Datasets:

librarian-bots

/

model_cards_with_metadata

like 7

Salesforce/blip-image-captioning-large

Salesforce

transformers

image-to-text

--- pipeline_tag: image-to-text tags: - image-captioning languages: - en license: bsd-3-clause --- # BLIP: Bootstrapping Language-Image Pre-training for Unified Vision-Language Understanding and Generation Model card for image captioning pretrained on COCO dataset - base architecture (with ViT large backbone). |  | |:--:| | <b> Pull figure from BLIP official repo | Image source: https://github.com/salesforce/BLIP </b>| ## TL;DR Authors from the [paper](https://arxiv.org/abs/2201.12086) write in the abstract: *Vision-Language Pre-training (VLP) has advanced the performance for many vision-language tasks. However, most existing pre-trained models only excel in either understanding-based tasks or generation-based tasks. Furthermore, performance improvement has been largely achieved by scaling up the dataset with noisy image-text pairs collected from the web, which is a suboptimal source of supervision. In this paper, we propose BLIP, a new VLP framework which transfers flexibly to both vision-language understanding and generation tasks. BLIP effectively utilizes the noisy web data by bootstrapping the captions, where a captioner generates synthetic captions and a filter removes the noisy ones. We achieve state-of-the-art results on a wide range of vision-language tasks, such as image-text retrieval (+2.7% in average recall@1), image captioning (+2.8% in CIDEr), and VQA (+1.6% in VQA score). BLIP also demonstrates strong generalization ability when directly transferred to videolanguage tasks in a zero-shot manner. Code, models, and datasets are released.* ## Usage You can use this model for conditional and un-conditional image captioning ### Using the Pytorch model #### Running the model on CPU <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import BlipProcessor, BlipForConditionalGeneration processor = BlipProcessor.from_pretrained("Salesforce/blip-image-captioning-large") model = BlipForConditionalGeneration.from_pretrained("Salesforce/blip-image-captioning-large") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') # conditional image captioning text = "a photography of" inputs = processor(raw_image, text, return_tensors="pt") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) # unconditional image captioning inputs = processor(raw_image, return_tensors="pt") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) ``` </details> #### Running the model on GPU ##### In full precision <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import BlipProcessor, BlipForConditionalGeneration processor = BlipProcessor.from_pretrained("Salesforce/blip-image-captioning-large") model = BlipForConditionalGeneration.from_pretrained("Salesforce/blip-image-captioning-large").to("cuda") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') # conditional image captioning text = "a photography of" inputs = processor(raw_image, text, return_tensors="pt").to("cuda") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) # unconditional image captioning inputs = processor(raw_image, return_tensors="pt").to("cuda") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) ``` </details> ##### In half precision (`float16`) <details> <summary> Click to expand </summary> ```python import torch import requests from PIL import Image from transformers import BlipProcessor, BlipForConditionalGeneration processor = BlipProcessor.from_pretrained("Salesforce/blip-image-captioning-large") model = BlipForConditionalGeneration.from_pretrained("Salesforce/blip-image-captioning-large", torch_dtype=torch.float16).to("cuda") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') # conditional image captioning text = "a photography of" inputs = processor(raw_image, text, return_tensors="pt").to("cuda", torch.float16) out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) # >>> a photography of a woman and her dog # unconditional image captioning inputs = processor(raw_image, return_tensors="pt").to("cuda", torch.float16) out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) >>> a woman sitting on the beach with her dog ``` </details> ## BibTex and citation info ``` @misc{https://doi.org/10.48550/arxiv.2201.12086, doi = {10.48550/ARXIV.2201.12086}, url = {https://arxiv.org/abs/2201.12086}, author = {Li, Junnan and Li, Dongxu and Xiong, Caiming and Hoi, Steven}, keywords = {Computer Vision and Pattern Recognition (cs.CV), FOS: Computer and information sciences, FOS: Computer and information sciences}, title = {BLIP: Bootstrapping Language-Image Pre-training for Unified Vision-Language Understanding and Generation}, publisher = {arXiv}, year = {2022}, copyright = {Creative Commons Attribution 4.0 International} } ```

nlptown/bert-base-multilingual-uncased-sentiment

nlptown

transformers

text-classification

--- language: - en - nl - de - fr - it - es license: mit --- # bert-base-multilingual-uncased-sentiment This is a bert-base-multilingual-uncased model finetuned for sentiment analysis on product reviews in six languages: English, Dutch, German, French, Spanish, and Italian. It predicts the sentiment of the review as a number of stars (between 1 and 5). This model is intended for direct use as a sentiment analysis model for product reviews in any of the six languages above or for further finetuning on related sentiment analysis tasks. ## Training data Here is the number of product reviews we used for finetuning the model: | Language | Number of reviews | | -------- | ----------------- | | English | 150k | | Dutch | 80k | | German | 137k | | French | 140k | | Italian | 72k | | Spanish | 50k | ## Accuracy The fine-tuned model obtained the following accuracy on 5,000 held-out product reviews in each of the languages: - Accuracy (exact) is the exact match for the number of stars. - Accuracy (off-by-1) is the percentage of reviews where the number of stars the model predicts differs by a maximum of 1 from the number given by the human reviewer. | Language | Accuracy (exact) | Accuracy (off-by-1) | | -------- | ---------------------- | ------------------- | | English | 67% | 95% | Dutch | 57% | 93% | German | 61% | 94% | French | 59% | 94% | Italian | 59% | 95% | Spanish | 58% | 95% ## Contact If you found this model useful, you can buy me a coffee at https://www.buymeacoffee.com/yvespeirsman. In addition to this model, [NLP Town](http://nlp.town) offers custom models for many languages and NLP tasks. Feel free to contact me for questions, feedback and/or requests for similar models.

dslim/bert-base-NER

dslim

transformers

token-classification

--- language: en datasets: - conll2003 license: mit model-index: - name: dslim/bert-base-NER results: - task: type: token-classification name: Token Classification dataset: name: conll2003 type: conll2003 config: conll2003 split: test metrics: - name: Accuracy type: accuracy value: 0.9118041001560013 verified: true - name: Precision type: precision value: 0.9211550382257732 verified: true - name: Recall type: recall value: 0.9306415698281261 verified: true - name: F1 type: f1 value: 0.9258740048459675 verified: true - name: loss type: loss value: 0.48325642943382263 verified: true --- # bert-base-NER ## Model description **bert-base-NER** is a fine-tuned BERT model that is ready to use for **Named Entity Recognition** and achieves **state-of-the-art performance** for the NER task. It has been trained to recognize four types of entities: location (LOC), organizations (ORG), person (PER) and Miscellaneous (MISC). Specifically, this model is a *bert-base-cased* model that was fine-tuned on the English version of the standard [CoNLL-2003 Named Entity Recognition](https://www.aclweb.org/anthology/W03-0419.pdf) dataset. If you'd like to use a larger BERT-large model fine-tuned on the same dataset, a [**bert-large-NER**](https://huggingface.co/dslim/bert-large-NER/) version is also available. ### Available NER models | Model Name | Description | Parameters | |-------------------|-------------|------------------| | [distilbert-NER](https://huggingface.co/dslim/distilbert-NER) **(NEW!)** | Fine-tuned DistilBERT - a smaller, faster, lighter version of BERT | 66M | | [bert-large-NER](https://huggingface.co/dslim/bert-large-NER/) | Fine-tuned bert-large-cased - larger model with slightly better performance | 340M | | [bert-base-NER](https://huggingface.co/dslim/bert-base-NER)-([uncased](https://huggingface.co/dslim/bert-base-NER-uncased)) | Fine-tuned bert-base, available in both cased and uncased versions | 110M | ## Intended uses & limitations #### How to use You can use this model with Transformers *pipeline* for NER. ```python from transformers import AutoTokenizer, AutoModelForTokenClassification from transformers import pipeline tokenizer = AutoTokenizer.from_pretrained("dslim/bert-base-NER") model = AutoModelForTokenClassification.from_pretrained("dslim/bert-base-NER") nlp = pipeline("ner", model=model, tokenizer=tokenizer) example = "My name is Wolfgang and I live in Berlin" ner_results = nlp(example) print(ner_results) ``` #### Limitations and bias This model is limited by its training dataset of entity-annotated news articles from a specific span of time. This may not generalize well for all use cases in different domains. Furthermore, the model occassionally tags subword tokens as entities and post-processing of results may be necessary to handle those cases. ## Training data This model was fine-tuned on English version of the standard [CoNLL-2003 Named Entity Recognition](https://www.aclweb.org/anthology/W03-0419.pdf) dataset. The training dataset distinguishes between the beginning and continuation of an entity so that if there are back-to-back entities of the same type, the model can output where the second entity begins. As in the dataset, each token will be classified as one of the following classes: Abbreviation|Description -|- O|Outside of a named entity B-MISC |Beginning of a miscellaneous entity right after another miscellaneous entity I-MISC | Miscellaneous entity B-PER |Beginning of a person’s name right after another person’s name I-PER |Person’s name B-ORG |Beginning of an organization right after another organization I-ORG |organization B-LOC |Beginning of a location right after another location I-LOC |Location ### CoNLL-2003 English Dataset Statistics This dataset was derived from the Reuters corpus which consists of Reuters news stories. You can read more about how this dataset was created in the CoNLL-2003 paper. #### # of training examples per entity type Dataset|LOC|MISC|ORG|PER -|-|-|-|- Train|7140|3438|6321|6600 Dev|1837|922|1341|1842 Test|1668|702|1661|1617 #### # of articles/sentences/tokens per dataset Dataset |Articles |Sentences |Tokens -|-|-|- Train |946 |14,987 |203,621 Dev |216 |3,466 |51,362 Test |231 |3,684 |46,435 ## Training procedure This model was trained on a single NVIDIA V100 GPU with recommended hyperparameters from the [original BERT paper](https://arxiv.org/pdf/1810.04805) which trained & evaluated the model on CoNLL-2003 NER task. ## Eval results metric|dev|test -|-|- f1 |95.1 |91.3 precision |95.0 |90.7 recall |95.3 |91.9 The test metrics are a little lower than the official Google BERT results which encoded document context & experimented with CRF. More on replicating the original results [here](https://github.com/google-research/bert/issues/223). ### BibTeX entry and citation info ``` @article{DBLP:journals/corr/abs-1810-04805, author = {Jacob Devlin and Ming{-}Wei Chang and Kenton Lee and Kristina Toutanova}, title = {{BERT:} Pre-training of Deep Bidirectional Transformers for Language Understanding}, journal = {CoRR}, volume = {abs/1810.04805}, year = {2018}, url = {http://arxiv.org/abs/1810.04805}, archivePrefix = {arXiv}, eprint = {1810.04805}, timestamp = {Tue, 30 Oct 2018 20:39:56 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1810-04805.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ``` ``` @inproceedings{tjong-kim-sang-de-meulder-2003-introduction, title = "Introduction to the {C}o{NLL}-2003 Shared Task: Language-Independent Named Entity Recognition", author = "Tjong Kim Sang, Erik F. and De Meulder, Fien", booktitle = "Proceedings of the Seventh Conference on Natural Language Learning at {HLT}-{NAACL} 2003", year = "2003", url = "https://www.aclweb.org/anthology/W03-0419", pages = "142--147", } ```

