is licensed under the Apache-2.0 License.

xlnet/xlnet-base-cased

xlnet

transformers

text-generation

--- language: en license: mit datasets: - bookcorpus - wikipedia --- # XLNet (base-sized model) XLNet model pre-trained on English language. It was introduced in the paper [XLNet: Generalized Autoregressive Pretraining for Language Understanding](https://arxiv.org/abs/1906.08237) by Yang et al. and first released in [this repository](https://github.com/zihangdai/xlnet/). Disclaimer: The team releasing XLNet did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description XLNet is a new unsupervised language representation learning method based on a novel generalized permutation language modeling objective. Additionally, XLNet employs Transformer-XL as the backbone model, exhibiting excellent performance for language tasks involving long context. Overall, XLNet achieves state-of-the-art (SOTA) results on various downstream language tasks including question answering, natural language inference, sentiment analysis, and document ranking. ## Intended uses & limitations The model is mostly intended to be fine-tuned on a downstream task. See the [model hub](https://huggingface.co/models?search=xlnet) to look for fine-tuned versions on a task that interests you. Note that this model is primarily aimed at being fine-tuned on tasks that use the whole sentence (potentially masked) to make decisions, such as sequence classification, token classification or question answering. For tasks such as text generation, you should look at models like GPT2. ## Usage Here is how to use this model to get the features of a given text in PyTorch: ```python from transformers import XLNetTokenizer, XLNetModel tokenizer = XLNetTokenizer.from_pretrained('xlnet-base-cased') model = XLNetModel.from_pretrained('xlnet-base-cased') inputs = tokenizer("Hello, my dog is cute", return_tensors="pt") outputs = model(**inputs) last_hidden_states = outputs.last_hidden_state ``` ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-1906-08237, author = {Zhilin Yang and Zihang Dai and Yiming Yang and Jaime G. Carbonell and Ruslan Salakhutdinov and Quoc V. Le}, title = {XLNet: Generalized Autoregressive Pretraining for Language Understanding}, journal = {CoRR}, volume = {abs/1906.08237}, year = {2019}, url = {http://arxiv.org/abs/1906.08237}, eprinttype = {arXiv}, eprint = {1906.08237}, timestamp = {Mon, 24 Jun 2019 17:28:45 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1906-08237.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

ckiplab/bert-base-chinese-ner

ckiplab

transformers

token-classification

--- language: - zh thumbnail: https://ckip.iis.sinica.edu.tw/files/ckip_logo.png tags: - pytorch - token-classification - bert - zh license: gpl-3.0 --- # CKIP BERT Base Chinese This project provides traditional Chinese transformers models (including ALBERT, BERT, GPT2) and NLP tools (including word segmentation, part-of-speech tagging, named entity recognition). 這個專案提供了繁體中文的 transformers 模型（包含 ALBERT、BERT、GPT2）及自然語言處理工具（包含斷詞、詞性標記、實體辨識）。 ## Homepage - https://github.com/ckiplab/ckip-transformers ## Contributers - [Mu Yang](https://muyang.pro) at [CKIP](https://ckip.iis.sinica.edu.tw) (Author & Maintainer) ## Usage Please use BertTokenizerFast as tokenizer instead of AutoTokenizer. 請使用 BertTokenizerFast 而非 AutoTokenizer。 ``` from transformers import ( BertTokenizerFast, AutoModel, ) tokenizer = BertTokenizerFast.from_pretrained('bert-base-chinese') model = AutoModel.from_pretrained('ckiplab/bert-base-chinese-ner') ``` For full usage and more information, please refer to https://github.com/ckiplab/ckip-transformers. 有關完整使用方法及其他資訊，請參見 https://github.com/ckiplab/ckip-transformers 。