BAAI/bge-small-en-v1.5

BAAI

sentence-transformers

feature-extraction

--- tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers - mteb model-index: - name: bge-small-en-v1.5 results: - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en) config: en split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 73.79104477611939 - type: ap value: 37.21923821573361 - type: f1 value: 68.0914945617093 - task: type: Classification dataset: type: mteb/amazon_polarity name: MTEB AmazonPolarityClassification config: default split: test revision: e2d317d38cd51312af73b3d32a06d1a08b442046 metrics: - type: accuracy value: 92.75377499999999 - type: ap value: 89.46766124546022 - type: f1 value: 92.73884001331487 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (en) config: en split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 46.986 - type: f1 value: 46.55936786727896 - task: type: Retrieval dataset: type: arguana name: MTEB ArguAna config: default split: test revision: None metrics: - type: map_at_1 value: 35.846000000000004 - type: map_at_10 value: 51.388 - type: map_at_100 value: 52.132999999999996 - type: map_at_1000 value: 52.141000000000005 - type: map_at_3 value: 47.037 - type: map_at_5 value: 49.579 - type: mrr_at_1 value: 36.558 - type: mrr_at_10 value: 51.658 - type: mrr_at_100 value: 52.402 - type: mrr_at_1000 value: 52.410000000000004 - type: mrr_at_3 value: 47.345 - type: mrr_at_5 value: 49.797999999999995 - type: ndcg_at_1 value: 35.846000000000004 - type: ndcg_at_10 value: 59.550000000000004 - type: ndcg_at_100 value: 62.596 - type: ndcg_at_1000 value: 62.759 - type: ndcg_at_3 value: 50.666999999999994 - type: ndcg_at_5 value: 55.228 - type: precision_at_1 value: 35.846000000000004 - type: precision_at_10 value: 8.542 - type: precision_at_100 value: 0.984 - type: precision_at_1000 value: 0.1 - type: precision_at_3 value: 20.389 - type: precision_at_5 value: 14.438 - type: recall_at_1 value: 35.846000000000004 - type: recall_at_10 value: 85.42 - type: recall_at_100 value: 98.43499999999999 - type: recall_at_1000 value: 99.644 - type: recall_at_3 value: 61.166 - type: recall_at_5 value: 72.191 - task: type: Clustering dataset: type: mteb/arxiv-clustering-p2p name: MTEB ArxivClusteringP2P config: default split: test revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d metrics: - type: v_measure value: 47.402770198163594 - task: type: Clustering dataset: type: mteb/arxiv-clustering-s2s name: MTEB ArxivClusteringS2S config: default split: test revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 metrics: - type: v_measure value: 40.01545436974177 - task: type: Reranking dataset: type: mteb/askubuntudupquestions-reranking name: MTEB AskUbuntuDupQuestions config: default split: test revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 metrics: - type: map value: 62.586465273207196 - type: mrr value: 74.42169019038825 - task: type: STS dataset: type: mteb/biosses-sts name: MTEB BIOSSES config: default split: test revision: d3fb88f8f02e40887cd149695127462bbcf29b4a metrics: - type: cos_sim_pearson value: 85.1891186537969 - type: cos_sim_spearman value: 83.75492046087288 - type: euclidean_pearson value: 84.11766204805357 - type: euclidean_spearman value: 84.01456493126516 - type: manhattan_pearson value: 84.2132950502772 - type: manhattan_spearman value: 83.89227298813377 - task: type: Classification dataset: type: mteb/banking77 name: MTEB Banking77Classification config: default split: test revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 metrics: - type: accuracy value: 85.74025974025975 - type: f1 value: 85.71493566466381 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-p2p name: MTEB BiorxivClusteringP2P config: default split: test revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 metrics: - type: v_measure value: 38.467181385006434 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-s2s name: MTEB BiorxivClusteringS2S config: default split: test revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 metrics: - type: v_measure value: 34.719496037339056 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackAndroidRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 29.587000000000003 - type: map_at_10 value: 41.114 - type: map_at_100 value: 42.532 - type: map_at_1000 value: 42.661 - type: map_at_3 value: 37.483 - type: map_at_5 value: 39.652 - type: mrr_at_1 value: 36.338 - type: mrr_at_10 value: 46.763 - type: mrr_at_100 value: 47.393 - type: mrr_at_1000 value: 47.445 - type: mrr_at_3 value: 43.538 - type: mrr_at_5 value: 45.556000000000004 - type: ndcg_at_1 value: 36.338 - type: ndcg_at_10 value: 47.658 - type: ndcg_at_100 value: 52.824000000000005 - type: ndcg_at_1000 value: 54.913999999999994 - type: ndcg_at_3 value: 41.989 - type: ndcg_at_5 value: 44.944 - type: precision_at_1 value: 36.338 - type: precision_at_10 value: 9.156 - type: precision_at_100 value: 1.4789999999999999 - type: precision_at_1000 value: 0.196 - type: precision_at_3 value: 20.076 - type: precision_at_5 value: 14.85 - type: recall_at_1 value: 29.587000000000003 - type: recall_at_10 value: 60.746 - type: recall_at_100 value: 82.157 - type: recall_at_1000 value: 95.645 - type: recall_at_3 value: 44.821 - type: recall_at_5 value: 52.819 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackEnglishRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 30.239 - type: map_at_10 value: 39.989000000000004 - type: map_at_100 value: 41.196 - type: map_at_1000 value: 41.325 - type: map_at_3 value: 37.261 - type: map_at_5 value: 38.833 - type: mrr_at_1 value: 37.516 - type: mrr_at_10 value: 46.177 - type: mrr_at_100 value: 46.806 - type: mrr_at_1000 value: 46.849000000000004 - type: mrr_at_3 value: 44.002 - type: mrr_at_5 value: 45.34 - type: ndcg_at_1 value: 37.516 - type: ndcg_at_10 value: 45.586 - type: ndcg_at_100 value: 49.897000000000006 - type: ndcg_at_1000 value: 51.955 - type: ndcg_at_3 value: 41.684 - type: ndcg_at_5 value: 43.617 - type: precision_at_1 value: 37.516 - type: precision_at_10 value: 8.522 - type: precision_at_100 value: 1.374 - type: precision_at_1000 value: 0.184 - type: precision_at_3 value: 20.105999999999998 - type: precision_at_5 value: 14.152999999999999 - type: recall_at_1 value: 30.239 - type: recall_at_10 value: 55.03 - type: recall_at_100 value: 73.375 - type: recall_at_1000 value: 86.29599999999999 - type: recall_at_3 value: 43.269000000000005 - type: recall_at_5 value: 48.878 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGamingRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 38.338 - type: map_at_10 value: 50.468999999999994 - type: map_at_100 value: 51.553000000000004 - type: map_at_1000 value: 51.608 - type: map_at_3 value: 47.107 - type: map_at_5 value: 49.101 - type: mrr_at_1 value: 44.201 - type: mrr_at_10 value: 54.057 - type: mrr_at_100 value: 54.764 - type: mrr_at_1000 value: 54.791000000000004 - type: mrr_at_3 value: 51.56699999999999 - type: mrr_at_5 value: 53.05 - type: ndcg_at_1 value: 44.201 - type: ndcg_at_10 value: 56.379000000000005 - type: ndcg_at_100 value: 60.645 - type: ndcg_at_1000 value: 61.73499999999999 - type: ndcg_at_3 value: 50.726000000000006 - type: ndcg_at_5 value: 53.58500000000001 - type: precision_at_1 value: 44.201 - type: precision_at_10 value: 9.141 - type: precision_at_100 value: 1.216 - type: precision_at_1000 value: 0.135 - type: precision_at_3 value: 22.654 - type: precision_at_5 value: 15.723999999999998 - type: recall_at_1 value: 38.338 - type: recall_at_10 value: 70.30499999999999 - type: recall_at_100 value: 88.77199999999999 - type: recall_at_1000 value: 96.49799999999999 - type: recall_at_3 value: 55.218 - type: recall_at_5 value: 62.104000000000006 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGisRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 25.682 - type: map_at_10 value: 33.498 - type: map_at_100 value: 34.461000000000006 - type: map_at_1000 value: 34.544000000000004 - type: map_at_3 value: 30.503999999999998 - type: map_at_5 value: 32.216 - type: mrr_at_1 value: 27.683999999999997 - type: mrr_at_10 value: 35.467999999999996 - type: mrr_at_100 value: 36.32 - type: mrr_at_1000 value: 36.386 - type: mrr_at_3 value: 32.618 - type: mrr_at_5 value: 34.262 - type: ndcg_at_1 value: 27.683999999999997 - type: ndcg_at_10 value: 38.378 - type: ndcg_at_100 value: 43.288 - type: ndcg_at_1000 value: 45.413 - type: ndcg_at_3 value: 32.586 - type: ndcg_at_5 value: 35.499 - type: precision_at_1 value: 27.683999999999997 - type: precision_at_10 value: 5.864 - type: precision_at_100 value: 0.882 - type: precision_at_1000 value: 0.11 - type: precision_at_3 value: 13.446 - type: precision_at_5 value: 9.718 - type: recall_at_1 value: 25.682 - type: recall_at_10 value: 51.712 - type: recall_at_100 value: 74.446 - type: recall_at_1000 value: 90.472 - type: recall_at_3 value: 36.236000000000004 - type: recall_at_5 value: 43.234 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackMathematicaRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 16.073999999999998 - type: map_at_10 value: 24.352999999999998 - type: map_at_100 value: 25.438 - type: map_at_1000 value: 25.545 - type: map_at_3 value: 21.614 - type: map_at_5 value: 23.104 - type: mrr_at_1 value: 19.776 - type: mrr_at_10 value: 28.837000000000003 - type: mrr_at_100 value: 29.755 - type: mrr_at_1000 value: 29.817 - type: mrr_at_3 value: 26.201999999999998 - type: mrr_at_5 value: 27.714 - type: ndcg_at_1 value: 19.776 - type: ndcg_at_10 value: 29.701 - type: ndcg_at_100 value: 35.307 - type: ndcg_at_1000 value: 37.942 - type: ndcg_at_3 value: 24.764 - type: ndcg_at_5 value: 27.025 - type: precision_at_1 value: 19.776 - type: precision_at_10 value: 5.659 - type: precision_at_100 value: 0.971 - type: precision_at_1000 value: 0.133 - type: precision_at_3 value: 12.065 - type: precision_at_5 value: 8.905000000000001 - type: recall_at_1 value: 16.073999999999998 - type: recall_at_10 value: 41.647 - type: recall_at_100 value: 66.884 - type: recall_at_1000 value: 85.91499999999999 - type: recall_at_3 value: 27.916 - type: recall_at_5 value: 33.729 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackPhysicsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 28.444999999999997 - type: map_at_10 value: 38.218999999999994 - type: map_at_100 value: 39.595 - type: map_at_1000 value: 39.709 - type: map_at_3 value: 35.586 - type: map_at_5 value: 36.895 - type: mrr_at_1 value: 34.841 - type: mrr_at_10 value: 44.106 - type: mrr_at_100 value: 44.98 - type: mrr_at_1000 value: 45.03 - type: mrr_at_3 value: 41.979 - type: mrr_at_5 value: 43.047999999999995 - type: ndcg_at_1 value: 34.841 - type: ndcg_at_10 value: 43.922 - type: ndcg_at_100 value: 49.504999999999995 - type: ndcg_at_1000 value: 51.675000000000004 - type: ndcg_at_3 value: 39.858 - type: ndcg_at_5 value: 41.408 - type: precision_at_1 value: 34.841 - type: precision_at_10 value: 7.872999999999999 - type: precision_at_100 value: 1.2449999999999999 - type: precision_at_1000 value: 0.161 - type: precision_at_3 value: 18.993 - type: precision_at_5 value: 13.032 - type: recall_at_1 value: 28.444999999999997 - type: recall_at_10 value: 54.984 - type: recall_at_100 value: 78.342 - type: recall_at_1000 value: 92.77 - type: recall_at_3 value: 42.842999999999996 - type: recall_at_5 value: 47.247 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackProgrammersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 23.072 - type: map_at_10 value: 32.354 - type: map_at_100 value: 33.800000000000004 - type: map_at_1000 value: 33.908 - type: map_at_3 value: 29.232000000000003 - type: map_at_5 value: 31.049 - type: mrr_at_1 value: 29.110000000000003 - type: mrr_at_10 value: 38.03 - type: mrr_at_100 value: 39.032 - type: mrr_at_1000 value: 39.086999999999996 - type: mrr_at_3 value: 35.407 - type: mrr_at_5 value: 36.76 - type: ndcg_at_1 value: 29.110000000000003 - type: ndcg_at_10 value: 38.231 - type: ndcg_at_100 value: 44.425 - type: ndcg_at_1000 value: 46.771 - type: ndcg_at_3 value: 33.095 - type: ndcg_at_5 value: 35.459 - type: precision_at_1 value: 29.110000000000003 - type: precision_at_10 value: 7.215000000000001 - type: precision_at_100 value: 1.2109999999999999 - type: precision_at_1000 value: 0.157 - type: precision_at_3 value: 16.058 - type: precision_at_5 value: 11.644 - type: recall_at_1 value: 23.072 - type: recall_at_10 value: 50.285999999999994 - type: recall_at_100 value: 76.596 - type: recall_at_1000 value: 92.861 - type: recall_at_3 value: 35.702 - type: recall_at_5 value: 42.152 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 24.937916666666666 - type: map_at_10 value: 33.755250000000004 - type: map_at_100 value: 34.955999999999996 - type: map_at_1000 value: 35.070499999999996 - type: map_at_3 value: 30.98708333333333 - type: map_at_5 value: 32.51491666666666 - type: mrr_at_1 value: 29.48708333333333 - type: mrr_at_10 value: 37.92183333333334 - type: mrr_at_100 value: 38.76583333333333 - type: mrr_at_1000 value: 38.82466666666667 - type: mrr_at_3 value: 35.45125 - type: mrr_at_5 value: 36.827000000000005 - type: ndcg_at_1 value: 29.48708333333333 - type: ndcg_at_10 value: 39.05225 - type: ndcg_at_100 value: 44.25983333333334 - type: ndcg_at_1000 value: 46.568333333333335 - type: ndcg_at_3 value: 34.271583333333325 - type: ndcg_at_5 value: 36.483916666666666 - type: precision_at_1 value: 29.48708333333333 - type: precision_at_10 value: 6.865749999999999 - type: precision_at_100 value: 1.1195833333333332 - type: precision_at_1000 value: 0.15058333333333335 - type: precision_at_3 value: 15.742083333333333 - type: precision_at_5 value: 11.221916666666667 - type: recall_at_1 value: 24.937916666666666 - type: recall_at_10 value: 50.650416666666665 - type: recall_at_100 value: 73.55383333333334 - type: recall_at_1000 value: 89.61691666666667 - type: recall_at_3 value: 37.27808333333334 - type: recall_at_5 value: 42.99475 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackStatsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 23.947 - type: map_at_10 value: 30.575000000000003 - type: map_at_100 value: 31.465 - type: map_at_1000 value: 31.558000000000003 - type: map_at_3 value: 28.814 - type: map_at_5 value: 29.738999999999997 - type: mrr_at_1 value: 26.994 - type: mrr_at_10 value: 33.415 - type: mrr_at_100 value: 34.18 - type: mrr_at_1000 value: 34.245 - type: mrr_at_3 value: 31.621 - type: mrr_at_5 value: 32.549 - type: ndcg_at_1 value: 26.994 - type: ndcg_at_10 value: 34.482 - type: ndcg_at_100 value: 38.915 - type: ndcg_at_1000 value: 41.355 - type: ndcg_at_3 value: 31.139 - type: ndcg_at_5 value: 32.589 - type: precision_at_1 value: 26.994 - type: precision_at_10 value: 5.322 - type: precision_at_100 value: 0.8160000000000001 - type: precision_at_1000 value: 0.11100000000000002 - type: precision_at_3 value: 13.344000000000001 - type: precision_at_5 value: 8.988 - type: recall_at_1 value: 23.947 - type: recall_at_10 value: 43.647999999999996 - type: recall_at_100 value: 63.851 - type: recall_at_1000 value: 82.0 - type: recall_at_3 value: 34.288000000000004 - type: recall_at_5 value: 38.117000000000004 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackTexRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 16.197 - type: map_at_10 value: 22.968 - type: map_at_100 value: 24.095 - type: map_at_1000 value: 24.217 - type: map_at_3 value: 20.771 - type: map_at_5 value: 21.995 - type: mrr_at_1 value: 19.511 - type: mrr_at_10 value: 26.55 - type: mrr_at_100 value: 27.500999999999998 - type: mrr_at_1000 value: 27.578999999999997 - type: mrr_at_3 value: 24.421 - type: mrr_at_5 value: 25.604 - type: ndcg_at_1 value: 19.511 - type: ndcg_at_10 value: 27.386 - type: ndcg_at_100 value: 32.828 - type: ndcg_at_1000 value: 35.739 - type: ndcg_at_3 value: 23.405 - type: ndcg_at_5 value: 25.255 - type: precision_at_1 value: 19.511 - type: precision_at_10 value: 5.017 - type: precision_at_100 value: 0.91 - type: precision_at_1000 value: 0.133 - type: precision_at_3 value: 11.023 - type: precision_at_5 value: 8.025 - type: recall_at_1 value: 16.197 - type: recall_at_10 value: 37.09 - type: recall_at_100 value: 61.778 - type: recall_at_1000 value: 82.56599999999999 - type: recall_at_3 value: 26.034000000000002 - type: recall_at_5 value: 30.762 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackUnixRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 25.41 - type: map_at_10 value: 33.655 - type: map_at_100 value: 34.892 - type: map_at_1000 value: 34.995 - type: map_at_3 value: 30.94 - type: map_at_5 value: 32.303 - type: mrr_at_1 value: 29.477999999999998 - type: mrr_at_10 value: 37.443 - type: mrr_at_100 value: 38.383 - type: mrr_at_1000 value: 38.440000000000005 - type: mrr_at_3 value: 34.949999999999996 - type: mrr_at_5 value: 36.228 - type: ndcg_at_1 value: 29.477999999999998 - type: ndcg_at_10 value: 38.769 - type: ndcg_at_100 value: 44.245000000000005 - type: ndcg_at_1000 value: 46.593 - type: ndcg_at_3 value: 33.623 - type: ndcg_at_5 value: 35.766 - type: precision_at_1 value: 29.477999999999998 - type: precision_at_10 value: 6.455 - type: precision_at_100 value: 1.032 - type: precision_at_1000 value: 0.135 - type: precision_at_3 value: 14.893999999999998 - type: precision_at_5 value: 10.485 - type: recall_at_1 value: 25.41 - type: recall_at_10 value: 50.669 - type: recall_at_100 value: 74.084 - type: recall_at_1000 value: 90.435 - type: recall_at_3 value: 36.679 - type: recall_at_5 value: 41.94 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWebmastersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 23.339 - type: map_at_10 value: 31.852000000000004 - type: map_at_100 value: 33.411 - type: map_at_1000 value: 33.62 - type: map_at_3 value: 28.929 - type: map_at_5 value: 30.542 - type: mrr_at_1 value: 28.063 - type: mrr_at_10 value: 36.301 - type: mrr_at_100 value: 37.288 - type: mrr_at_1000 value: 37.349 - type: mrr_at_3 value: 33.663 - type: mrr_at_5 value: 35.165 - type: ndcg_at_1 value: 28.063 - type: ndcg_at_10 value: 37.462 - type: ndcg_at_100 value: 43.620999999999995 - type: ndcg_at_1000 value: 46.211 - type: ndcg_at_3 value: 32.68 - type: ndcg_at_5 value: 34.981 - type: precision_at_1 value: 28.063 - type: precision_at_10 value: 7.1739999999999995 - type: precision_at_100 value: 1.486 - type: precision_at_1000 value: 0.23500000000000001 - type: precision_at_3 value: 15.217 - type: precision_at_5 value: 11.265 - type: recall_at_1 value: 23.339 - type: recall_at_10 value: 48.376999999999995 - type: recall_at_100 value: 76.053 - type: recall_at_1000 value: 92.455 - type: recall_at_3 value: 34.735 - type: recall_at_5 value: 40.71 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWordpressRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 18.925 - type: map_at_10 value: 26.017000000000003 - type: map_at_100 value: 27.034000000000002 - type: map_at_1000 value: 27.156000000000002 - type: map_at_3 value: 23.604 - type: map_at_5 value: 24.75 - type: mrr_at_1 value: 20.333000000000002 - type: mrr_at_10 value: 27.915 - type: mrr_at_100 value: 28.788000000000004 - type: mrr_at_1000 value: 28.877999999999997 - type: mrr_at_3 value: 25.446999999999996 - type: mrr_at_5 value: 26.648 - type: ndcg_at_1 value: 20.333000000000002 - type: ndcg_at_10 value: 30.673000000000002 - type: ndcg_at_100 value: 35.618 - type: ndcg_at_1000 value: 38.517 - type: ndcg_at_3 value: 25.71 - type: ndcg_at_5 value: 27.679 - type: precision_at_1 value: 20.333000000000002 - type: precision_at_10 value: 4.9910000000000005 - type: precision_at_100 value: 0.8130000000000001 - type: precision_at_1000 value: 0.117 - type: precision_at_3 value: 11.029 - type: precision_at_5 value: 7.8740000000000006 - type: recall_at_1 value: 18.925 - type: recall_at_10 value: 43.311 - type: recall_at_100 value: 66.308 - type: recall_at_1000 value: 87.49 - type: recall_at_3 value: 29.596 - type: recall_at_5 value: 34.245 - task: type: Retrieval dataset: type: climate-fever name: MTEB ClimateFEVER config: default split: test revision: None metrics: - type: map_at_1 value: 13.714 - type: map_at_10 value: 23.194 - type: map_at_100 value: 24.976000000000003 - type: map_at_1000 value: 25.166 - type: map_at_3 value: 19.709 - type: map_at_5 value: 21.523999999999997 - type: mrr_at_1 value: 30.619000000000003 - type: mrr_at_10 value: 42.563 - type: mrr_at_100 value: 43.386 - type: mrr_at_1000 value: 43.423 - type: mrr_at_3 value: 39.555 - type: mrr_at_5 value: 41.268 - type: ndcg_at_1 value: 30.619000000000003 - type: ndcg_at_10 value: 31.836 - type: ndcg_at_100 value: 38.652 - type: ndcg_at_1000 value: 42.088 - type: ndcg_at_3 value: 26.733 - type: ndcg_at_5 value: 28.435 - type: precision_at_1 value: 30.619000000000003 - type: precision_at_10 value: 9.751999999999999 - type: precision_at_100 value: 1.71 - type: precision_at_1000 value: 0.23500000000000001 - type: precision_at_3 value: 19.935 - type: precision_at_5 value: 14.984 - type: recall_at_1 value: 13.714 - type: recall_at_10 value: 37.26 - type: recall_at_100 value: 60.546 - type: recall_at_1000 value: 79.899 - type: recall_at_3 value: 24.325 - type: recall_at_5 value: 29.725 - task: type: Retrieval dataset: type: dbpedia-entity name: MTEB DBPedia config: default split: test revision: None metrics: - type: map_at_1 value: 8.462 - type: map_at_10 value: 18.637 - type: map_at_100 value: 26.131999999999998 - type: map_at_1000 value: 27.607 - type: map_at_3 value: 13.333 - type: map_at_5 value: 15.654000000000002 - type: mrr_at_1 value: 66.25 - type: mrr_at_10 value: 74.32600000000001 - type: mrr_at_100 value: 74.60900000000001 - type: mrr_at_1000 value: 74.62 - type: mrr_at_3 value: 72.667 - type: mrr_at_5 value: 73.817 - type: ndcg_at_1 value: 53.87499999999999 - type: ndcg_at_10 value: 40.028999999999996 - type: ndcg_at_100 value: 44.199 - type: ndcg_at_1000 value: 51.629999999999995 - type: ndcg_at_3 value: 44.113 - type: ndcg_at_5 value: 41.731 - type: precision_at_1 value: 66.25 - type: precision_at_10 value: 31.900000000000002 - type: precision_at_100 value: 10.043000000000001 - type: precision_at_1000 value: 1.926 - type: precision_at_3 value: 47.417 - type: precision_at_5 value: 40.65 - type: recall_at_1 value: 8.462 - type: recall_at_10 value: 24.293 - type: recall_at_100 value: 50.146 - type: recall_at_1000 value: 74.034 - type: recall_at_3 value: 14.967 - type: recall_at_5 value: 18.682000000000002 - task: type: Classification dataset: type: mteb/emotion name: MTEB EmotionClassification config: default split: test revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 metrics: - type: accuracy value: 47.84499999999999 - type: f1 value: 42.48106691979349 - task: type: Retrieval dataset: type: fever name: MTEB FEVER config: default split: test revision: None metrics: - type: map_at_1 value: 74.034 - type: map_at_10 value: 82.76 - type: map_at_100 value: 82.968 - type: map_at_1000 value: 82.98299999999999 - type: map_at_3 value: 81.768 - type: map_at_5 value: 82.418 - type: mrr_at_1 value: 80.048 - type: mrr_at_10 value: 87.64999999999999 - type: mrr_at_100 value: 87.712 - type: mrr_at_1000 value: 87.713 - type: mrr_at_3 value: 87.01100000000001 - type: mrr_at_5 value: 87.466 - type: ndcg_at_1 value: 80.048 - type: ndcg_at_10 value: 86.643 - type: ndcg_at_100 value: 87.361 - type: ndcg_at_1000 value: 87.606 - type: ndcg_at_3 value: 85.137 - type: ndcg_at_5 value: 86.016 - type: precision_at_1 value: 80.048 - type: precision_at_10 value: 10.372 - type: precision_at_100 value: 1.093 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 32.638 - type: precision_at_5 value: 20.177 - type: recall_at_1 value: 74.034 - type: recall_at_10 value: 93.769 - type: recall_at_100 value: 96.569 - type: recall_at_1000 value: 98.039 - type: recall_at_3 value: 89.581 - type: recall_at_5 value: 91.906 - task: type: Retrieval dataset: type: fiqa name: MTEB FiQA2018 config: default split: test revision: None metrics: - type: map_at_1 value: 20.5 - type: map_at_10 value: 32.857 - type: map_at_100 value: 34.589 - type: map_at_1000 value: 34.778 - type: map_at_3 value: 29.160999999999998 - type: map_at_5 value: 31.033 - type: mrr_at_1 value: 40.123 - type: mrr_at_10 value: 48.776 - type: mrr_at_100 value: 49.495 - type: mrr_at_1000 value: 49.539 - type: mrr_at_3 value: 46.605000000000004 - type: mrr_at_5 value: 47.654 - type: ndcg_at_1 value: 40.123 - type: ndcg_at_10 value: 40.343 - type: ndcg_at_100 value: 46.56 - type: ndcg_at_1000 value: 49.777 - type: ndcg_at_3 value: 37.322 - type: ndcg_at_5 value: 37.791000000000004 - type: precision_at_1 value: 40.123 - type: precision_at_10 value: 11.08 - type: precision_at_100 value: 1.752 - type: precision_at_1000 value: 0.232 - type: precision_at_3 value: 24.897 - type: precision_at_5 value: 17.809 - type: recall_at_1 value: 20.5 - type: recall_at_10 value: 46.388 - type: recall_at_100 value: 69.552 - type: recall_at_1000 value: 89.011 - type: recall_at_3 value: 33.617999999999995 - type: recall_at_5 value: 38.211 - task: type: Retrieval dataset: type: hotpotqa name: MTEB HotpotQA config: default split: test revision: None metrics: - type: map_at_1 value: 39.135999999999996 - type: map_at_10 value: 61.673 - type: map_at_100 value: 62.562 - type: map_at_1000 value: 62.62 - type: map_at_3 value: 58.467999999999996 - type: map_at_5 value: 60.463 - type: mrr_at_1 value: 78.271 - type: mrr_at_10 value: 84.119 - type: mrr_at_100 value: 84.29299999999999 - type: mrr_at_1000 value: 84.299 - type: mrr_at_3 value: 83.18900000000001 - type: mrr_at_5 value: 83.786 - type: ndcg_at_1 value: 78.271 - type: ndcg_at_10 value: 69.935 - type: ndcg_at_100 value: 73.01299999999999 - type: ndcg_at_1000 value: 74.126 - type: ndcg_at_3 value: 65.388 - type: ndcg_at_5 value: 67.906 - type: precision_at_1 value: 78.271 - type: precision_at_10 value: 14.562 - type: precision_at_100 value: 1.6969999999999998 - type: precision_at_1000 value: 0.184 - type: precision_at_3 value: 41.841 - type: precision_at_5 value: 27.087 - type: recall_at_1 value: 39.135999999999996 - type: recall_at_10 value: 72.809 - type: recall_at_100 value: 84.86200000000001 - type: recall_at_1000 value: 92.208 - type: recall_at_3 value: 62.76199999999999 - type: recall_at_5 value: 67.718 - task: type: Classification dataset: type: mteb/imdb name: MTEB ImdbClassification config: default split: test revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 metrics: - type: accuracy value: 90.60600000000001 - type: ap value: 86.6579587804335 - type: f1 value: 90.5938853929307 - task: type: Retrieval dataset: type: msmarco name: MTEB MSMARCO config: default split: dev revision: None metrics: - type: map_at_1 value: 21.852 - type: map_at_10 value: 33.982 - type: map_at_100 value: 35.116 - type: map_at_1000 value: 35.167 - type: map_at_3 value: 30.134 - type: map_at_5 value: 32.340999999999994 - type: mrr_at_1 value: 22.479 - type: mrr_at_10 value: 34.594 - type: mrr_at_100 value: 35.672 - type: mrr_at_1000 value: 35.716 - type: mrr_at_3 value: 30.84 - type: mrr_at_5 value: 32.998 - type: ndcg_at_1 value: 22.493 - type: ndcg_at_10 value: 40.833000000000006 - type: ndcg_at_100 value: 46.357 - type: ndcg_at_1000 value: 47.637 - type: ndcg_at_3 value: 32.995999999999995 - type: ndcg_at_5 value: 36.919000000000004 - type: precision_at_1 value: 22.493 - type: precision_at_10 value: 6.465999999999999 - type: precision_at_100 value: 0.9249999999999999 - type: precision_at_1000 value: 0.104 - type: precision_at_3 value: 14.030999999999999 - type: precision_at_5 value: 10.413 - type: recall_at_1 value: 21.852 - type: recall_at_10 value: 61.934999999999995 - type: recall_at_100 value: 87.611 - type: recall_at_1000 value: 97.441 - type: recall_at_3 value: 40.583999999999996 - type: recall_at_5 value: 49.992999999999995 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (en) config: en split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 93.36069311445507 - type: f1 value: 93.16456330371453 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (en) config: en split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 74.74692202462381 - type: f1 value: 58.17903579421599 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (en) config: en split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 74.80833893745796 - type: f1 value: 72.70786592684664 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (en) config: en split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 78.69872225958305 - type: f1 value: 78.61626934504731 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-p2p name: MTEB MedrxivClusteringP2P config: default split: test revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 metrics: - type: v_measure value: 33.058658628717694 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-s2s name: MTEB MedrxivClusteringS2S config: default split: test revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 metrics: - type: v_measure value: 30.85561739360599 - task: type: Reranking dataset: type: mteb/mind_small name: MTEB MindSmallReranking config: default split: test revision: 3bdac13927fdc888b903db93b2ffdbd90b295a69 metrics: - type: map value: 31.290259910144385 - type: mrr value: 32.44223046102856 - task: type: Retrieval dataset: type: nfcorpus name: MTEB NFCorpus config: default split: test revision: None metrics: - type: map_at_1 value: 5.288 - type: map_at_10 value: 12.267999999999999 - type: map_at_100 value: 15.557000000000002 - type: map_at_1000 value: 16.98 - type: map_at_3 value: 8.866 - type: map_at_5 value: 10.418 - type: mrr_at_1 value: 43.653 - type: mrr_at_10 value: 52.681 - type: mrr_at_100 value: 53.315999999999995 - type: mrr_at_1000 value: 53.357 - type: mrr_at_3 value: 51.393 - type: mrr_at_5 value: 51.903999999999996 - type: ndcg_at_1 value: 42.415000000000006 - type: ndcg_at_10 value: 34.305 - type: ndcg_at_100 value: 30.825999999999997 - type: ndcg_at_1000 value: 39.393 - type: ndcg_at_3 value: 39.931 - type: ndcg_at_5 value: 37.519999999999996 - type: precision_at_1 value: 43.653 - type: precision_at_10 value: 25.728 - type: precision_at_100 value: 7.932 - type: precision_at_1000 value: 2.07 - type: precision_at_3 value: 38.184000000000005 - type: precision_at_5 value: 32.879000000000005 - type: recall_at_1 value: 5.288 - type: recall_at_10 value: 16.195 - type: recall_at_100 value: 31.135 - type: recall_at_1000 value: 61.531000000000006 - type: recall_at_3 value: 10.313 - type: recall_at_5 value: 12.754999999999999 - task: type: Retrieval dataset: type: nq name: MTEB NQ config: default split: test revision: None metrics: - type: map_at_1 value: 28.216 - type: map_at_10 value: 42.588 - type: map_at_100 value: 43.702999999999996 - type: map_at_1000 value: 43.739 - type: map_at_3 value: 38.177 - type: map_at_5 value: 40.754000000000005 - type: mrr_at_1 value: 31.866 - type: mrr_at_10 value: 45.189 - type: mrr_at_100 value: 46.056000000000004 - type: mrr_at_1000 value: 46.081 - type: mrr_at_3 value: 41.526999999999994 - type: mrr_at_5 value: 43.704 - type: ndcg_at_1 value: 31.837 - type: ndcg_at_10 value: 50.178 - type: ndcg_at_100 value: 54.98800000000001 - type: ndcg_at_1000 value: 55.812 - type: ndcg_at_3 value: 41.853 - type: ndcg_at_5 value: 46.153 - type: precision_at_1 value: 31.837 - type: precision_at_10 value: 8.43 - type: precision_at_100 value: 1.1119999999999999 - type: precision_at_1000 value: 0.11900000000000001 - type: precision_at_3 value: 19.023 - type: precision_at_5 value: 13.911000000000001 - type: recall_at_1 value: 28.216 - type: recall_at_10 value: 70.8 - type: recall_at_100 value: 91.857 - type: recall_at_1000 value: 97.941 - type: recall_at_3 value: 49.196 - type: recall_at_5 value: 59.072 - task: type: Retrieval dataset: type: quora name: MTEB QuoraRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 71.22800000000001 - type: map_at_10 value: 85.115 - type: map_at_100 value: 85.72 - type: map_at_1000 value: 85.737 - type: map_at_3 value: 82.149 - type: map_at_5 value: 84.029 - type: mrr_at_1 value: 81.96 - type: mrr_at_10 value: 88.00200000000001 - type: mrr_at_100 value: 88.088 - type: mrr_at_1000 value: 88.089 - type: mrr_at_3 value: 87.055 - type: mrr_at_5 value: 87.715 - type: ndcg_at_1 value: 82.01 - type: ndcg_at_10 value: 88.78 - type: ndcg_at_100 value: 89.91 - type: ndcg_at_1000 value: 90.013 - type: ndcg_at_3 value: 85.957 - type: ndcg_at_5 value: 87.56 - type: precision_at_1 value: 82.01 - type: precision_at_10 value: 13.462 - type: precision_at_100 value: 1.528 - type: precision_at_1000 value: 0.157 - type: precision_at_3 value: 37.553 - type: precision_at_5 value: 24.732000000000003 - type: recall_at_1 value: 71.22800000000001 - type: recall_at_10 value: 95.69 - type: recall_at_100 value: 99.531 - type: recall_at_1000 value: 99.98 - type: recall_at_3 value: 87.632 - type: recall_at_5 value: 92.117 - task: type: Clustering dataset: type: mteb/reddit-clustering name: MTEB RedditClustering config: default split: test revision: 24640382cdbf8abc73003fb0fa6d111a705499eb metrics: - type: v_measure value: 52.31768034366916 - task: type: Clustering dataset: type: mteb/reddit-clustering-p2p name: MTEB RedditClusteringP2P config: default split: test revision: 282350215ef01743dc01b456c7f5241fa8937f16 metrics: - type: v_measure value: 60.640266772723606 - task: type: Retrieval dataset: type: scidocs name: MTEB SCIDOCS config: default split: test revision: None metrics: - type: map_at_1 value: 4.7780000000000005 - type: map_at_10 value: 12.299 - type: map_at_100 value: 14.363000000000001 - type: map_at_1000 value: 14.71 - type: map_at_3 value: 8.738999999999999 - type: map_at_5 value: 10.397 - type: mrr_at_1 value: 23.599999999999998 - type: mrr_at_10 value: 34.845 - type: mrr_at_100 value: 35.916 - type: mrr_at_1000 value: 35.973 - type: mrr_at_3 value: 31.7 - type: mrr_at_5 value: 33.535 - type: ndcg_at_1 value: 23.599999999999998 - type: ndcg_at_10 value: 20.522000000000002 - type: ndcg_at_100 value: 28.737000000000002 - type: ndcg_at_1000 value: 34.596 - type: ndcg_at_3 value: 19.542 - type: ndcg_at_5 value: 16.958000000000002 - type: precision_at_1 value: 23.599999999999998 - type: precision_at_10 value: 10.67 - type: precision_at_100 value: 2.259 - type: precision_at_1000 value: 0.367 - type: precision_at_3 value: 18.333 - type: precision_at_5 value: 14.879999999999999 - type: recall_at_1 value: 4.7780000000000005 - type: recall_at_10 value: 21.617 - type: recall_at_100 value: 45.905 - type: recall_at_1000 value: 74.42 - type: recall_at_3 value: 11.148 - type: recall_at_5 value: 15.082999999999998 - task: type: STS dataset: type: mteb/sickr-sts name: MTEB SICK-R config: default split: test revision: a6ea5a8cab320b040a23452cc28066d9beae2cee metrics: - type: cos_sim_pearson value: 83.22372750297885 - type: cos_sim_spearman value: 79.40972617119405 - type: euclidean_pearson value: 80.6101072020434 - type: euclidean_spearman value: 79.53844217225202 - type: manhattan_pearson value: 80.57265975286111 - type: manhattan_spearman value: 79.46335611792958 - task: type: STS dataset: type: mteb/sts12-sts name: MTEB STS12 config: default split: test revision: a0d554a64d88156834ff5ae9920b964011b16384 metrics: - type: cos_sim_pearson value: 85.43713315520749 - type: cos_sim_spearman value: 77.44128693329532 - type: euclidean_pearson value: 81.63869928101123 - type: euclidean_spearman value: 77.29512977961515 - type: manhattan_pearson value: 81.63704185566183 - type: manhattan_spearman value: 77.29909412738657 - task: type: STS dataset: type: mteb/sts13-sts name: MTEB STS13 config: default split: test revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca metrics: - type: cos_sim_pearson value: 81.59451537860527 - type: cos_sim_spearman value: 82.97994638856723 - type: euclidean_pearson value: 82.89478688288412 - type: euclidean_spearman value: 83.58740751053104 - type: manhattan_pearson value: 82.69140840941608 - type: manhattan_spearman value: 83.33665956040555 - task: type: STS dataset: type: mteb/sts14-sts name: MTEB STS14 config: default split: test revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 metrics: - type: cos_sim_pearson value: 82.00756527711764 - type: cos_sim_spearman value: 81.83560996841379 - type: euclidean_pearson value: 82.07684151976518 - type: euclidean_spearman value: 82.00913052060511 - type: manhattan_pearson value: 82.05690778488794 - type: manhattan_spearman value: 82.02260252019525 - task: type: STS dataset: type: mteb/sts15-sts name: MTEB STS15 config: default split: test revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 metrics: - type: cos_sim_pearson value: 86.13710262895447 - type: cos_sim_spearman value: 87.26412811156248 - type: euclidean_pearson value: 86.94151453230228 - type: euclidean_spearman value: 87.5363796699571 - type: manhattan_pearson value: 86.86989424083748 - type: manhattan_spearman value: 87.47315940781353 - task: type: STS dataset: type: mteb/sts16-sts name: MTEB STS16 config: default split: test revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 metrics: - type: cos_sim_pearson value: 83.0230597603627 - type: cos_sim_spearman value: 84.93344499318864 - type: euclidean_pearson value: 84.23754743431141 - type: euclidean_spearman value: 85.09707376597099 - type: manhattan_pearson value: 84.04325160987763 - type: manhattan_spearman value: 84.89353071339909 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-en) config: en-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 86.75620824563921 - type: cos_sim_spearman value: 87.15065513706398 - type: euclidean_pearson value: 88.26281533633521 - type: euclidean_spearman value: 87.51963738643983 - type: manhattan_pearson value: 88.25599267618065 - type: manhattan_spearman value: 87.58048736047483 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (en) config: en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 64.74645319195137 - type: cos_sim_spearman value: 65.29996325037214 - type: euclidean_pearson value: 67.04297794086443 - type: euclidean_spearman value: 65.43841726694343 - type: manhattan_pearson value: 67.39459955690904 - type: manhattan_spearman value: 65.92864704413651 - task: type: STS dataset: type: mteb/stsbenchmark-sts name: MTEB STSBenchmark config: default split: test revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 metrics: - type: cos_sim_pearson value: 84.31291020270801 - type: cos_sim_spearman value: 85.86473738688068 - type: euclidean_pearson value: 85.65537275064152 - type: euclidean_spearman value: 86.13087454209642 - type: manhattan_pearson value: 85.43946955047609 - type: manhattan_spearman value: 85.91568175344916 - task: type: Reranking dataset: type: mteb/scidocs-reranking name: MTEB SciDocsRR config: default split: test revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab metrics: - type: map value: 85.93798118350695 - type: mrr value: 95.93536274908824 - task: type: Retrieval dataset: type: scifact name: MTEB SciFact config: default split: test revision: None metrics: - type: map_at_1 value: 57.594 - type: map_at_10 value: 66.81899999999999 - type: map_at_100 value: 67.368 - type: map_at_1000 value: 67.4 - type: map_at_3 value: 64.061 - type: map_at_5 value: 65.47 - type: mrr_at_1 value: 60.667 - type: mrr_at_10 value: 68.219 - type: mrr_at_100 value: 68.655 - type: mrr_at_1000 value: 68.684 - type: mrr_at_3 value: 66.22200000000001 - type: mrr_at_5 value: 67.289 - type: ndcg_at_1 value: 60.667 - type: ndcg_at_10 value: 71.275 - type: ndcg_at_100 value: 73.642 - type: ndcg_at_1000 value: 74.373 - type: ndcg_at_3 value: 66.521 - type: ndcg_at_5 value: 68.581 - type: precision_at_1 value: 60.667 - type: precision_at_10 value: 9.433 - type: precision_at_100 value: 1.0699999999999998 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 25.556 - type: precision_at_5 value: 16.8 - type: recall_at_1 value: 57.594 - type: recall_at_10 value: 83.622 - type: recall_at_100 value: 94.167 - type: recall_at_1000 value: 99.667 - type: recall_at_3 value: 70.64399999999999 - type: recall_at_5 value: 75.983 - task: type: PairClassification dataset: type: mteb/sprintduplicatequestions-pairclassification name: MTEB SprintDuplicateQuestions config: default split: test revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 metrics: - type: cos_sim_accuracy value: 99.85841584158416 - type: cos_sim_ap value: 96.66996142314342 - type: cos_sim_f1 value: 92.83208020050125 - type: cos_sim_precision value: 93.06532663316584 - type: cos_sim_recall value: 92.60000000000001 - type: dot_accuracy value: 99.85841584158416 - type: dot_ap value: 96.6775307676576 - type: dot_f1 value: 92.69289729177312 - type: dot_precision value: 94.77533960292581 - type: dot_recall value: 90.7 - type: euclidean_accuracy value: 99.86138613861387 - type: euclidean_ap value: 96.6338454403108 - type: euclidean_f1 value: 92.92214357937311 - type: euclidean_precision value: 93.96728016359918 - type: euclidean_recall value: 91.9 - type: manhattan_accuracy value: 99.86237623762376 - type: manhattan_ap value: 96.60370449645053 - type: manhattan_f1 value: 92.91177970423253 - type: manhattan_precision value: 94.7970863683663 - type: manhattan_recall value: 91.10000000000001 - type: max_accuracy value: 99.86237623762376 - type: max_ap value: 96.6775307676576 - type: max_f1 value: 92.92214357937311 - task: type: Clustering dataset: type: mteb/stackexchange-clustering name: MTEB StackExchangeClustering config: default split: test revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 metrics: - type: v_measure value: 60.77977058695198 - task: type: Clustering dataset: type: mteb/stackexchange-clustering-p2p name: MTEB StackExchangeClusteringP2P config: default split: test revision: 815ca46b2622cec33ccafc3735d572c266efdb44 metrics: - type: v_measure value: 35.2725272535638 - task: type: Reranking dataset: type: mteb/stackoverflowdupquestions-reranking name: MTEB StackOverflowDupQuestions config: default split: test revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 metrics: - type: map value: 53.64052466362125 - type: mrr value: 54.533067014684654 - task: type: Summarization dataset: type: mteb/summeval name: MTEB SummEval config: default split: test revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c metrics: - type: cos_sim_pearson value: 30.677624219206578 - type: cos_sim_spearman value: 30.121368518123447 - type: dot_pearson value: 30.69870088041608 - type: dot_spearman value: 29.61284927093751 - task: type: Retrieval dataset: type: trec-covid name: MTEB TRECCOVID config: default split: test revision: None metrics: - type: map_at_1 value: 0.22 - type: map_at_10 value: 1.855 - type: map_at_100 value: 9.885 - type: map_at_1000 value: 23.416999999999998 - type: map_at_3 value: 0.637 - type: map_at_5 value: 1.024 - type: mrr_at_1 value: 88.0 - type: mrr_at_10 value: 93.067 - type: mrr_at_100 value: 93.067 - type: mrr_at_1000 value: 93.067 - type: mrr_at_3 value: 92.667 - type: mrr_at_5 value: 93.067 - type: ndcg_at_1 value: 82.0 - type: ndcg_at_10 value: 75.899 - type: ndcg_at_100 value: 55.115 - type: ndcg_at_1000 value: 48.368 - type: ndcg_at_3 value: 79.704 - type: ndcg_at_5 value: 78.39699999999999 - type: precision_at_1 value: 88.0 - type: precision_at_10 value: 79.60000000000001 - type: precision_at_100 value: 56.06 - type: precision_at_1000 value: 21.206 - type: precision_at_3 value: 84.667 - type: precision_at_5 value: 83.2 - type: recall_at_1 value: 0.22 - type: recall_at_10 value: 2.078 - type: recall_at_100 value: 13.297 - type: recall_at_1000 value: 44.979 - type: recall_at_3 value: 0.6689999999999999 - type: recall_at_5 value: 1.106 - task: type: Retrieval dataset: type: webis-touche2020 name: MTEB Touche2020 config: default split: test revision: None metrics: - type: map_at_1 value: 2.258 - type: map_at_10 value: 10.439 - type: map_at_100 value: 16.89 - type: map_at_1000 value: 18.407999999999998 - type: map_at_3 value: 5.668 - type: map_at_5 value: 7.718 - type: mrr_at_1 value: 32.653 - type: mrr_at_10 value: 51.159 - type: mrr_at_100 value: 51.714000000000006 - type: mrr_at_1000 value: 51.714000000000006 - type: mrr_at_3 value: 47.959 - type: mrr_at_5 value: 50.407999999999994 - type: ndcg_at_1 value: 29.592000000000002 - type: ndcg_at_10 value: 26.037 - type: ndcg_at_100 value: 37.924 - type: ndcg_at_1000 value: 49.126999999999995 - type: ndcg_at_3 value: 30.631999999999998 - type: ndcg_at_5 value: 28.571 - type: precision_at_1 value: 32.653 - type: precision_at_10 value: 22.857 - type: precision_at_100 value: 7.754999999999999 - type: precision_at_1000 value: 1.529 - type: precision_at_3 value: 34.014 - type: precision_at_5 value: 29.796 - type: recall_at_1 value: 2.258 - type: recall_at_10 value: 16.554 - type: recall_at_100 value: 48.439 - type: recall_at_1000 value: 82.80499999999999 - type: recall_at_3 value: 7.283 - type: recall_at_5 value: 10.732 - task: type: Classification dataset: type: mteb/toxic_conversations_50k name: MTEB ToxicConversationsClassification config: default split: test revision: d7c0de2777da35d6aae2200a62c6e0e5af397c4c metrics: - type: accuracy value: 69.8858 - type: ap value: 13.835684144362109 - type: f1 value: 53.803351693244586 - task: type: Classification dataset: type: mteb/tweet_sentiment_extraction name: MTEB TweetSentimentExtractionClassification config: default split: test revision: d604517c81ca91fe16a244d1248fc021f9ecee7a metrics: - type: accuracy value: 60.50650820599886 - type: f1 value: 60.84357825979259 - task: type: Clustering dataset: type: mteb/twentynewsgroups-clustering name: MTEB TwentyNewsgroupsClustering config: default split: test revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 metrics: - type: v_measure value: 48.52131044852134 - task: type: PairClassification dataset: type: mteb/twittersemeval2015-pairclassification name: MTEB TwitterSemEval2015 config: default split: test revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 metrics: - type: cos_sim_accuracy value: 85.59337187816654 - type: cos_sim_ap value: 73.23925826533437 - type: cos_sim_f1 value: 67.34693877551021 - type: cos_sim_precision value: 62.40432237730752 - type: cos_sim_recall value: 73.13984168865434 - type: dot_accuracy value: 85.31322644096085 - type: dot_ap value: 72.30723963807422 - type: dot_f1 value: 66.47051612112296 - type: dot_precision value: 62.0792305930845 - type: dot_recall value: 71.53034300791556 - type: euclidean_accuracy value: 85.61125350181797 - type: euclidean_ap value: 73.32843720487845 - type: euclidean_f1 value: 67.36549633745895 - type: euclidean_precision value: 64.60755813953489 - type: euclidean_recall value: 70.36939313984169 - type: manhattan_accuracy value: 85.63509566668654 - type: manhattan_ap value: 73.16658488311325 - type: manhattan_f1 value: 67.20597386434349 - type: manhattan_precision value: 63.60424028268551 - type: manhattan_recall value: 71.2401055408971 - type: max_accuracy value: 85.63509566668654 - type: max_ap value: 73.32843720487845 - type: max_f1 value: 67.36549633745895 - task: type: PairClassification dataset: type: mteb/twitterurlcorpus-pairclassification name: MTEB TwitterURLCorpus config: default split: test revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf metrics: - type: cos_sim_accuracy value: 88.33779640625606 - type: cos_sim_ap value: 84.83868375898157 - type: cos_sim_f1 value: 77.16506154017773 - type: cos_sim_precision value: 74.62064005753327 - type: cos_sim_recall value: 79.88912842623961 - type: dot_accuracy value: 88.02732176815307 - type: dot_ap value: 83.95089283763002 - type: dot_f1 value: 76.29635101196631 - type: dot_precision value: 73.31771720613288 - type: dot_recall value: 79.52725592854944 - type: euclidean_accuracy value: 88.44452206310397 - type: euclidean_ap value: 84.98384576824827 - type: euclidean_f1 value: 77.29311047696697 - type: euclidean_precision value: 74.51232583065381 - type: euclidean_recall value: 80.28949799815214 - type: manhattan_accuracy value: 88.47362906042613 - type: manhattan_ap value: 84.91421462218432 - type: manhattan_f1 value: 77.05107637204792 - type: manhattan_precision value: 74.74484256243214 - type: manhattan_recall value: 79.50415768401602 - type: max_accuracy value: 88.47362906042613 - type: max_ap value: 84.98384576824827 - type: max_f1 value: 77.29311047696697 license: mit language: - en --- <h1 align="center">FlagEmbedding</h1> <h4 align="center"> <p> <a href=#model-list>Model List</a> | <a href=#frequently-asked-questions>FAQ</a> | <a href=#usage>Usage</a> | <a href="#evaluation">Evaluation</a> | <a href="#train">Train</a> | <a href="#contact">Contact</a> | <a href="#citation">Citation</a> | <a href="#license">License</a> <p> </h4> More details please refer to our Github: [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding). If you are looking for a model that supports more languages, longer texts, and other retrieval methods, you can try using [bge-m3](https://huggingface.co/BAAI/bge-m3). [English](README.md) | [中文](https://github.com/FlagOpen/FlagEmbedding/blob/master/README_zh.md) FlagEmbedding focuses on retrieval-augmented LLMs, consisting of the following projects currently: - **Long-Context LLM**: [Activation Beacon](https://github.com/FlagOpen/FlagEmbedding/tree/master/Long_LLM/activation_beacon) - **Fine-tuning of LM** : [LM-Cocktail](https://github.com/FlagOpen/FlagEmbedding/tree/master/LM_Cocktail) - **Dense Retrieval**: [BGE-M3](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3), [LLM Embedder](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder), [BGE Embedding](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/baai_general_embedding) - **Reranker Model**: [BGE Reranker](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker) - **Benchmark**: [C-MTEB](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB) ## News - 1/30/2024: Release **BGE-M3**, a new member to BGE model series! M3 stands for **M**ulti-linguality (100+ languages), **M**ulti-granularities (input length up to 8192), **M**ulti-Functionality (unification of dense, lexical, multi-vec/colbert retrieval). It is the first embedding model which supports all three retrieval methods, achieving new SOTA on multi-lingual (MIRACL) and cross-lingual (MKQA) benchmarks. [Technical Report](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/BGE_M3/BGE_M3.pdf) and [Code](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3). :fire: - 1/9/2024: Release [Activation-Beacon](https://github.com/FlagOpen/FlagEmbedding/tree/master/Long_LLM/activation_beacon), an effective, efficient, compatible, and low-cost (training) method to extend the context length of LLM. [Technical Report](https://arxiv.org/abs/2401.03462) :fire: - 12/24/2023: Release **LLaRA**, a LLaMA-7B based dense retriever, leading to state-of-the-art performances on MS MARCO and BEIR. Model and code will be open-sourced. Please stay tuned. [Technical Report](https://arxiv.org/abs/2312.15503) :fire: - 11/23/2023: Release [LM-Cocktail](https://github.com/FlagOpen/FlagEmbedding/tree/master/LM_Cocktail), a method to maintain general capabilities during fine-tuning by merging multiple language models. [Technical Report](https://arxiv.org/abs/2311.13534) :fire: - 10/12/2023: Release [LLM-Embedder](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder), a unified embedding model to support diverse retrieval augmentation needs for LLMs. [Technical Report](https://arxiv.org/pdf/2310.07554.pdf) - 09/15/2023: The [technical report](https://arxiv.org/pdf/2309.07597.pdf) of BGE has been released - 09/15/2023: The [massive training data](https://data.baai.ac.cn/details/BAAI-MTP) of BGE has been released - 09/12/2023: New models: - **New reranker model**: release cross-encoder models `BAAI/bge-reranker-base` and `BAAI/bge-reranker-large`, which are more powerful than embedding model. We recommend to use/fine-tune them to re-rank top-k documents returned by embedding models. - **update embedding model**: release `bge-*-v1.5` embedding model to alleviate the issue of the similarity distribution, and enhance its retrieval ability without instruction. <details> <summary>More</summary> <!-- ### More --> - 09/07/2023: Update [fine-tune code](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md): Add script to mine hard negatives and support adding instruction during fine-tuning. - 08/09/2023: BGE Models are integrated into **Langchain**, you can use it like [this](#using-langchain); C-MTEB **leaderboard** is [available](https://huggingface.co/spaces/mteb/leaderboard). - 08/05/2023: Release base-scale and small-scale models, **best performance among the models of the same size 🤗** - 08/02/2023: Release `bge-large-*`(short for BAAI General Embedding) Models, **rank 1st on MTEB and C-MTEB benchmark!** :tada: :tada: - 08/01/2023: We release the [Chinese Massive Text Embedding Benchmark](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB) (**C-MTEB**), consisting of 31 test dataset. </details> ## Model List `bge` is short for `BAAI general embedding`. | Model | Language | | Description | query instruction for retrieval [1] | |:-------------------------------|:--------:| :--------:| :--------:|:--------:| | [BAAI/bge-m3](https://huggingface.co/BAAI/bge-m3) | Multilingual | [Inference](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3#usage) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3) | Multi-Functionality(dense retrieval, sparse retrieval, multi-vector(colbert)), Multi-Linguality, and Multi-Granularity(8192 tokens) | | | [BAAI/llm-embedder](https://huggingface.co/BAAI/llm-embedder) | English | [Inference](./FlagEmbedding/llm_embedder/README.md) [Fine-tune](./FlagEmbedding/llm_embedder/README.md) | a unified embedding model to support diverse retrieval augmentation needs for LLMs | See [README](./FlagEmbedding/llm_embedder/README.md) | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh-v1.5](https://huggingface.co/BAAI/bge-large-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-large-en](https://huggingface.co/BAAI/bge-large-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [MTEB](https://huggingface.co/spaces/mteb/leaderboard) leaderboard | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en](https://huggingface.co/BAAI/bge-base-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-en` | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en](https://huggingface.co/BAAI/bge-small-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) |a small-scale model but with competitive performance | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [C-MTEB](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB) benchmark | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-zh` | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a small-scale model but with competitive performance | `为这个句子生成表示以用于检索相关文章：` | [1\]: If you need to search the relevant passages to a query, we suggest to add the instruction to the query; in other cases, no instruction is needed, just use the original query directly. In all cases, **no instruction** needs to be added to passages. [2\]: Different from embedding model, reranker uses question and document as input and directly output similarity instead of embedding. To balance the accuracy and time cost, cross-encoder is widely used to re-rank top-k documents retrieved by other simple models. For examples, use bge embedding model to retrieve top 100 relevant documents, and then use bge reranker to re-rank the top 100 document to get the final top-3 results. All models have been uploaded to Huggingface Hub, and you can see them at https://huggingface.co/BAAI. If you cannot open the Huggingface Hub, you also can download the models at https://model.baai.ac.cn/models . ## Frequently asked questions <details> <summary>1. How to fine-tune bge embedding model?