google-bert/bert-base-multilingual-uncased

google-bert

transformers

fill-mask

--- language: - multilingual - af - sq - ar - an - hy - ast - az - ba - eu - bar - be - bn - inc - bs - br - bg - my - ca - ceb - ce - zh - cv - hr - cs - da - nl - en - et - fi - fr - gl - ka - de - el - gu - ht - he - hi - hu - is - io - id - ga - it - ja - jv - kn - kk - ky - ko - la - lv - lt - roa - nds - lm - mk - mg - ms - ml - mr - min - ne - new - nb - nn - oc - fa - pms - pl - pt - pa - ro - ru - sco - sr - hr - scn - sk - sl - aze - es - su - sw - sv - tl - tg - ta - tt - te - tr - uk - ud - uz - vi - vo - war - cy - fry - pnb - yo license: apache-2.0 datasets: - wikipedia --- # BERT multilingual base model (uncased) Pretrained model on the top 102 languages with the largest Wikipedia using a masked language modeling (MLM) objective. It was introduced in [this paper](https://arxiv.org/abs/1810.04805) and first released in [this repository](https://github.com/google-research/bert). This model is uncased: it does not make a difference between english and English. Disclaimer: The team releasing BERT did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description BERT is a transformers model pretrained on a large corpus of multilingual data in a self-supervised fashion. This means it was pretrained on the raw texts only, with no humans labelling them in any way (which is why it can use lots of publicly available data) with an automatic process to generate inputs and labels from those texts. More precisely, it was pretrained with two objectives: - Masked language modeling (MLM): taking a sentence, the model randomly masks 15% of the words in the input then run the entire masked sentence through the model and has to predict the masked words. This is different from traditional recurrent neural networks (RNNs) that usually see the words one after the other, or from autoregressive models like GPT which internally mask the future tokens. It allows the model to learn a bidirectional representation of the sentence. - Next sentence prediction (NSP): the models concatenates two masked sentences as inputs during pretraining. Sometimes they correspond to sentences that were next to each other in the original text, sometimes not. The model then has to predict if the two sentences were following each other or not. This way, the model learns an inner representation of the languages in the training set that can then be used to extract features useful for downstream tasks: if you have a dataset of labeled sentences for instance, you can train a standard classifier using the features produced by the BERT model as inputs. ## Intended uses & limitations You can use the raw model for either masked language modeling or next sentence prediction, but it's mostly intended to be fine-tuned on a downstream task. See the [model hub](https://huggingface.co/models?filter=bert) to look for fine-tuned versions on a task that interests you. Note that this model is primarily aimed at being fine-tuned on tasks that use the whole sentence (potentially masked) to make decisions, such as sequence classification, token classification or question answering. For tasks such as text generation you should look at model like GPT2. ### How to use You can use this model directly with a pipeline for masked language modeling: ```python >>> from transformers import pipeline >>> unmasker = pipeline('fill-mask', model='bert-base-multilingual-uncased') >>> unmasker("Hello I'm a [MASK] model.") [{'sequence': "[CLS] hello i'm a top model. [SEP]", 'score': 0.1507750153541565, 'token': 11397, 'token_str': 'top'}, {'sequence': "[CLS] hello i'm a fashion model. [SEP]", 'score': 0.13075384497642517, 'token': 23589, 'token_str': 'fashion'}, {'sequence': "[CLS] hello i'm a good model. [SEP]", 'score': 0.036272723227739334, 'token': 12050, 'token_str': 'good'}, {'sequence': "[CLS] hello i'm a new model. [SEP]", 'score': 0.035954564809799194, 'token': 10246, 'token_str': 'new'}, {'sequence': "[CLS] hello i'm a great model. [SEP]", 'score': 0.028643041849136353, 'token': 11838, 'token_str': 'great'}] ``` Here is how to use this model to get the features of a given text in PyTorch: ```python from transformers import BertTokenizer, BertModel tokenizer = BertTokenizer.from_pretrained('bert-base-multilingual-uncased') model = BertModel.from_pretrained("bert-base-multilingual-uncased") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='pt') output = model(**encoded_input) ``` and in TensorFlow: ```python from transformers import BertTokenizer, TFBertModel tokenizer = BertTokenizer.from_pretrained('bert-base-multilingual-uncased') model = TFBertModel.from_pretrained("bert-base-multilingual-uncased") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='tf') output = model(encoded_input) ``` ### Limitations and bias Even if the training data used for this model could be characterized as fairly neutral, this model can have biased predictions: ```python >>> from transformers import pipeline >>> unmasker = pipeline('fill-mask', model='bert-base-multilingual-uncased') >>> unmasker("The man worked as a [MASK].") [{'sequence': '[CLS] the man worked as a teacher. [SEP]', 'score': 0.07943806052207947, 'token': 21733, 'token_str': 'teacher'}, {'sequence': '[CLS] the man worked as a lawyer. [SEP]', 'score': 0.0629938617348671, 'token': 34249, 'token_str': 'lawyer'}, {'sequence': '[CLS] the man worked as a farmer. [SEP]', 'score': 0.03367974981665611, 'token': 36799, 'token_str': 'farmer'}, {'sequence': '[CLS] the man worked as a journalist. [SEP]', 'score': 0.03172805905342102, 'token': 19477, 'token_str': 'journalist'}, {'sequence': '[CLS] the man worked as a carpenter. [SEP]', 'score': 0.031021825969219208, 'token': 33241, 'token_str': 'carpenter'}] >>> unmasker("The Black woman worked as a [MASK].") [{'sequence': '[CLS] the black woman worked as a nurse. [SEP]', 'score': 0.07045423984527588, 'token': 52428, 'token_str': 'nurse'}, {'sequence': '[CLS] the black woman worked as a teacher. [SEP]', 'score': 0.05178029090166092, 'token': 21733, 'token_str': 'teacher'}, {'sequence': '[CLS] the black woman worked as a lawyer. [SEP]', 'score': 0.032601192593574524, 'token': 34249, 'token_str': 'lawyer'}, {'sequence': '[CLS] the black woman worked as a slave. [SEP]', 'score': 0.030507225543260574, 'token': 31173, 'token_str': 'slave'}, {'sequence': '[CLS] the black woman worked as a woman. [SEP]', 'score': 0.027691684663295746, 'token': 14050, 'token_str': 'woman'}] ``` This bias will also affect all fine-tuned versions of this model. ## Training data The BERT model was pretrained on the 102 languages with the largest Wikipedias. You can find the complete list [here](https://github.com/google-research/bert/blob/master/multilingual.md#list-of-languages). ## Training procedure ### Preprocessing The texts are lowercased and tokenized using WordPiece and a shared vocabulary size of 110,000. The languages with a larger Wikipedia are under-sampled and the ones with lower resources are oversampled. For languages like Chinese, Japanese Kanji and Korean Hanja that don't have space, a CJK Unicode block is added around every character. The inputs of the model are then of the form: ``` [CLS] Sentence A [SEP] Sentence B [SEP] ``` With probability 0.5, sentence A and sentence B correspond to two consecutive sentences in the original corpus and in the other cases, it's another random sentence in the corpus. Note that what is considered a sentence here is a consecutive span of text usually longer than a single sentence. The only constrain is that the result with the two "sentences" has a combined length of less than 512 tokens. The details of the masking procedure for each sentence are the following: - 15% of the tokens are masked. - In 80% of the cases, the masked tokens are replaced by `[MASK]`. - In 10% of the cases, the masked tokens are replaced by a random token (different) from the one they replace. - In the 10% remaining cases, the masked tokens are left as is. ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-1810-04805, author = {Jacob Devlin and Ming{-}Wei Chang and Kenton Lee and Kristina Toutanova}, title = {{BERT:} Pre-training of Deep Bidirectional Transformers for Language Understanding}, journal = {CoRR}, volume = {abs/1810.04805}, year = {2018}, url = {http://arxiv.org/abs/1810.04805}, archivePrefix = {arXiv}, eprint = {1810.04805}, timestamp = {Tue, 30 Oct 2018 20:39:56 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1810-04805.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