</summary> <!-- ### How to fine-tune bge embedding model? --> Following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) to prepare data and fine-tune your model. Some suggestions: - Mine hard negatives following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune#hard-negatives), which can improve the retrieval performance. - If you pre-train bge on your data, the pre-trained model cannot be directly used to calculate similarity, and it must be fine-tuned with contrastive learning before computing similarity. - If the accuracy of the fine-tuned model is still not high, it is recommended to use/fine-tune the cross-encoder model (bge-reranker) to re-rank top-k results. Hard negatives also are needed to fine-tune reranker. </details> <details> <summary>2. The similarity score between two dissimilar sentences is higher than 0.5</summary> <!-- ### The similarity score between two dissimilar sentences is higher than 0.5 --> **Suggest to use bge v1.5, which alleviates the issue of the similarity distribution.** Since we finetune the models by contrastive learning with a temperature of 0.01, the similarity distribution of the current BGE model is about in the interval \[0.6, 1\]. So a similarity score greater than 0.5 does not indicate that the two sentences are similar. For downstream tasks, such as passage retrieval or semantic similarity, **what matters is the relative order of the scores, not the absolute value.** If you need to filter similar sentences based on a similarity threshold, please select an appropriate similarity threshold based on the similarity distribution on your data (such as 0.8, 0.85, or even 0.9). </details> <details> <summary>3. When does the query instruction need to be used</summary> <!-- ### When does the query instruction need to be used --> For the `bge-*-v1.5`, we improve its retrieval ability when not using instruction. No instruction only has a slight degradation in retrieval performance compared with using instruction. So you can generate embedding without instruction in all cases for convenience. For a retrieval task that uses short queries to find long related documents, it is recommended to add instructions for these short queries. **The best method to decide whether to add instructions for queries is choosing the setting that achieves better performance on your task.** In all cases, the documents/passages do not need to add the instruction. </details> ## Usage ### Usage for Embedding Model Here are some examples for using `bge` models with [FlagEmbedding](#using-flagembedding), [Sentence-Transformers](#using-sentence-transformers), [Langchain](#using-langchain), or [Huggingface Transformers](#using-huggingface-transformers). #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` If it doesn't work for you, you can see [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md) for more methods to install FlagEmbedding. ```python from FlagEmbedding import FlagModel sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = FlagModel('BAAI/bge-large-zh-v1.5', query_instruction_for_retrieval="为这个句子生成表示以用于检索相关文章：", use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation embeddings_1 = model.encode(sentences_1) embeddings_2 = model.encode(sentences_2) similarity = embeddings_1 @ embeddings_2.T print(similarity) # for s2p(short query to long passage) retrieval task, suggest to use encode_queries() which will automatically add the instruction to each query # corpus in retrieval task can still use encode() or encode_corpus(), since they don't need instruction queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] q_embeddings = model.encode_queries(queries) p_embeddings = model.encode(passages) scores = q_embeddings @ p_embeddings.T ``` For the value of the argument `query_instruction_for_retrieval`, see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list). By default, FlagModel will use all available GPUs when encoding. Please set `os.environ["CUDA_VISIBLE_DEVICES"]` to select specific GPUs. You also can set `os.environ["CUDA_VISIBLE_DEVICES"]=""` to make all GPUs unavailable. #### Using Sentence-Transformers You can also use the `bge` models with [sentence-transformers](https://www.SBERT.net): ``` pip install -U sentence-transformers ``` ```python from sentence_transformers import SentenceTransformer sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = SentenceTransformer('BAAI/bge-large-zh-v1.5') embeddings_1 = model.encode(sentences_1, normalize_embeddings=True) embeddings_2 = model.encode(sentences_2, normalize_embeddings=True) similarity = embeddings_1 @ embeddings_2.T print(similarity) ``` For s2p(short query to long passage) retrieval task, each short query should start with an instruction (instructions see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list)). But the instruction is not needed for passages. ```python from sentence_transformers import SentenceTransformer queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] instruction = "为这个句子生成表示以用于检索相关文章：" model = SentenceTransformer('BAAI/bge-large-zh-v1.5') q_embeddings = model.encode([instruction+q for q in queries], normalize_embeddings=True) p_embeddings = model.encode(passages, normalize_embeddings=True) scores = q_embeddings @ p_embeddings.T ``` #### Using Langchain You can use `bge` in langchain like this: ```python from langchain.embeddings import HuggingFaceBgeEmbeddings model_name = "BAAI/bge-large-en-v1.5" model_kwargs = {'device': 'cuda'} encode_kwargs = {'normalize_embeddings': True} # set True to compute cosine similarity model = HuggingFaceBgeEmbeddings( model_name=model_name, model_kwargs=model_kwargs, encode_kwargs=encode_kwargs, query_instruction="为这个句子生成表示以用于检索相关文章：" ) model.query_instruction = "为这个句子生成表示以用于检索相关文章：" ``` #### Using HuggingFace Transformers With the transformers package, you can use the model like this: First, you pass your input through the transformer model, then you select the last hidden state of the first token (i.e., [CLS]) as the sentence embedding. ```python from transformers import AutoTokenizer, AutoModel import torch # Sentences we want sentence embeddings for sentences = ["样例数据-1", "样例数据-2"] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-large-zh-v1.5') model = AutoModel.from_pretrained('BAAI/bge-large-zh-v1.5') model.eval() # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # for s2p(short query to long passage) retrieval task, add an instruction to query (not add instruction for passages) # encoded_input = tokenizer([instruction + q for q in queries], padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, cls pooling. sentence_embeddings = model_output[0][:, 0] # normalize embeddings sentence_embeddings = torch.nn.functional.normalize(sentence_embeddings, p=2, dim=1) print("Sentence embeddings:", sentence_embeddings) ``` ### Usage for Reranker Different from embedding model, reranker uses question and document as input and directly output similarity instead of embedding. You can get a relevance score by inputting query and passage to the reranker. The reranker is optimized based cross-entropy loss, so the relevance score is not bounded to a specific range. #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` Get relevance scores (higher scores indicate more relevance): ```python from FlagEmbedding import FlagReranker reranker = FlagReranker('BAAI/bge-reranker-large', use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation score = reranker.compute_score(['query', 'passage']) print(score) scores = reranker.compute_score([['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']]) print(scores) ``` #### Using Huggingface transformers ```python import torch from transformers import AutoModelForSequenceClassification, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-reranker-large') model = AutoModelForSequenceClassification.from_pretrained('BAAI/bge-reranker-large') model.eval() pairs = [['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']] with torch.no_grad(): inputs = tokenizer(pairs, padding=True, truncation=True, return_tensors='pt', max_length=512) scores = model(**inputs, return_dict=True).logits.view(-1, ).float() print(scores) ``` #### Usage of the ONNX files ```python from optimum.onnxruntime import ORTModelForFeatureExtraction # type: ignore import torch from transformers import AutoModel, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-small-en-v1.5') model = AutoModel.from_pretrained('BAAI/bge-small-en-v1.5') model_ort = ORTModelForFeatureExtraction.from_pretrained('BAAI/bge-small-en-v1.5', file_name="onnx/model.onnx") # Sentences we want sentence embeddings for sentences = ["样例数据-1", "样例数据-2"] # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # for s2p(short query to long passage) retrieval task, add an instruction to query (not add instruction for passages) # encoded_input = tokenizer([instruction + q for q in queries], padding=True, truncation=True, return_tensors='pt') model_output_ort = model_ort(**encoded_input) # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # model_output and model_output_ort are identical ``` #### Usage via infinity Its also possible to deploy the onnx files with the [infinity_emb](https://github.com/michaelfeil/infinity) pip package. Recommended is `device="cuda", engine="torch"` with flash attention on gpu, and `device="cpu", engine="optimum"` for onnx inference. ```python import asyncio from infinity_emb import AsyncEmbeddingEngine, EngineArgs sentences = ["Embed this is sentence via Infinity.", "Paris is in France."] engine = AsyncEmbeddingEngine.from_args( EngineArgs(model_name_or_path = "BAAI/bge-small-en-v1.5", device="cpu", engine="optimum" # or engine="torch" )) async def main(): async with engine: embeddings, usage = await engine.embed(sentences=sentences) asyncio.run(main()) ``` ## Evaluation `baai-general-embedding` models achieve **state-of-the-art performance on both MTEB and C-MTEB leaderboard!** For more details and evaluation tools see our [scripts](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md). - **MTEB**: | Model Name | Dimension | Sequence Length | Average (56) | Retrieval (15) |Clustering (11) | Pair Classification (3) | Reranking (4) | STS (10) | Summarization (1) | Classification (12) | |:----:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:| | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | 1024 | 512 | **64.23** | **54.29** | 46.08 | 87.12 | 60.03 | 83.11 | 31.61 | 75.97 | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | 768 | 512 | 63.55 | 53.25 | 45.77 | 86.55 | 58.86 | 82.4 | 31.07 | 75.53 | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | 384 | 512 | 62.17 |51.68 | 43.82 | 84.92 | 58.36 | 81.59 | 30.12 | 74.14 | | [bge-large-en](https://huggingface.co/BAAI/bge-large-en) | 1024 | 512 | 63.98 | 53.9 | 46.98 | 85.8 | 59.48 | 81.56 | 32.06 | 76.21 | | [bge-base-en](https://huggingface.co/BAAI/bge-base-en) | 768 | 512 | 63.36 | 53.0 | 46.32 | 85.86 | 58.7 | 81.84 | 29.27 | 75.27 | | [gte-large](https://huggingface.co/thenlper/gte-large) | 1024 | 512 | 63.13 | 52.22 | 46.84 | 85.00 | 59.13 | 83.35 | 31.66 | 73.33 | | [gte-base](https://huggingface.co/thenlper/gte-base) | 768 | 512 | 62.39 | 51.14 | 46.2 | 84.57 | 58.61 | 82.3 | 31.17 | 73.01 | | [e5-large-v2](https://huggingface.co/intfloat/e5-large-v2) | 1024| 512 | 62.25 | 50.56 | 44.49 | 86.03 | 56.61 | 82.05 | 30.19 | 75.24 | | [bge-small-en](https://huggingface.co/BAAI/bge-small-en) | 384 | 512 | 62.11 | 51.82 | 44.31 | 83.78 | 57.97 | 80.72 | 30.53 | 74.37 | | [instructor-xl](https://huggingface.co/hkunlp/instructor-xl) | 768 | 512 | 61.79 | 49.26 | 44.74 | 86.62 | 57.29 | 83.06 | 32.32 | 61.79 | | [e5-base-v2](https://huggingface.co/intfloat/e5-base-v2) | 768 | 512 | 61.5 | 50.29 | 43.80 | 85.73 | 55.91 | 81.05 | 30.28 | 73.84 | | [gte-small](https://huggingface.co/thenlper/gte-small) | 384 | 512 | 61.36 | 49.46 | 44.89 | 83.54 | 57.7 | 82.07 | 30.42 | 72.31 | | [text-embedding-ada-002](https://platform.openai.com/docs/guides/embeddings) | 1536 | 8192 | 60.99 | 49.25 | 45.9 | 84.89 | 56.32 | 80.97 | 30.8 | 70.93 | | [e5-small-v2](https://huggingface.co/intfloat/e5-base-v2) | 384 | 512 | 59.93 | 49.04 | 39.92 | 84.67 | 54.32 | 80.39 | 31.16 | 72.94 | | [sentence-t5-xxl](https://huggingface.co/sentence-transformers/sentence-t5-xxl) | 768 | 512 | 59.51 | 42.24 | 43.72 | 85.06 | 56.42 | 82.63 | 30.08 | 73.42 | | [all-mpnet-base-v2](https://huggingface.co/sentence-transformers/all-mpnet-base-v2) | 768 | 514 | 57.78 | 43.81 | 43.69 | 83.04 | 59.36 | 80.28 | 27.49 | 65.07 | | [sgpt-bloom-7b1-msmarco](https://huggingface.co/bigscience/sgpt-bloom-7b1-msmarco) | 4096 | 2048 | 57.59 | 48.22 | 38.93 | 81.9 | 55.65 | 77.74 | 33.6 | 66.19 | - **C-MTEB**: We create the benchmark C-MTEB for Chinese text embedding which consists of 31 datasets from 6 tasks. Please refer to [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md) for a detailed introduction. | Model | Embedding dimension | Avg | Retrieval | STS | PairClassification | Classification | Reranking | Clustering | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | [**BAAI/bge-large-zh-v1.5**](https://huggingface.co/BAAI/bge-large-zh-v1.5) | 1024 | **64.53** | 70.46 | 56.25 | 81.6 | 69.13 | 65.84 | 48.99 | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | 768 | 63.13 | 69.49 | 53.72 | 79.75 | 68.07 | 65.39 | 47.53 | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | 512 | 57.82 | 61.77 | 49.11 | 70.41 | 63.96 | 60.92 | 44.18 | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | 1024 | 64.20 | 71.53 | 54.98 | 78.94 | 68.32 | 65.11 | 48.39 | | [bge-large-zh-noinstruct](https://huggingface.co/BAAI/bge-large-zh-noinstruct) | 1024 | 63.53 | 70.55 | 53 | 76.77 | 68.58 | 64.91 | 50.01 | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | 768 | 62.96 | 69.53 | 54.12 | 77.5 | 67.07 | 64.91 | 47.63 | | [multilingual-e5-large](https://huggingface.co/intfloat/multilingual-e5-large) | 1024 | 58.79 | 63.66 | 48.44 | 69.89 | 67.34 | 56.00 | 48.23 | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | 512 | 58.27 | 63.07 | 49.45 | 70.35 | 63.64 | 61.48 | 45.09 | | [m3e-base](https://huggingface.co/moka-ai/m3e-base) | 768 | 57.10 | 56.91 | 50.47 | 63.99 | 67.52 | 59.34 | 47.68 | | [m3e-large](https://huggingface.co/moka-ai/m3e-large) | 1024 | 57.05 | 54.75 | 50.42 | 64.3 | 68.2 | 59.66 | 48.88 | | [multilingual-e5-base](https://huggingface.co/intfloat/multilingual-e5-base) | 768 | 55.48 | 61.63 | 46.49 | 67.07 | 65.35 | 54.35 | 40.68 | | [multilingual-e5-small](https://huggingface.co/intfloat/multilingual-e5-small) | 384 | 55.38 | 59.95 | 45.27 | 66.45 | 65.85 | 53.86 | 45.26 | | [text-embedding-ada-002(OpenAI)](https://platform.openai.com/docs/guides/embeddings/what-are-embeddings) | 1536 | 53.02 | 52.0 | 43.35 | 69.56 | 64.31 | 54.28 | 45.68 | | [luotuo](https://huggingface.co/silk-road/luotuo-bert-medium) | 1024 | 49.37 | 44.4 | 42.78 | 66.62 | 61 | 49.25 | 44.39 | | [text2vec-base](https://huggingface.co/shibing624/text2vec-base-chinese) | 768 | 47.63 | 38.79 | 43.41 | 67.41 | 62.19 | 49.45 | 37.66 | | [text2vec-large](https://huggingface.co/GanymedeNil/text2vec-large-chinese) | 1024 | 47.36 | 41.94 | 44.97 | 70.86 | 60.66 | 49.16 | 30.02 | - **Reranking**: See [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/) for evaluation script. | Model | T2Reranking | T2RerankingZh2En\* | T2RerankingEn2Zh\* | MMarcoReranking | CMedQAv1 | CMedQAv2 | Avg | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | text2vec-base-multilingual | 64.66 | 62.94 | 62.51 | 14.37 | 48.46 | 48.6 | 50.26 | | multilingual-e5-small | 65.62 | 60.94 | 56.41 | 29.91 | 67.26 | 66.54 | 57.78 | | multilingual-e5-large | 64.55 | 61.61 | 54.28 | 28.6 | 67.42 | 67.92 | 57.4 | | multilingual-e5-base | 64.21 | 62.13 | 54.68 | 29.5 | 66.23 | 66.98 | 57.29 | | m3e-base | 66.03 | 62.74 | 56.07 | 17.51 | 77.05 | 76.76 | 59.36 | | m3e-large | 66.13 | 62.72 | 56.1 | 16.46 | 77.76 | 78.27 | 59.57 | | bge-base-zh-v1.5 | 66.49 | 63.25 | 57.02 | 29.74 | 80.47 | 84.88 | 63.64 | | bge-large-zh-v1.5 | 65.74 | 63.39 | 57.03 | 28.74 | 83.45 | 85.44 | 63.97 | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | 67.28 | 63.95 | 60.45 | 35.46 | 81.26 | 84.1 | 65.42 | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | 67.6 | 64.03 | 61.44 | 37.16 | 82.15 | 84.18 | 66.09 | \* : T2RerankingZh2En and T2RerankingEn2Zh are cross-language retrieval tasks ## Train ### BAAI Embedding We pre-train the models using [retromae](https://github.com/staoxiao/RetroMAE) and train them on large-scale pairs data using contrastive learning. **You can fine-tune the embedding model on your data following our [examples](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune).** We also provide a [pre-train example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/pretrain). Note that the goal of pre-training is to reconstruct the text, and the pre-trained model cannot be used for similarity calculation directly, it needs to be fine-tuned. More training details for bge see [baai_general_embedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md). ### BGE Reranker Cross-encoder will perform full-attention over the input pair, which is more accurate than embedding model (i.e., bi-encoder) but more time-consuming than embedding model. Therefore, it can be used to re-rank the top-k documents returned by embedding model. We train the cross-encoder on a multilingual pair data, The data format is the same as embedding model, so you can fine-tune it easily following our [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker). More details please refer to [./FlagEmbedding/reranker/README.md](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker) ## Contact If you have any question or suggestion related to this project, feel free to open an issue or pull request. You also can email Shitao Xiao(stxiao@baai.ac.cn) and Zheng Liu(liuzheng@baai.ac.cn). ## Citation If you find this repository useful, please consider giving a star :star: and citation ``` @misc{bge_embedding, title={C-Pack: Packaged Resources To Advance General Chinese Embedding}, author={Shitao Xiao and Zheng Liu and Peitian Zhang and Niklas Muennighoff}, year={2023}, eprint={2309.07597}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` ## License FlagEmbedding is licensed under the [MIT License](https://github.com/FlagOpen/FlagEmbedding/blob/master/LICENSE). The released models can be used for commercial purposes free of charge.

BAAI/bge-base-en-v1.5

BAAI

sentence-transformers

feature-extraction

--- tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers - mteb model-index: - name: bge-base-en-v1.5 results: - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en) config: en split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 76.14925373134328 - type: ap value: 39.32336517995478 - type: f1 value: 70.16902252611425 - task: type: Classification dataset: type: mteb/amazon_polarity name: MTEB AmazonPolarityClassification config: default split: test revision: e2d317d38cd51312af73b3d32a06d1a08b442046 metrics: - type: accuracy value: 93.386825 - type: ap value: 90.21276917991995 - type: f1 value: 93.37741030006174 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (en) config: en split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 48.846000000000004 - type: f1 value: 48.14646269778261 - task: type: Retrieval dataset: type: arguana name: MTEB ArguAna config: default split: test revision: None metrics: - type: map_at_1 value: 40.754000000000005 - type: map_at_10 value: 55.761 - type: map_at_100 value: 56.330999999999996 - type: map_at_1000 value: 56.333999999999996 - type: map_at_3 value: 51.92 - type: map_at_5 value: 54.010999999999996 - type: mrr_at_1 value: 41.181 - type: mrr_at_10 value: 55.967999999999996 - type: mrr_at_100 value: 56.538 - type: mrr_at_1000 value: 56.542 - type: mrr_at_3 value: 51.980000000000004 - type: mrr_at_5 value: 54.208999999999996 - type: ndcg_at_1 value: 40.754000000000005 - type: ndcg_at_10 value: 63.605000000000004 - type: ndcg_at_100 value: 66.05199999999999 - type: ndcg_at_1000 value: 66.12 - type: ndcg_at_3 value: 55.708 - type: ndcg_at_5 value: 59.452000000000005 - type: precision_at_1 value: 40.754000000000005 - type: precision_at_10 value: 8.841000000000001 - type: precision_at_100 value: 0.991 - type: precision_at_1000 value: 0.1 - type: precision_at_3 value: 22.238 - type: precision_at_5 value: 15.149000000000001 - type: recall_at_1 value: 40.754000000000005 - type: recall_at_10 value: 88.407 - type: recall_at_100 value: 99.14699999999999 - type: recall_at_1000 value: 99.644 - type: recall_at_3 value: 66.714 - type: recall_at_5 value: 75.747 - task: type: Clustering dataset: type: mteb/arxiv-clustering-p2p name: MTEB ArxivClusteringP2P config: default split: test revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d metrics: - type: v_measure value: 48.74884539679369 - task: type: Clustering dataset: type: mteb/arxiv-clustering-s2s name: MTEB ArxivClusteringS2S config: default split: test revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 metrics: - type: v_measure value: 42.8075893810716 - task: type: Reranking dataset: type: mteb/askubuntudupquestions-reranking name: MTEB AskUbuntuDupQuestions config: default split: test revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 metrics: - type: map value: 62.128470519187736 - type: mrr value: 74.28065778481289 - task: type: STS dataset: type: mteb/biosses-sts name: MTEB BIOSSES config: default split: test revision: d3fb88f8f02e40887cd149695127462bbcf29b4a metrics: - type: cos_sim_pearson value: 89.24629081484655 - type: cos_sim_spearman value: 86.93752309911496 - type: euclidean_pearson value: 87.58589628573816 - type: euclidean_spearman value: 88.05622328825284 - type: manhattan_pearson value: 87.5594959805773 - type: manhattan_spearman value: 88.19658793233961 - task: type: Classification dataset: type: mteb/banking77 name: MTEB Banking77Classification config: default split: test revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 metrics: - type: accuracy value: 86.9512987012987 - type: f1 value: 86.92515357973708 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-p2p name: MTEB BiorxivClusteringP2P config: default split: test revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 metrics: - type: v_measure value: 39.10263762928872 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-s2s name: MTEB BiorxivClusteringS2S config: default split: test revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 metrics: - type: v_measure value: 36.69711517426737 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackAndroidRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 32.327 - type: map_at_10 value: 44.099 - type: map_at_100 value: 45.525 - type: map_at_1000 value: 45.641999999999996 - type: map_at_3 value: 40.47 - type: map_at_5 value: 42.36 - type: mrr_at_1 value: 39.199 - type: mrr_at_10 value: 49.651 - type: mrr_at_100 value: 50.29 - type: mrr_at_1000 value: 50.329 - type: mrr_at_3 value: 46.924 - type: mrr_at_5 value: 48.548 - type: ndcg_at_1 value: 39.199 - type: ndcg_at_10 value: 50.773 - type: ndcg_at_100 value: 55.67999999999999 - type: ndcg_at_1000 value: 57.495 - type: ndcg_at_3 value: 45.513999999999996 - type: ndcg_at_5 value: 47.703 - type: precision_at_1 value: 39.199 - type: precision_at_10 value: 9.914000000000001 - type: precision_at_100 value: 1.5310000000000001 - type: precision_at_1000 value: 0.198 - type: precision_at_3 value: 21.984 - type: precision_at_5 value: 15.737000000000002 - type: recall_at_1 value: 32.327 - type: recall_at_10 value: 63.743 - type: recall_at_100 value: 84.538 - type: recall_at_1000 value: 96.089 - type: recall_at_3 value: 48.065000000000005 - type: recall_at_5 value: 54.519 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackEnglishRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 32.671 - type: map_at_10 value: 42.954 - type: map_at_100 value: 44.151 - type: map_at_1000 value: 44.287 - type: map_at_3 value: 39.912 - type: map_at_5 value: 41.798 - type: mrr_at_1 value: 41.465 - type: mrr_at_10 value: 49.351 - type: mrr_at_100 value: 49.980000000000004 - type: mrr_at_1000 value: 50.016000000000005 - type: mrr_at_3 value: 47.144000000000005 - type: mrr_at_5 value: 48.592999999999996 - type: ndcg_at_1 value: 41.465 - type: ndcg_at_10 value: 48.565999999999995 - type: ndcg_at_100 value: 52.76499999999999 - type: ndcg_at_1000 value: 54.749 - type: ndcg_at_3 value: 44.57 - type: ndcg_at_5 value: 46.759 - type: precision_at_1 value: 41.465 - type: precision_at_10 value: 9.107999999999999 - type: precision_at_100 value: 1.433 - type: precision_at_1000 value: 0.191 - type: precision_at_3 value: 21.423000000000002 - type: precision_at_5 value: 15.414 - type: recall_at_1 value: 32.671 - type: recall_at_10 value: 57.738 - type: recall_at_100 value: 75.86500000000001 - type: recall_at_1000 value: 88.36 - type: recall_at_3 value: 45.626 - type: recall_at_5 value: 51.812000000000005 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGamingRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 41.185 - type: map_at_10 value: 53.929 - type: map_at_100 value: 54.92 - type: map_at_1000 value: 54.967999999999996 - type: map_at_3 value: 50.70400000000001 - type: map_at_5 value: 52.673 - type: mrr_at_1 value: 47.398 - type: mrr_at_10 value: 57.303000000000004 - type: mrr_at_100 value: 57.959 - type: mrr_at_1000 value: 57.985 - type: mrr_at_3 value: 54.932 - type: mrr_at_5 value: 56.464999999999996 - type: ndcg_at_1 value: 47.398 - type: ndcg_at_10 value: 59.653 - type: ndcg_at_100 value: 63.627 - type: ndcg_at_1000 value: 64.596 - type: ndcg_at_3 value: 54.455 - type: ndcg_at_5 value: 57.245000000000005 - type: precision_at_1 value: 47.398 - type: precision_at_10 value: 9.524000000000001 - type: precision_at_100 value: 1.243 - type: precision_at_1000 value: 0.13699999999999998 - type: precision_at_3 value: 24.389 - type: precision_at_5 value: 16.752 - type: recall_at_1 value: 41.185 - type: recall_at_10 value: 73.193 - type: recall_at_100 value: 90.357 - type: recall_at_1000 value: 97.253 - type: recall_at_3 value: 59.199999999999996 - type: recall_at_5 value: 66.118 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGisRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.27 - type: map_at_10 value: 36.223 - type: map_at_100 value: 37.218 - type: map_at_1000 value: 37.293 - type: map_at_3 value: 33.503 - type: map_at_5 value: 35.097 - type: mrr_at_1 value: 29.492 - type: mrr_at_10 value: 38.352000000000004 - type: mrr_at_100 value: 39.188 - type: mrr_at_1000 value: 39.247 - type: mrr_at_3 value: 35.876000000000005 - type: mrr_at_5 value: 37.401 - type: ndcg_at_1 value: 29.492 - type: ndcg_at_10 value: 41.239 - type: ndcg_at_100 value: 46.066 - type: ndcg_at_1000 value: 47.992000000000004 - type: ndcg_at_3 value: 36.11 - type: ndcg_at_5 value: 38.772 - type: precision_at_1 value: 29.492 - type: precision_at_10 value: 6.260000000000001 - type: precision_at_100 value: 0.914 - type: precision_at_1000 value: 0.11100000000000002 - type: precision_at_3 value: 15.104000000000001 - type: precision_at_5 value: 10.644 - type: recall_at_1 value: 27.27 - type: recall_at_10 value: 54.589 - type: recall_at_100 value: 76.70700000000001 - type: recall_at_1000 value: 91.158 - type: recall_at_3 value: 40.974 - type: recall_at_5 value: 47.327000000000005 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackMathematicaRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 17.848 - type: map_at_10 value: 26.207 - type: map_at_100 value: 27.478 - type: map_at_1000 value: 27.602 - type: map_at_3 value: 23.405 - type: map_at_5 value: 24.98 - type: mrr_at_1 value: 21.891 - type: mrr_at_10 value: 31.041999999999998 - type: mrr_at_100 value: 32.092 - type: mrr_at_1000 value: 32.151999999999994 - type: mrr_at_3 value: 28.358 - type: mrr_at_5 value: 29.969 - type: ndcg_at_1 value: 21.891 - type: ndcg_at_10 value: 31.585 - type: ndcg_at_100 value: 37.531 - type: ndcg_at_1000 value: 40.256 - type: ndcg_at_3 value: 26.508 - type: ndcg_at_5 value: 28.894 - type: precision_at_1 value: 21.891 - type: precision_at_10 value: 5.795999999999999 - type: precision_at_100 value: 0.9990000000000001 - type: precision_at_1000 value: 0.13799999999999998 - type: precision_at_3 value: 12.769 - type: precision_at_5 value: 9.279 - type: recall_at_1 value: 17.848 - type: recall_at_10 value: 43.452 - type: recall_at_100 value: 69.216 - type: recall_at_1000 value: 88.102 - type: recall_at_3 value: 29.18 - type: recall_at_5 value: 35.347 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackPhysicsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 30.94 - type: map_at_10 value: 41.248000000000005 - type: map_at_100 value: 42.495 - type: map_at_1000 value: 42.602000000000004 - type: map_at_3 value: 37.939 - type: map_at_5 value: 39.924 - type: mrr_at_1 value: 37.824999999999996 - type: mrr_at_10 value: 47.041 - type: mrr_at_100 value: 47.83 - type: mrr_at_1000 value: 47.878 - type: mrr_at_3 value: 44.466 - type: mrr_at_5 value: 46.111999999999995 - type: ndcg_at_1 value: 37.824999999999996 - type: ndcg_at_10 value: 47.223 - type: ndcg_at_100 value: 52.394 - type: ndcg_at_1000 value: 54.432 - type: ndcg_at_3 value: 42.032000000000004 - type: ndcg_at_5 value: 44.772 - type: precision_at_1 value: 37.824999999999996 - type: precision_at_10 value: 8.393 - type: precision_at_100 value: 1.2890000000000001 - type: precision_at_1000 value: 0.164 - type: precision_at_3 value: 19.698 - type: precision_at_5 value: 14.013 - type: recall_at_1 value: 30.94 - type: recall_at_10 value: 59.316 - type: recall_at_100 value: 80.783 - type: recall_at_1000 value: 94.15400000000001 - type: recall_at_3 value: 44.712 - type: recall_at_5 value: 51.932 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackProgrammersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.104 - type: map_at_10 value: 36.675999999999995 - type: map_at_100 value: 38.076 - type: map_at_1000 value: 38.189 - type: map_at_3 value: 33.733999999999995 - type: map_at_5 value: 35.287 - type: mrr_at_1 value: 33.904 - type: mrr_at_10 value: 42.55 - type: mrr_at_100 value: 43.434 - type: mrr_at_1000 value: 43.494 - type: mrr_at_3 value: 40.126 - type: mrr_at_5 value: 41.473 - type: ndcg_at_1 value: 33.904 - type: ndcg_at_10 value: 42.414 - type: ndcg_at_100 value: 48.203 - type: ndcg_at_1000 value: 50.437 - type: ndcg_at_3 value: 37.633 - type: ndcg_at_5 value: 39.67 - type: precision_at_1 value: 33.904 - type: precision_at_10 value: 7.82 - type: precision_at_100 value: 1.2409999999999999 - type: precision_at_1000 value: 0.159 - type: precision_at_3 value: 17.884 - type: precision_at_5 value: 12.648000000000001 - type: recall_at_1 value: 27.104 - type: recall_at_10 value: 53.563 - type: recall_at_100 value: 78.557 - type: recall_at_1000 value: 93.533 - type: recall_at_3 value: 39.92 - type: recall_at_5 value: 45.457 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.707749999999997 - type: map_at_10 value: 36.961 - type: map_at_100 value: 38.158833333333334 - type: map_at_1000 value: 38.270333333333326 - type: map_at_3 value: 34.07183333333334 - type: map_at_5 value: 35.69533333333334 - type: mrr_at_1 value: 32.81875 - type: mrr_at_10 value: 41.293 - type: mrr_at_100 value: 42.116499999999995 - type: mrr_at_1000 value: 42.170249999999996 - type: mrr_at_3 value: 38.83983333333333 - type: mrr_at_5 value: 40.29775 - type: ndcg_at_1 value: 32.81875 - type: ndcg_at_10 value: 42.355 - type: ndcg_at_100 value: 47.41374999999999 - type: ndcg_at_1000 value: 49.5805 - type: ndcg_at_3 value: 37.52825 - type: ndcg_at_5 value: 39.83266666666667 - type: precision_at_1 value: 32.81875 - type: precision_at_10 value: 7.382416666666666 - type: precision_at_100 value: 1.1640833333333334 - type: precision_at_1000 value: 0.15383333333333335 - type: precision_at_3 value: 17.134166666666665 - type: precision_at_5 value: 12.174833333333336 - type: recall_at_1 value: 27.707749999999997 - type: recall_at_10 value: 53.945 - type: recall_at_100 value: 76.191 - type: recall_at_1000 value: 91.101 - type: recall_at_3 value: 40.39083333333334 - type: recall_at_5 value: 46.40083333333333 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackStatsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 26.482 - type: map_at_10 value: 33.201 - type: map_at_100 value: 34.107 - type: map_at_1000 value: 34.197 - type: map_at_3 value: 31.174000000000003 - type: map_at_5 value: 32.279 - type: mrr_at_1 value: 29.908 - type: mrr_at_10 value: 36.235 - type: mrr_at_100 value: 37.04 - type: mrr_at_1000 value: 37.105 - type: mrr_at_3 value: 34.355999999999995 - type: mrr_at_5 value: 35.382999999999996 - type: ndcg_at_1 value: 29.908 - type: ndcg_at_10 value: 37.325 - type: ndcg_at_100 value: 41.795 - type: ndcg_at_1000 value: 44.105 - type: ndcg_at_3 value: 33.555 - type: ndcg_at_5 value: 35.266999999999996 - type: precision_at_1 value: 29.908 - type: precision_at_10 value: 5.721 - type: precision_at_100 value: 0.8630000000000001 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 14.008000000000001 - type: precision_at_5 value: 9.754999999999999 - type: recall_at_1 value: 26.482 - type: recall_at_10 value: 47.072 - type: recall_at_100 value: 67.27 - type: recall_at_1000 value: 84.371 - type: recall_at_3 value: 36.65 - type: recall_at_5 value: 40.774 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackTexRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 18.815 - type: map_at_10 value: 26.369999999999997 - type: map_at_100 value: 27.458 - type: map_at_1000 value: 27.588 - type: map_at_3 value: 23.990000000000002 - type: map_at_5 value: 25.345000000000002 - type: mrr_at_1 value: 22.953000000000003 - type: mrr_at_10 value: 30.342999999999996 - type: mrr_at_100 value: 31.241000000000003 - type: mrr_at_1000 value: 31.319000000000003 - type: mrr_at_3 value: 28.16 - type: mrr_at_5 value: 29.406 - type: ndcg_at_1 value: 22.953000000000003 - type: ndcg_at_10 value: 31.151 - type: ndcg_at_100 value: 36.309000000000005 - type: ndcg_at_1000 value: 39.227000000000004 - type: ndcg_at_3 value: 26.921 - type: ndcg_at_5 value: 28.938000000000002 - type: precision_at_1 value: 22.953000000000003 - type: precision_at_10 value: 5.602 - type: precision_at_100 value: 0.9530000000000001 - type: precision_at_1000 value: 0.13899999999999998 - type: precision_at_3 value: 12.606 - type: precision_at_5 value: 9.119 - type: recall_at_1 value: 18.815 - type: recall_at_10 value: 41.574 - type: recall_at_100 value: 64.84400000000001 - type: recall_at_1000 value: 85.406 - type: recall_at_3 value: 29.694 - type: recall_at_5 value: 34.935 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackUnixRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.840999999999998 - type: map_at_10 value: 36.797999999999995 - type: map_at_100 value: 37.993 - type: map_at_1000 value: 38.086999999999996 - type: map_at_3 value: 34.050999999999995 - type: map_at_5 value: 35.379 - type: mrr_at_1 value: 32.649 - type: mrr_at_10 value: 41.025 - type: mrr_at_100 value: 41.878 - type: mrr_at_1000 value: 41.929 - type: mrr_at_3 value: 38.573 - type: mrr_at_5 value: 39.715 - type: ndcg_at_1 value: 32.649 - type: ndcg_at_10 value: 42.142 - type: ndcg_at_100 value: 47.558 - type: ndcg_at_1000 value: 49.643 - type: ndcg_at_3 value: 37.12 - type: ndcg_at_5 value: 38.983000000000004 - type: precision_at_1 value: 32.649 - type: precision_at_10 value: 7.08 - type: precision_at_100 value: 1.1039999999999999 - type: precision_at_1000 value: 0.13899999999999998 - type: precision_at_3 value: 16.698 - type: precision_at_5 value: 11.511000000000001 - type: recall_at_1 value: 27.840999999999998 - type: recall_at_10 value: 54.245 - type: recall_at_100 value: 77.947 - type: recall_at_1000 value: 92.36999999999999 - type: recall_at_3 value: 40.146 - type: recall_at_5 value: 44.951 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWebmastersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 26.529000000000003 - type: map_at_10 value: 35.010000000000005 - type: map_at_100 value: 36.647 - type: map_at_1000 value: 36.857 - type: map_at_3 value: 31.968000000000004 - type: map_at_5 value: 33.554 - type: mrr_at_1 value: 31.818 - type: mrr_at_10 value: 39.550999999999995 - type: mrr_at_100 value: 40.54 - type: mrr_at_1000 value: 40.596 - type: mrr_at_3 value: 36.726 - type: mrr_at_5 value: 38.416 - type: ndcg_at_1 value: 31.818 - type: ndcg_at_10 value: 40.675 - type: ndcg_at_100 value: 46.548 - type: ndcg_at_1000 value: 49.126 - type: ndcg_at_3 value: 35.829 - type: ndcg_at_5 value: 38.0 - type: precision_at_1 value: 31.818 - type: precision_at_10 value: 7.826 - type: precision_at_100 value: 1.538 - type: precision_at_1000 value: 0.24 - type: precision_at_3 value: 16.601 - type: precision_at_5 value: 12.095 - type: recall_at_1 value: 26.529000000000003 - type: recall_at_10 value: 51.03 - type: recall_at_100 value: 77.556 - type: recall_at_1000 value: 93.804 - type: recall_at_3 value: 36.986000000000004 - type: recall_at_5 value: 43.096000000000004 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWordpressRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 23.480999999999998 - type: map_at_10 value: 30.817 - type: map_at_100 value: 31.838 - type: map_at_1000 value: 31.932 - type: map_at_3 value: 28.011999999999997 - type: map_at_5 value: 29.668 - type: mrr_at_1 value: 25.323 - type: mrr_at_10 value: 33.072 - type: mrr_at_100 value: 33.926 - type: mrr_at_1000 value: 33.993 - type: mrr_at_3 value: 30.436999999999998 - type: mrr_at_5 value: 32.092 - type: ndcg_at_1 value: 25.323 - type: ndcg_at_10 value: 35.514 - type: ndcg_at_100 value: 40.489000000000004 - type: ndcg_at_1000 value: 42.908 - type: ndcg_at_3 value: 30.092000000000002 - type: ndcg_at_5 value: 32.989000000000004 - type: precision_at_1 value: 25.323 - type: precision_at_10 value: 5.545 - type: precision_at_100 value: 0.861 - type: precision_at_1000 value: 0.117 - type: precision_at_3 value: 12.446 - type: precision_at_5 value: 9.131 - type: recall_at_1 value: 23.480999999999998 - type: recall_at_10 value: 47.825 - type: recall_at_100 value: 70.652 - type: recall_at_1000 value: 88.612 - type: recall_at_3 value: 33.537 - type: recall_at_5 value: 40.542 - task: type: Retrieval dataset: type: climate-fever name: MTEB ClimateFEVER config: default split: test revision: None metrics: - type: map_at_1 value: 13.333999999999998 - type: map_at_10 value: 22.524 - type: map_at_100 value: 24.506 - type: map_at_1000 value: 24.715 - type: map_at_3 value: 19.022 - type: map_at_5 value: 20.693 - type: mrr_at_1 value: 29.186 - type: mrr_at_10 value: 41.22 - type: mrr_at_100 value: 42.16 - type: mrr_at_1000 value: 42.192 - type: mrr_at_3 value: 38.013000000000005 - type: mrr_at_5 value: 39.704 - type: ndcg_at_1 value: 29.186 - type: ndcg_at_10 value: 31.167 - type: ndcg_at_100 value: 38.879000000000005 - type: ndcg_at_1000 value: 42.376000000000005 - type: ndcg_at_3 value: 25.817 - type: ndcg_at_5 value: 27.377000000000002 - type: precision_at_1 value: 