cross-encoder/ms-marco-MiniLM-L-6-v2

cross-encoder

transformers

text-classification

--- license: apache-2.0 --- # Cross-Encoder for MS Marco This model was trained on the [MS Marco Passage Ranking](https://github.com/microsoft/MSMARCO-Passage-Ranking) task. The model can be used for Information Retrieval: Given a query, encode the query will all possible passages (e.g. retrieved with ElasticSearch). Then sort the passages in a decreasing order. See [SBERT.net Retrieve & Re-rank](https://www.sbert.net/examples/applications/retrieve_rerank/README.html) for more details. The training code is available here: [SBERT.net Training MS Marco](https://github.com/UKPLab/sentence-transformers/tree/master/examples/training/ms_marco) ## Usage with Transformers ```python from transformers import AutoTokenizer, AutoModelForSequenceClassification import torch model = AutoModelForSequenceClassification.from_pretrained('model_name') tokenizer = AutoTokenizer.from_pretrained('model_name') features = tokenizer(['How many people live in Berlin?', 'How many people live in Berlin?'], ['Berlin has a population of 3,520,031 registered inhabitants in an area of 891.82 square kilometers.', 'New York City is famous for the Metropolitan Museum of Art.'], padding=True, truncation=True, return_tensors="pt") model.eval() with torch.no_grad(): scores = model(**features).logits print(scores) ``` ## Usage with SentenceTransformers The usage becomes easier when you have [SentenceTransformers](https://www.sbert.net/) installed. Then, you can use the pre-trained models like this: ```python from sentence_transformers import CrossEncoder model = CrossEncoder('model_name', max_length=512) scores = model.predict([('Query', 'Paragraph1'), ('Query', 'Paragraph2') , ('Query', 'Paragraph3')]) ``` ## Performance In the following table, we provide various pre-trained Cross-Encoders together with their performance on the [TREC Deep Learning 2019](https://microsoft.github.io/TREC-2019-Deep-Learning/) and the [MS Marco Passage Reranking](https://github.com/microsoft/MSMARCO-Passage-Ranking/) dataset. | Model-Name | NDCG@10 (TREC DL 19) | MRR@10 (MS Marco Dev) | Docs / Sec | | ------------- |:-------------| -----| --- | | **Version 2 models** | | | | cross-encoder/ms-marco-TinyBERT-L-2-v2 | 69.84 | 32.56 | 9000 | cross-encoder/ms-marco-MiniLM-L-2-v2 | 71.01 | 34.85 | 4100 | cross-encoder/ms-marco-MiniLM-L-4-v2 | 73.04 | 37.70 | 2500 | cross-encoder/ms-marco-MiniLM-L-6-v2 | 74.30 | 39.01 | 1800 | cross-encoder/ms-marco-MiniLM-L-12-v2 | 74.31 | 39.02 | 960 | **Version 1 models** | | | | cross-encoder/ms-marco-TinyBERT-L-2 | 67.43 | 30.15 | 9000 | cross-encoder/ms-marco-TinyBERT-L-4 | 68.09 | 34.50 | 2900 | cross-encoder/ms-marco-TinyBERT-L-6 | 69.57 | 36.13 | 680 | cross-encoder/ms-marco-electra-base | 71.99 | 36.41 | 340 | **Other models** | | | | nboost/pt-tinybert-msmarco | 63.63 | 28.80 | 2900 | nboost/pt-bert-base-uncased-msmarco | 70.94 | 34.75 | 340 | nboost/pt-bert-large-msmarco | 73.36 | 36.48 | 100 | Capreolus/electra-base-msmarco | 71.23 | 36.89 | 340 | amberoad/bert-multilingual-passage-reranking-msmarco | 68.40 | 35.54 | 330 | sebastian-hofstaetter/distilbert-cat-margin_mse-T2-msmarco | 72.82 | 37.88 | 720 Note: Runtime was computed on a V100 GPU.

laion/CLIP-ViT-B-32-laion2B-s34B-b79K

laion

open_clip

zero-shot-image-classification

--- license: mit widget: - src: >- https://huggingface.co/datasets/mishig/sample_images/resolve/main/cat-dog-music.png candidate_labels: playing music, playing sports example_title: Cat & Dog pipeline_tag: zero-shot-image-classification --- # Model Card for CLIP ViT-B/32 - LAION-2B # Table of Contents 1. [Model Details](#model-details) 2. [Uses](#uses) 3. [Training Details](#training-details) 4. [Evaluation](#evaluation) 5. [Acknowledgements](#acknowledgements) 6. [Citation](#citation) 7. [How To Get Started With the Model](#how-to-get-started-with-the-model) # Model Details ## Model Description A CLIP ViT-B/32 model trained with the LAION-2B English subset of LAION-5B (https://laion.ai/blog/laion-5b/) using OpenCLIP (https://github.com/mlfoundations/open_clip). Model training done by Romain Beaumont on the [stability.ai](https://stability.ai/) cluster. # Uses As per the original [OpenAI CLIP model card](https://github.com/openai/CLIP/blob/d50d76daa670286dd6cacf3bcd80b5e4823fc8e1/model-card.md), this model is intended as a research output for research communities. We hope that this model will enable researchers to better understand and explore zero-shot, arbitrary image classification. We also hope it can be used for interdisciplinary studies of the potential impact of such model. The OpenAI CLIP paper includes a discussion of potential downstream impacts to provide an example for this sort of analysis. Additionally, the LAION-5B blog (https://laion.ai/blog/laion-5b/) and upcoming paper include additional discussion as it relates specifically to the training dataset. ## Direct Use Zero-shot image classification, image and text retrieval, among others. ## Downstream Use Image classification and other image task fine-tuning, linear probe image classification, image generation guiding and conditioning, among others. ## Out-of-Scope Use As per the OpenAI models, **Any** deployed use case of the model - whether commercial or not - is currently out of scope. Non-deployed use cases such as image search in a constrained environment, are also not recommended unless there is thorough in-domain testing of the model with a specific, fixed class taxonomy. This is because our safety assessment demonstrated a high need for task specific testing especially given the variability of CLIP’s performance with different class taxonomies. This makes untested and unconstrained deployment of the model in any use case currently potentially harmful. Certain use cases which would fall under the domain of surveillance and facial recognition are always out-of-scope regardless of performance of the model. This is because the use of artificial intelligence for tasks such as these can be premature currently given the lack of testing norms and checks to ensure its fair use. Since the model has not been purposefully trained in or evaluated on any languages other than English, its use should be limited to English language use cases. Further the above notice, the LAION-5B dataset used in training of these models has additional considerations, see below. # Training Details ## Training Data This model was trained with the 2 Billion sample English subset of LAION-5B (https://laion.ai/blog/laion-5b/). **IMPORTANT NOTE:** The motivation behind dataset creation is to democratize research and experimentation around large-scale multi-modal model training and handling of uncurated, large-scale datasets crawled from publically available internet. Our recommendation is therefore to use the dataset for research purposes. Be aware that this large-scale dataset is uncurated. Keep in mind that the uncurated nature of the dataset means that collected links may lead to strongly discomforting and disturbing content for a human viewer. Therefore, please use the demo links with caution and at your own risk. It is possible to extract a “safe” subset by filtering out samples based on the safety tags (using a customized trained NSFW classifier that we built). While this strongly reduces the chance for encountering potentially harmful content when viewing, we cannot entirely exclude the possibility for harmful content being still present in safe mode, so that the warning holds also there. We think that providing the dataset openly to broad research and other interested communities will allow for transparent investigation of benefits that come along with training large-scale models as well as pitfalls and dangers that may stay unreported or unnoticed when working with closed large datasets that remain restricted to a small community. Providing our dataset openly, we however do not recommend using it for creating ready-to-go industrial products, as the basic research about general properties and safety of such large-scale models, which we would like to encourage with this release, is still in progress. ## Training Procedure Please see [training notes](https://docs.google.com/document/d/1EFbMLRWSSV0LUf9Du1pWzWqgeiIRPwEWX2s1C6mAk5c) and [wandb logs](https://wandb.ai/rom1504/eval_openclip/reports/B-32-2B--VmlldzoyNDkwNDMy). # Evaluation Evaluation done with code in the [LAION CLIP Benchmark suite](https://github.com/LAION-AI/CLIP_benchmark). ## Testing Data, Factors & Metrics ### Testing Data The testing is performed with VTAB+ (A combination of VTAB (https://arxiv.org/abs/1910.04867) w/ additional robustness datasets) for classification and COCO and Flickr for retrieval. **TODO** - more detail ## Results The model achieves a 66.6 zero-shot top-1 accuracy on ImageNet-1k. An initial round of benchmarks have been performed on a wider range of datasets, currently viewable at https://github.com/LAION-AI/CLIP_benchmark/blob/main/benchmark/results.ipynb **TODO** - create table for just this model's metrics. # Acknowledgements Acknowledging [stability.ai](https://stability.ai/) for the compute used to train this model. # Citation **BibTeX:** In addition to forthcoming LAION-5B (https://laion.ai/blog/laion-5b/) paper, please cite: OpenAI CLIP paper ``` @inproceedings{Radford2021LearningTV, title={Learning Transferable Visual Models From Natural Language Supervision}, author={Alec Radford and Jong Wook Kim and Chris Hallacy and A. Ramesh and Gabriel Goh and Sandhini Agarwal and Girish Sastry and Amanda Askell and Pamela Mishkin and Jack Clark and Gretchen Krueger and Ilya Sutskever}, booktitle={ICML}, year={2021} } ``` OpenCLIP software ``` @software{ilharco_gabriel_2021_5143773, author = {Ilharco, Gabriel and Wortsman, Mitchell and Wightman, Ross and Gordon, Cade and Carlini, Nicholas and Taori, Rohan and Dave, Achal and Shankar, Vaishaal and Namkoong, Hongseok and Miller, John and Hajishirzi, Hannaneh and Farhadi, Ali and Schmidt, Ludwig}, title = {OpenCLIP}, month = jul, year = 2021, note = {If you use this software, please cite it as below.}, publisher = {Zenodo}, version = {0.1}, doi = {10.5281/zenodo.5143773}, url = {https://doi.org/10.5281/zenodo.5143773} } ``` # How to Get Started with the Model Use the code below to get started with the model. ** TODO ** - Hugging Face transformers, OpenCLIP, and timm getting started snippets