29.186 - type: precision_at_10 value: 9.693999999999999 - type: precision_at_100 value: 1.8030000000000002 - type: precision_at_1000 value: 0.246 - type: precision_at_3 value: 19.11 - type: precision_at_5 value: 14.344999999999999 - type: recall_at_1 value: 13.333999999999998 - type: recall_at_10 value: 37.092000000000006 - type: recall_at_100 value: 63.651 - type: recall_at_1000 value: 83.05 - type: recall_at_3 value: 23.74 - type: recall_at_5 value: 28.655 - task: type: Retrieval dataset: type: dbpedia-entity name: MTEB DBPedia config: default split: test revision: None metrics: - type: map_at_1 value: 9.151 - type: map_at_10 value: 19.653000000000002 - type: map_at_100 value: 28.053 - type: map_at_1000 value: 29.709000000000003 - type: map_at_3 value: 14.191 - type: map_at_5 value: 16.456 - type: mrr_at_1 value: 66.25 - type: mrr_at_10 value: 74.4 - type: mrr_at_100 value: 74.715 - type: mrr_at_1000 value: 74.726 - type: mrr_at_3 value: 72.417 - type: mrr_at_5 value: 73.667 - type: ndcg_at_1 value: 54.25 - type: ndcg_at_10 value: 40.77 - type: ndcg_at_100 value: 46.359 - type: ndcg_at_1000 value: 54.193000000000005 - type: ndcg_at_3 value: 44.832 - type: ndcg_at_5 value: 42.63 - type: precision_at_1 value: 66.25 - type: precision_at_10 value: 32.175 - type: precision_at_100 value: 10.668 - type: precision_at_1000 value: 2.067 - type: precision_at_3 value: 47.667 - type: precision_at_5 value: 41.3 - type: recall_at_1 value: 9.151 - type: recall_at_10 value: 25.003999999999998 - type: recall_at_100 value: 52.976 - type: recall_at_1000 value: 78.315 - type: recall_at_3 value: 15.487 - type: recall_at_5 value: 18.999 - task: type: Classification dataset: type: mteb/emotion name: MTEB EmotionClassification config: default split: test revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 metrics: - type: accuracy value: 51.89999999999999 - type: f1 value: 46.47777925067403 - task: type: Retrieval dataset: type: fever name: MTEB FEVER config: default split: test revision: None metrics: - type: map_at_1 value: 73.706 - type: map_at_10 value: 82.423 - type: map_at_100 value: 82.67999999999999 - type: map_at_1000 value: 82.694 - type: map_at_3 value: 81.328 - type: map_at_5 value: 82.001 - type: mrr_at_1 value: 79.613 - type: mrr_at_10 value: 87.07000000000001 - type: mrr_at_100 value: 87.169 - type: mrr_at_1000 value: 87.17 - type: mrr_at_3 value: 86.404 - type: mrr_at_5 value: 86.856 - type: ndcg_at_1 value: 79.613 - type: ndcg_at_10 value: 86.289 - type: ndcg_at_100 value: 87.201 - type: ndcg_at_1000 value: 87.428 - type: ndcg_at_3 value: 84.625 - type: ndcg_at_5 value: 85.53699999999999 - type: precision_at_1 value: 79.613 - type: precision_at_10 value: 10.399 - type: precision_at_100 value: 1.1079999999999999 - type: precision_at_1000 value: 0.11499999999999999 - type: precision_at_3 value: 32.473 - type: precision_at_5 value: 20.132 - type: recall_at_1 value: 73.706 - type: recall_at_10 value: 93.559 - type: recall_at_100 value: 97.188 - type: recall_at_1000 value: 98.555 - type: recall_at_3 value: 88.98700000000001 - type: recall_at_5 value: 91.373 - task: type: Retrieval dataset: type: fiqa name: MTEB FiQA2018 config: default split: test revision: None metrics: - type: map_at_1 value: 19.841 - type: map_at_10 value: 32.643 - type: map_at_100 value: 34.575 - type: map_at_1000 value: 34.736 - type: map_at_3 value: 28.317999999999998 - type: map_at_5 value: 30.964000000000002 - type: mrr_at_1 value: 39.660000000000004 - type: mrr_at_10 value: 48.620000000000005 - type: mrr_at_100 value: 49.384 - type: mrr_at_1000 value: 49.415 - type: mrr_at_3 value: 45.988 - type: mrr_at_5 value: 47.361 - type: ndcg_at_1 value: 39.660000000000004 - type: ndcg_at_10 value: 40.646 - type: ndcg_at_100 value: 47.657 - type: ndcg_at_1000 value: 50.428 - type: ndcg_at_3 value: 36.689 - type: ndcg_at_5 value: 38.211 - type: precision_at_1 value: 39.660000000000004 - type: precision_at_10 value: 11.235000000000001 - type: precision_at_100 value: 1.8530000000000002 - type: precision_at_1000 value: 0.23600000000000002 - type: precision_at_3 value: 24.587999999999997 - type: precision_at_5 value: 18.395 - type: recall_at_1 value: 19.841 - type: recall_at_10 value: 48.135 - type: recall_at_100 value: 74.224 - type: recall_at_1000 value: 90.826 - type: recall_at_3 value: 33.536 - type: recall_at_5 value: 40.311 - task: type: Retrieval dataset: type: hotpotqa name: MTEB HotpotQA config: default split: test revision: None metrics: - type: map_at_1 value: 40.358 - type: map_at_10 value: 64.497 - type: map_at_100 value: 65.362 - type: map_at_1000 value: 65.41900000000001 - type: map_at_3 value: 61.06700000000001 - type: map_at_5 value: 63.317 - type: mrr_at_1 value: 80.716 - type: mrr_at_10 value: 86.10799999999999 - type: mrr_at_100 value: 86.265 - type: mrr_at_1000 value: 86.27 - type: mrr_at_3 value: 85.271 - type: mrr_at_5 value: 85.82499999999999 - type: ndcg_at_1 value: 80.716 - type: ndcg_at_10 value: 72.597 - type: ndcg_at_100 value: 75.549 - type: ndcg_at_1000 value: 76.61 - type: ndcg_at_3 value: 67.874 - type: ndcg_at_5 value: 70.655 - type: precision_at_1 value: 80.716 - type: precision_at_10 value: 15.148 - type: precision_at_100 value: 1.745 - type: precision_at_1000 value: 0.188 - type: precision_at_3 value: 43.597 - type: precision_at_5 value: 28.351 - type: recall_at_1 value: 40.358 - type: recall_at_10 value: 75.739 - type: recall_at_100 value: 87.259 - type: recall_at_1000 value: 94.234 - type: recall_at_3 value: 65.39500000000001 - type: recall_at_5 value: 70.878 - task: type: Classification dataset: type: mteb/imdb name: MTEB ImdbClassification config: default split: test revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 metrics: - type: accuracy value: 90.80799999999998 - type: ap value: 86.81350378180757 - type: f1 value: 90.79901248314215 - task: type: Retrieval dataset: type: msmarco name: MTEB MSMARCO config: default split: dev revision: None metrics: - type: map_at_1 value: 22.096 - type: map_at_10 value: 34.384 - type: map_at_100 value: 35.541 - type: map_at_1000 value: 35.589999999999996 - type: map_at_3 value: 30.496000000000002 - type: map_at_5 value: 32.718 - type: mrr_at_1 value: 22.750999999999998 - type: mrr_at_10 value: 35.024 - type: mrr_at_100 value: 36.125 - type: mrr_at_1000 value: 36.168 - type: mrr_at_3 value: 31.225 - type: mrr_at_5 value: 33.416000000000004 - type: ndcg_at_1 value: 22.750999999999998 - type: ndcg_at_10 value: 41.351 - type: ndcg_at_100 value: 46.92 - type: ndcg_at_1000 value: 48.111 - type: ndcg_at_3 value: 33.439 - type: ndcg_at_5 value: 37.407000000000004 - type: precision_at_1 value: 22.750999999999998 - type: precision_at_10 value: 6.564 - type: precision_at_100 value: 0.935 - type: precision_at_1000 value: 0.104 - type: precision_at_3 value: 14.288 - type: precision_at_5 value: 10.581999999999999 - type: recall_at_1 value: 22.096 - type: recall_at_10 value: 62.771 - type: recall_at_100 value: 88.529 - type: recall_at_1000 value: 97.55 - type: recall_at_3 value: 41.245 - type: recall_at_5 value: 50.788 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (en) config: en split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 94.16780665754673 - type: f1 value: 93.96331194859894 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (en) config: en split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 76.90606475148198 - type: f1 value: 58.58344986604187 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (en) config: en split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 76.14660390047075 - type: f1 value: 74.31533923533614 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (en) config: en split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 80.16139878950908 - type: f1 value: 80.18532656824924 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-p2p name: MTEB MedrxivClusteringP2P config: default split: test revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 metrics: - type: v_measure value: 32.949880906135085 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-s2s name: MTEB MedrxivClusteringS2S config: default split: test revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 metrics: - type: v_measure value: 31.56300351524862 - task: type: Reranking dataset: type: mteb/mind_small name: MTEB MindSmallReranking config: default split: test revision: 3bdac13927fdc888b903db93b2ffdbd90b295a69 metrics: - type: map value: 31.196521894371315 - type: mrr value: 32.22644231694389 - task: type: Retrieval dataset: type: nfcorpus name: MTEB NFCorpus config: default split: test revision: None metrics: - type: map_at_1 value: 6.783 - type: map_at_10 value: 14.549000000000001 - type: map_at_100 value: 18.433 - type: map_at_1000 value: 19.949 - type: map_at_3 value: 10.936 - type: map_at_5 value: 12.514 - type: mrr_at_1 value: 47.368 - type: mrr_at_10 value: 56.42 - type: mrr_at_100 value: 56.908 - type: mrr_at_1000 value: 56.95 - type: mrr_at_3 value: 54.283 - type: mrr_at_5 value: 55.568 - type: ndcg_at_1 value: 45.666000000000004 - type: ndcg_at_10 value: 37.389 - type: ndcg_at_100 value: 34.253 - type: ndcg_at_1000 value: 43.059999999999995 - type: ndcg_at_3 value: 42.725 - type: ndcg_at_5 value: 40.193 - type: precision_at_1 value: 47.368 - type: precision_at_10 value: 27.988000000000003 - type: precision_at_100 value: 8.672 - type: precision_at_1000 value: 2.164 - type: precision_at_3 value: 40.248 - type: precision_at_5 value: 34.737 - type: recall_at_1 value: 6.783 - type: recall_at_10 value: 17.838 - type: recall_at_100 value: 33.672000000000004 - type: recall_at_1000 value: 66.166 - type: recall_at_3 value: 11.849 - type: recall_at_5 value: 14.205000000000002 - task: type: Retrieval dataset: type: nq name: MTEB NQ config: default split: test revision: None metrics: - type: map_at_1 value: 31.698999999999998 - type: map_at_10 value: 46.556 - type: map_at_100 value: 47.652 - type: map_at_1000 value: 47.68 - type: map_at_3 value: 42.492000000000004 - type: map_at_5 value: 44.763999999999996 - type: mrr_at_1 value: 35.747 - type: mrr_at_10 value: 49.242999999999995 - type: mrr_at_100 value: 50.052 - type: mrr_at_1000 value: 50.068 - type: mrr_at_3 value: 45.867000000000004 - type: mrr_at_5 value: 47.778999999999996 - type: ndcg_at_1 value: 35.717999999999996 - type: ndcg_at_10 value: 54.14600000000001 - type: ndcg_at_100 value: 58.672999999999995 - type: ndcg_at_1000 value: 59.279 - type: ndcg_at_3 value: 46.407 - type: ndcg_at_5 value: 50.181 - type: precision_at_1 value: 35.717999999999996 - type: precision_at_10 value: 8.844000000000001 - type: precision_at_100 value: 1.139 - type: precision_at_1000 value: 0.12 - type: precision_at_3 value: 20.993000000000002 - type: precision_at_5 value: 14.791000000000002 - type: recall_at_1 value: 31.698999999999998 - type: recall_at_10 value: 74.693 - type: recall_at_100 value: 94.15299999999999 - type: recall_at_1000 value: 98.585 - type: recall_at_3 value: 54.388999999999996 - type: recall_at_5 value: 63.08200000000001 - task: type: Retrieval dataset: type: quora name: MTEB QuoraRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 71.283 - type: map_at_10 value: 85.24000000000001 - type: map_at_100 value: 85.882 - type: map_at_1000 value: 85.897 - type: map_at_3 value: 82.326 - type: map_at_5 value: 84.177 - type: mrr_at_1 value: 82.21000000000001 - type: mrr_at_10 value: 88.228 - type: mrr_at_100 value: 88.32 - type: mrr_at_1000 value: 88.32 - type: mrr_at_3 value: 87.323 - type: mrr_at_5 value: 87.94800000000001 - type: ndcg_at_1 value: 82.17999999999999 - type: ndcg_at_10 value: 88.9 - type: ndcg_at_100 value: 90.079 - type: ndcg_at_1000 value: 90.158 - type: ndcg_at_3 value: 86.18299999999999 - type: ndcg_at_5 value: 87.71799999999999 - type: precision_at_1 value: 82.17999999999999 - type: precision_at_10 value: 13.464 - type: precision_at_100 value: 1.533 - type: precision_at_1000 value: 0.157 - type: precision_at_3 value: 37.693 - type: precision_at_5 value: 24.792 - type: recall_at_1 value: 71.283 - type: recall_at_10 value: 95.742 - type: recall_at_100 value: 99.67200000000001 - type: recall_at_1000 value: 99.981 - type: recall_at_3 value: 87.888 - type: recall_at_5 value: 92.24 - task: type: Clustering dataset: type: mteb/reddit-clustering name: MTEB RedditClustering config: default split: test revision: 24640382cdbf8abc73003fb0fa6d111a705499eb metrics: - type: v_measure value: 56.24267063669042 - task: type: Clustering dataset: type: mteb/reddit-clustering-p2p name: MTEB RedditClusteringP2P config: default split: test revision: 282350215ef01743dc01b456c7f5241fa8937f16 metrics: - type: v_measure value: 62.88056988932578 - task: type: Retrieval dataset: type: scidocs name: MTEB SCIDOCS config: default split: test revision: None metrics: - type: map_at_1 value: 4.903 - type: map_at_10 value: 13.202 - type: map_at_100 value: 15.5 - type: map_at_1000 value: 15.870999999999999 - type: map_at_3 value: 9.407 - type: map_at_5 value: 11.238 - type: mrr_at_1 value: 24.2 - type: mrr_at_10 value: 35.867 - type: mrr_at_100 value: 37.001 - type: mrr_at_1000 value: 37.043 - type: mrr_at_3 value: 32.5 - type: mrr_at_5 value: 34.35 - type: ndcg_at_1 value: 24.2 - type: ndcg_at_10 value: 21.731 - type: ndcg_at_100 value: 30.7 - type: ndcg_at_1000 value: 36.618 - type: ndcg_at_3 value: 20.72 - type: ndcg_at_5 value: 17.954 - type: precision_at_1 value: 24.2 - type: precision_at_10 value: 11.33 - type: precision_at_100 value: 2.4410000000000003 - type: precision_at_1000 value: 0.386 - type: precision_at_3 value: 19.667 - type: precision_at_5 value: 15.86 - type: recall_at_1 value: 4.903 - type: recall_at_10 value: 22.962 - type: recall_at_100 value: 49.563 - type: recall_at_1000 value: 78.238 - type: recall_at_3 value: 11.953 - type: recall_at_5 value: 16.067999999999998 - task: type: STS dataset: type: mteb/sickr-sts name: MTEB SICK-R config: default split: test revision: a6ea5a8cab320b040a23452cc28066d9beae2cee metrics: - type: cos_sim_pearson value: 84.12694254604078 - type: cos_sim_spearman value: 80.30141815181918 - type: euclidean_pearson value: 81.34015449877128 - type: euclidean_spearman value: 80.13984197010849 - type: manhattan_pearson value: 81.31767068124086 - type: manhattan_spearman value: 80.11720513114103 - task: type: STS dataset: type: mteb/sts12-sts name: MTEB STS12 config: default split: test revision: a0d554a64d88156834ff5ae9920b964011b16384 metrics: - type: cos_sim_pearson value: 86.13112984010417 - type: cos_sim_spearman value: 78.03063573402875 - type: euclidean_pearson value: 83.51928418844804 - type: euclidean_spearman value: 78.4045235411144 - type: manhattan_pearson value: 83.49981637388689 - type: manhattan_spearman value: 78.4042575139372 - task: type: STS dataset: type: mteb/sts13-sts name: MTEB STS13 config: default split: test revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca metrics: - type: cos_sim_pearson value: 82.50327987379504 - type: cos_sim_spearman value: 84.18556767756205 - type: euclidean_pearson value: 82.69684424327679 - type: euclidean_spearman value: 83.5368106038335 - type: manhattan_pearson value: 82.57967581007374 - type: manhattan_spearman value: 83.43009053133697 - task: type: STS dataset: type: mteb/sts14-sts name: MTEB STS14 config: default split: test revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 metrics: - type: cos_sim_pearson value: 82.50756863007814 - type: cos_sim_spearman value: 82.27204331279108 - type: euclidean_pearson value: 81.39535251429741 - type: euclidean_spearman value: 81.84386626336239 - type: manhattan_pearson value: 81.34281737280695 - type: manhattan_spearman value: 81.81149375673166 - task: type: STS dataset: type: mteb/sts15-sts name: MTEB STS15 config: default split: test revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 metrics: - type: cos_sim_pearson value: 86.8727714856726 - type: cos_sim_spearman value: 87.95738287792312 - type: euclidean_pearson value: 86.62920602795887 - type: euclidean_spearman value: 87.05207355381243 - type: manhattan_pearson value: 86.53587918472225 - type: manhattan_spearman value: 86.95382961029586 - task: type: STS dataset: type: mteb/sts16-sts name: MTEB STS16 config: default split: test revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 metrics: - type: cos_sim_pearson value: 83.52240359769479 - type: cos_sim_spearman value: 85.47685776238286 - type: euclidean_pearson value: 84.25815333483058 - type: euclidean_spearman value: 85.27415639683198 - type: manhattan_pearson value: 84.29127757025637 - type: manhattan_spearman value: 85.30226224917351 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-en) config: en-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 86.42501708915708 - type: cos_sim_spearman value: 86.42276182795041 - type: euclidean_pearson value: 86.5408207354761 - type: euclidean_spearman value: 85.46096321750838 - type: manhattan_pearson value: 86.54177303026881 - type: manhattan_spearman value: 85.50313151916117 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (en) config: en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 64.86521089250766 - type: cos_sim_spearman value: 65.94868540323003 - type: euclidean_pearson value: 67.16569626533084 - type: euclidean_spearman value: 66.37667004134917 - type: manhattan_pearson value: 67.1482365102333 - type: manhattan_spearman value: 66.53240122580029 - task: type: STS dataset: type: mteb/stsbenchmark-sts name: MTEB STSBenchmark config: default split: test revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 metrics: - type: cos_sim_pearson value: 84.64746265365318 - type: cos_sim_spearman value: 86.41888825906786 - type: euclidean_pearson value: 85.27453642725811 - type: euclidean_spearman value: 85.94095796602544 - type: manhattan_pearson value: 85.28643660505334 - type: manhattan_spearman value: 85.95028003260744 - task: type: Reranking dataset: type: mteb/scidocs-reranking name: MTEB SciDocsRR config: default split: test revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab metrics: - type: map value: 87.48903153618527 - type: mrr value: 96.41081503826601 - task: type: Retrieval dataset: type: scifact name: MTEB SciFact config: default split: test revision: None metrics: - type: map_at_1 value: 58.594 - type: map_at_10 value: 69.296 - type: map_at_100 value: 69.782 - type: map_at_1000 value: 69.795 - type: map_at_3 value: 66.23 - type: map_at_5 value: 68.293 - type: mrr_at_1 value: 61.667 - type: mrr_at_10 value: 70.339 - type: mrr_at_100 value: 70.708 - type: mrr_at_1000 value: 70.722 - type: mrr_at_3 value: 68.0 - type: mrr_at_5 value: 69.56700000000001 - type: ndcg_at_1 value: 61.667 - type: ndcg_at_10 value: 74.039 - type: ndcg_at_100 value: 76.103 - type: ndcg_at_1000 value: 76.47800000000001 - type: ndcg_at_3 value: 68.967 - type: ndcg_at_5 value: 71.96900000000001 - type: precision_at_1 value: 61.667 - type: precision_at_10 value: 9.866999999999999 - type: precision_at_100 value: 1.097 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 27.111 - type: precision_at_5 value: 18.2 - type: recall_at_1 value: 58.594 - type: recall_at_10 value: 87.422 - type: recall_at_100 value: 96.667 - type: recall_at_1000 value: 99.667 - type: recall_at_3 value: 74.217 - type: recall_at_5 value: 81.539 - task: type: PairClassification dataset: type: mteb/sprintduplicatequestions-pairclassification name: MTEB SprintDuplicateQuestions config: default split: test revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 metrics: - type: cos_sim_accuracy value: 99.85049504950496 - type: cos_sim_ap value: 96.33111544137081 - type: cos_sim_f1 value: 92.35443037974684 - type: cos_sim_precision value: 93.53846153846153 - type: cos_sim_recall value: 91.2 - type: dot_accuracy value: 99.82376237623762 - type: dot_ap value: 95.38082527310888 - type: dot_f1 value: 90.90909090909092 - type: dot_precision value: 92.90187891440502 - type: dot_recall value: 89.0 - type: euclidean_accuracy value: 99.84851485148515 - type: euclidean_ap value: 96.32316003996347 - type: euclidean_f1 value: 92.2071392659628 - type: euclidean_precision value: 92.71991911021233 - type: euclidean_recall value: 91.7 - type: manhattan_accuracy value: 99.84851485148515 - type: manhattan_ap value: 96.3655668249217 - type: manhattan_f1 value: 92.18356026222895 - type: manhattan_precision value: 92.98067141403867 - type: manhattan_recall value: 91.4 - type: max_accuracy value: 99.85049504950496 - type: max_ap value: 96.3655668249217 - type: max_f1 value: 92.35443037974684 - task: type: Clustering dataset: type: mteb/stackexchange-clustering name: MTEB StackExchangeClustering