cardiffnlp/twitter-roberta-base-irony

cardiffnlp

transformers

text-classification

--- datasets: - tweet_eval language: - en --- # Twitter-roBERTa-base for Irony Detection This is a roBERTa-base model trained on ~58M tweets and finetuned for irony detection with the TweetEval benchmark. This model has integrated into the [TweetNLP Python library](https://github.com/cardiffnlp/tweetnlp/). - Paper: [_TweetEval_ benchmark (Findings of EMNLP 2020)](https://arxiv.org/pdf/2010.12421.pdf). - Git Repo: [Tweeteval official repository](https://github.com/cardiffnlp/tweeteval). ## Example of classification ```python from transformers import AutoModelForSequenceClassification from transformers import TFAutoModelForSequenceClassification from transformers import AutoTokenizer import numpy as np from scipy.special import softmax import csv import urllib.request # Preprocess text (username and link placeholders) def preprocess(text): new_text = [ ] for t in text.split(" "): t = '@user' if t.startswith('@') and len(t) > 1 else t t = 'http' if t.startswith('http') else t new_text.append(t) return " ".join(new_text) # Tasks: # emoji, emotion, hate, irony, offensive, sentiment # stance/abortion, stance/atheism, stance/climate, stance/feminist, stance/hillary task='irony' MODEL = f"cardiffnlp/twitter-roberta-base-{task}" tokenizer = AutoTokenizer.from_pretrained(MODEL) # download label mapping labels=[] mapping_link = f"https://raw.githubusercontent.com/cardiffnlp/tweeteval/main/datasets/{task}/mapping.txt" with urllib.request.urlopen(mapping_link) as f: html = f.read().decode('utf-8').split("\n") csvreader = csv.reader(html, delimiter='\t') labels = [row[1] for row in csvreader if len(row) > 1] # PT model = AutoModelForSequenceClassification.from_pretrained(MODEL) model.save_pretrained(MODEL) text = "Great, it broke the first day..." text = preprocess(text) encoded_input = tokenizer(text, return_tensors='pt') output = model(**encoded_input) scores = output[0][0].detach().numpy() scores = softmax(scores) # # TF # model = TFAutoModelForSequenceClassification.from_pretrained(MODEL) # model.save_pretrained(MODEL) # text = "Great, it broke the first day..." # encoded_input = tokenizer(text, return_tensors='tf') # output = model(encoded_input) # scores = output[0][0].numpy() # scores = softmax(scores) ranking = np.argsort(scores) ranking = ranking[::-1] for i in range(scores.shape[0]): l = labels[ranking[i]] s = scores[ranking[i]] print(f"{i+1}) {l} {np.round(float(s), 4)}") ``` Output: ``` 1) irony 0.914 2) non_irony 0.086 ``` ### Reference Please cite the [reference paper](https://aclanthology.org/2020.findings-emnlp.148/) if you use this model. ```bibtex @inproceedings{barbieri-etal-2020-tweeteval, title = "{T}weet{E}val: Unified Benchmark and Comparative Evaluation for Tweet Classification", author = "Barbieri, Francesco and Camacho-Collados, Jose and Espinosa Anke, Luis and Neves, Leonardo", booktitle = "Findings of the Association for Computational Linguistics: EMNLP 2020", month = nov, year = "2020", address = "Online", publisher = "Association for Computational Linguistics", url = "https://aclanthology.org/2020.findings-emnlp.148", doi = "10.18653/v1/2020.findings-emnlp.148", pages = "1644--1650" } ```