config: default split: test revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 metrics: - type: v_measure value: 65.94861371629051 - task: type: Clustering dataset: type: mteb/stackexchange-clustering-p2p name: MTEB StackExchangeClusteringP2P config: default split: test revision: 815ca46b2622cec33ccafc3735d572c266efdb44 metrics: - type: v_measure value: 35.009430451385 - task: type: Reranking dataset: type: mteb/stackoverflowdupquestions-reranking name: MTEB StackOverflowDupQuestions config: default split: test revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 metrics: - type: map value: 54.61164066427969 - type: mrr value: 55.49710603938544 - task: type: Summarization dataset: type: mteb/summeval name: MTEB SummEval config: default split: test revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c metrics: - type: cos_sim_pearson value: 30.622620124907662 - type: cos_sim_spearman value: 31.0678351356163 - type: dot_pearson value: 30.863727693306814 - type: dot_spearman value: 31.230306567021255 - task: type: Retrieval dataset: type: trec-covid name: MTEB TRECCOVID config: default split: test revision: None metrics: - type: map_at_1 value: 0.22 - type: map_at_10 value: 2.011 - type: map_at_100 value: 10.974 - type: map_at_1000 value: 25.819 - type: map_at_3 value: 0.6649999999999999 - type: map_at_5 value: 1.076 - type: mrr_at_1 value: 86.0 - type: mrr_at_10 value: 91.8 - type: mrr_at_100 value: 91.8 - type: mrr_at_1000 value: 91.8 - type: mrr_at_3 value: 91.0 - type: mrr_at_5 value: 91.8 - type: ndcg_at_1 value: 82.0 - type: ndcg_at_10 value: 78.07300000000001 - type: ndcg_at_100 value: 58.231 - type: ndcg_at_1000 value: 51.153000000000006 - type: ndcg_at_3 value: 81.123 - type: ndcg_at_5 value: 81.059 - type: precision_at_1 value: 86.0 - type: precision_at_10 value: 83.0 - type: precision_at_100 value: 59.38 - type: precision_at_1000 value: 22.55 - type: precision_at_3 value: 87.333 - type: precision_at_5 value: 86.8 - type: recall_at_1 value: 0.22 - type: recall_at_10 value: 2.2079999999999997 - type: recall_at_100 value: 14.069 - type: recall_at_1000 value: 47.678 - type: recall_at_3 value: 0.7040000000000001 - type: recall_at_5 value: 1.161 - task: type: Retrieval dataset: type: webis-touche2020 name: MTEB Touche2020 config: default split: test revision: None metrics: - type: map_at_1 value: 2.809 - type: map_at_10 value: 10.394 - type: map_at_100 value: 16.598 - type: map_at_1000 value: 18.142 - type: map_at_3 value: 5.572 - type: map_at_5 value: 7.1370000000000005 - type: mrr_at_1 value: 32.653 - type: mrr_at_10 value: 46.564 - type: mrr_at_100 value: 47.469 - type: mrr_at_1000 value: 47.469 - type: mrr_at_3 value: 42.177 - type: mrr_at_5 value: 44.524 - type: ndcg_at_1 value: 30.612000000000002 - type: ndcg_at_10 value: 25.701 - type: ndcg_at_100 value: 37.532 - type: ndcg_at_1000 value: 48.757 - type: ndcg_at_3 value: 28.199999999999996 - type: ndcg_at_5 value: 25.987 - type: precision_at_1 value: 32.653 - type: precision_at_10 value: 23.469 - type: precision_at_100 value: 7.9799999999999995 - type: precision_at_1000 value: 1.5350000000000001 - type: precision_at_3 value: 29.932 - type: precision_at_5 value: 26.122 - type: recall_at_1 value: 2.809 - type: recall_at_10 value: 16.887 - type: recall_at_100 value: 48.67 - type: recall_at_1000 value: 82.89699999999999 - type: recall_at_3 value: 6.521000000000001 - type: recall_at_5 value: 9.609 - task: type: Classification dataset: type: mteb/toxic_conversations_50k name: MTEB ToxicConversationsClassification config: default split: test revision: d7c0de2777da35d6aae2200a62c6e0e5af397c4c metrics: - type: accuracy value: 71.57860000000001 - type: ap value: 13.82629211536393 - type: f1 value: 54.59860966183956 - task: type: Classification dataset: type: mteb/tweet_sentiment_extraction name: MTEB TweetSentimentExtractionClassification config: default split: test revision: d604517c81ca91fe16a244d1248fc021f9ecee7a metrics: - type: accuracy value: 59.38030560271647 - type: f1 value: 59.69685552567865 - task: type: Clustering dataset: type: mteb/twentynewsgroups-clustering name: MTEB TwentyNewsgroupsClustering config: default split: test revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 metrics: - type: v_measure value: 51.4736717043405 - task: type: PairClassification dataset: type: mteb/twittersemeval2015-pairclassification name: MTEB TwitterSemEval2015 config: default split: test revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 metrics: - type: cos_sim_accuracy value: 86.92853311080646 - type: cos_sim_ap value: 77.67872502591382 - type: cos_sim_f1 value: 70.33941236068895 - type: cos_sim_precision value: 67.63273258645884 - type: cos_sim_recall value: 73.27176781002639 - type: dot_accuracy value: 85.79603027954938 - type: dot_ap value: 73.73786190233379 - type: dot_f1 value: 67.3437901774235 - type: dot_precision value: 65.67201604814443 - type: dot_recall value: 69.10290237467018 - type: euclidean_accuracy value: 86.94045419324074 - type: euclidean_ap value: 77.6687791535167 - type: euclidean_f1 value: 70.47209214023542 - type: euclidean_precision value: 67.7207492094381 - type: euclidean_recall value: 73.45646437994723 - type: manhattan_accuracy value: 86.87488823985218 - type: manhattan_ap value: 77.63373392430728 - type: manhattan_f1 value: 70.40920716112532 - type: manhattan_precision value: 68.31265508684864 - type: manhattan_recall value: 72.63852242744063 - type: max_accuracy value: 86.94045419324074 - type: max_ap value: 77.67872502591382 - type: max_f1 value: 70.47209214023542 - task: type: PairClassification dataset: type: mteb/twitterurlcorpus-pairclassification name: MTEB TwitterURLCorpus config: default split: test revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf metrics: - type: cos_sim_accuracy value: 88.67155664221679 - type: cos_sim_ap value: 85.64591703003417 - type: cos_sim_f1 value: 77.59531005352656 - type: cos_sim_precision value: 73.60967184801382 - type: cos_sim_recall value: 82.03726516784724 - type: dot_accuracy value: 88.41541506578181 - type: dot_ap value: 84.6482788957769 - type: dot_f1 value: 77.04748541466657 - type: dot_precision value: 74.02440754931176 - type: dot_recall value: 80.3279950723745 - type: euclidean_accuracy value: 88.63080684596576 - type: euclidean_ap value: 85.44570045321562 - type: euclidean_f1 value: 77.28769403336106 - type: euclidean_precision value: 72.90600040958427 - type: euclidean_recall value: 82.22975053895904 - type: manhattan_accuracy value: 88.59393798269105 - type: manhattan_ap value: 85.40271361038187 - type: manhattan_f1 value: 77.17606419344392 - type: manhattan_precision value: 72.4447747078295 - type: manhattan_recall value: 82.5685247921158 - type: max_accuracy value: 88.67155664221679 - type: max_ap value: 85.64591703003417 - type: max_f1 value: 77.59531005352656 license: mit language: - en --- <h1 align="center">FlagEmbedding</h1> <h4 align="center"> <p> <a href=#model-list>Model List</a> | <a href=#frequently-asked-questions>FAQ</a> | <a href=#usage>Usage</a> | <a href="#evaluation">Evaluation</a> | <a href="#train">Train</a> | <a href="#contact">Contact</a> | <a href="#citation">Citation</a> | <a href="#license">License</a> <p> </h4> For more details please refer to our Github: [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding). If you are looking for a model that supports more languages, longer texts, and other retrieval methods, you can try using [bge-m3](https://huggingface.co/BAAI/bge-m3). [English](README.md) | [中文](https://github.com/FlagOpen/FlagEmbedding/blob/master/README_zh.md) FlagEmbedding focuses on retrieval-augmented LLMs, consisting of the following projects currently: - **Long-Context LLM**: [Activation Beacon](https://github.com/FlagOpen/FlagEmbedding/tree/master/Long_LLM/activation_beacon) - **Fine-tuning of LM** : [LM-Cocktail](https://github.com/FlagOpen/FlagEmbedding/tree/master/LM_Cocktail) - **Dense Retrieval**: [BGE-M3](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3), [LLM Embedder](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder), [BGE Embedding](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/baai_general_embedding) - **Reranker Model**: [BGE Reranker](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker) - **Benchmark**: [C-MTEB](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB) ## News - 1/30/2024: Release **BGE-M3**, a new member to BGE model series! M3 stands for **M**ulti-linguality (100+ languages), **M**ulti-granularities (input length up to 8192), **M**ulti-Functionality (unification of dense, lexical, multi-vec/colbert retrieval). It is the first embedding model which supports all three retrieval methods, achieving new SOTA on multi-lingual (MIRACL) and cross-lingual (MKQA) benchmarks. [Technical Report](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/BGE_M3/BGE_M3.pdf) and [Code](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3). :fire: - 1/9/2024: Release [Activation-Beacon](https://github.com/FlagOpen/FlagEmbedding/tree/master/Long_LLM/activation_beacon), an effective, efficient, compatible, and low-cost (training) method to extend the context length of LLM. [Technical Report](https://arxiv.org/abs/2401.03462) :fire: - 12/24/2023: Release **LLaRA**, a LLaMA-7B based dense retriever, leading to state-of-the-art performances on MS MARCO and BEIR. Model and code will be open-sourced. Please stay tuned. [Technical Report](https://arxiv.org/abs/2312.15503) :fire: - 11/23/2023: Release [LM-Cocktail](https://github.com/FlagOpen/FlagEmbedding/tree/master/LM_Cocktail), a method to maintain general capabilities during fine-tuning by merging multiple language models. [Technical Report](https://arxiv.org/abs/2311.13534) :fire: - 10/12/2023: Release [LLM-Embedder](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder), a unified embedding model to support diverse retrieval augmentation needs for LLMs. [Technical Report](https://arxiv.org/pdf/2310.07554.pdf) - 09/15/2023: The [technical report](https://arxiv.org/pdf/2309.07597.pdf) and [massive training data](https://data.baai.ac.cn/details/BAAI-MTP) of BGE has been released - 09/12/2023: New models: - **New reranker model**: release cross-encoder models `BAAI/bge-reranker-base` and `BAAI/bge-reranker-large`, which are more powerful than embedding model. We recommend to use/fine-tune them to re-rank top-k documents returned by embedding models. - **update embedding model**: release `bge-*-v1.5` embedding model to alleviate the issue of the similarity distribution, and enhance its retrieval ability without instruction. <details> <summary>More</summary> <!-- ### More --> - 09/07/2023: Update [fine-tune code](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md): Add script to mine hard negatives and support adding instruction during fine-tuning. - 08/09/2023: BGE Models are integrated into **Langchain**, you can use it like [this](#using-langchain); C-MTEB **leaderboard** is [available](https://huggingface.co/spaces/mteb/leaderboard). - 08/05/2023: Release base-scale and small-scale models, **best performance among the models of the same size 🤗** - 08/02/2023: Release `bge-large-*`(short for BAAI General Embedding) Models, **rank 1st on MTEB and C-MTEB benchmark!** :tada: :tada: - 08/01/2023: We release the [Chinese Massive Text Embedding Benchmark](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB) (**C-MTEB**), consisting of 31 test dataset. </details> ## Model List `bge` is short for `BAAI general embedding`. | Model | Language | | Description | query instruction for retrieval [1] | |:-------------------------------|:--------:| :--------:| :--------:|:--------:| | [BAAI/bge-m3](https://huggingface.co/BAAI/bge-m3) | Multilingual | [Inference](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3#usage) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3) | Multi-Functionality(dense retrieval, sparse retrieval, multi-vector(colbert)), Multi-Linguality, and Multi-Granularity(8192 tokens) | | | [BAAI/llm-embedder](https://huggingface.co/BAAI/llm-embedder) | English | [Inference](./FlagEmbedding/llm_embedder/README.md) [Fine-tune](./FlagEmbedding/llm_embedder/README.md) | a unified embedding model to support diverse retrieval augmentation needs for LLMs | See [README](./FlagEmbedding/llm_embedder/README.md) | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh-v1.5](https://huggingface.co/BAAI/bge-large-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-large-en](https://huggingface.co/BAAI/bge-large-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [MTEB](https://huggingface.co/spaces/mteb/leaderboard) leaderboard | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en](https://huggingface.co/BAAI/bge-base-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-en` | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en](https://huggingface.co/BAAI/bge-small-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) |a small-scale model but with competitive performance | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [C-MTEB](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB) benchmark | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-zh` | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a small-scale model but with competitive performance | `为这个句子生成表示以用于检索相关文章：` | [1\]: If you need to search the relevant passages to a query, we suggest to add the instruction to the query; in other cases, no instruction is needed, just use the original query directly. In all cases, **no instruction** needs to be added to passages. [2\]: Different from embedding model, reranker uses question and document as input and directly output similarity instead of embedding. To balance the accuracy and time cost, cross-encoder is widely used to re-rank top-k documents retrieved by other simple models. For examples, use bge embedding model to retrieve top 100 relevant documents, and then use bge reranker to re-rank the top 100 document to get the final top-3 results. All models have been uploaded to Huggingface Hub, and you can see them at https://huggingface.co/BAAI. If you cannot open the Huggingface Hub, you also can download the models at https://model.baai.ac.cn/models . ## Frequently asked questions <details> <summary>1. How to fine-tune bge embedding model?</summary> <!-- ### How to fine-tune bge embedding model? --> Following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) to prepare data and fine-tune your model. Some suggestions: - Mine hard negatives following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune#hard-negatives), which can improve the retrieval performance. - If you pre-train bge on your data, the pre-trained model cannot be directly used to calculate similarity, and it must be fine-tuned with contrastive learning before computing similarity. - If the accuracy of the fine-tuned model is still not high, it is recommended to use/fine-tune the cross-encoder model (bge-reranker) to re-rank top-k results. Hard negatives also are needed to fine-tune reranker. </details> <details> <summary>2. The similarity score between two dissimilar sentences is higher than 0.5</summary> <!-- ### The similarity score between two dissimilar sentences is higher than 0.5 --> **Suggest to use bge v1.5, which alleviates the issue of the similarity distribution.** Since we finetune the models by contrastive learning with a temperature of 0.01, the similarity distribution of the current BGE model is about in the interval \[0.6, 1\]. So a similarity score greater than 0.5 does not indicate that the two sentences are similar. For downstream tasks, such as passage retrieval or semantic similarity, **what matters is the relative order of the scores, not the absolute value.** If you need to filter similar sentences based on a similarity threshold, please select an appropriate similarity threshold based on the similarity distribution on your data (such as 0.8, 0.85, or even 0.9). </details> <details> <summary>3. When does the query instruction need to be used</summary> <!-- ### When does the query instruction need to be used --> For the `bge-*-v1.5`, we improve its retrieval ability when not using instruction. No instruction only has a slight degradation in retrieval performance compared with using instruction. So you can generate embedding without instruction in all cases for convenience. For a retrieval task that uses short queries to find long related documents, it is recommended to add instructions for these short queries. **The best method to decide whether to add instructions for queries is choosing the setting that achieves better performance on your task.** In all cases, the documents/passages do not need to add the instruction. </details> ## Usage ### Usage for Embedding Model Here are some examples for using `bge` models with [FlagEmbedding](#using-flagembedding), [Sentence-Transformers](#using-sentence-transformers), [Langchain](#using-langchain), or [Huggingface Transformers](#using-huggingface-transformers). #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` If it doesn't work for you, you can see [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md) for more methods to install FlagEmbedding. ```python from FlagEmbedding import FlagModel sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = FlagModel('BAAI/bge-large-zh-v1.5', query_instruction_for_retrieval="为这个句子生成表示以用于检索相关文章：", use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation embeddings_1 = model.encode(sentences_1) embeddings_2 = model.encode(sentences_2) similarity = embeddings_1 @ embeddings_2.T print(similarity) # for s2p(short query to long passage) retrieval task, suggest to use encode_queries() which will automatically add the instruction to each query # corpus in retrieval task can still use encode() or encode_corpus(), since they don't need instruction queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] q_embeddings = model.encode_queries(queries) p_embeddings = model.encode(passages) scores = q_embeddings @ p_embeddings.T ``` For the value of the argument `query_instruction_for_retrieval`, see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list). By default, FlagModel will use all available GPUs when encoding. Please set `os.environ["CUDA_VISIBLE_DEVICES"]` to select specific GPUs. You also can set `os.environ["CUDA_VISIBLE_DEVICES"]=""` to make all GPUs unavailable. #### Using Sentence-Transformers You can also use the `bge` models with [sentence-transformers](https://www.SBERT.net): ``` pip install -U sentence-transformers ``` ```python from sentence_transformers import SentenceTransformer sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = SentenceTransformer('BAAI/bge-large-zh-v1.5') embeddings_1 = model.encode(sentences_1, normalize_embeddings=True) embeddings_2 = model.encode(sentences_2, normalize_embeddings=True) similarity = embeddings_1 @ embeddings_2.T print(similarity) ``` For s2p(short query to long passage) retrieval task, each short query should start with an instruction (instructions see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list)). But the instruction is not needed for passages. ```python from sentence_transformers import SentenceTransformer queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] instruction = "为这个句子生成表示以用于检索相关文章：" model = SentenceTransformer('BAAI/bge-large-zh-v1.5') q_embeddings = model.encode([instruction+q for q in queries], normalize_embeddings=True) p_embeddings = model.encode(passages, normalize_embeddings=True) scores = q_embeddings @ p_embeddings.T ``` #### Using Langchain You can use `bge` in langchain like this: ```python from langchain.embeddings import HuggingFaceBgeEmbeddings model_name = "BAAI/bge-large-en-v1.5" model_kwargs = {'device': 'cuda'} encode_kwargs = {'normalize_embeddings': True} # set True to compute cosine similarity model = HuggingFaceBgeEmbeddings( model_name=model_name, model_kwargs=model_kwargs, encode_kwargs=encode_kwargs, query_instruction="为这个句子生成表示以用于检索相关文章：" ) model.query_instruction = "为这个句子生成表示以用于检索相关文章：" ``` #### Using HuggingFace Transformers With the transformers package, you can use the model like this: First, you pass your input through the transformer model, then you select the last hidden state of the first token (i.e., [CLS]) as the sentence embedding. ```python from transformers import AutoTokenizer, AutoModel import torch # Sentences we want sentence embeddings for sentences = ["样例数据-1", "样例数据-2"] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-large-zh-v1.5') model = AutoModel.from_pretrained('BAAI/bge-large-zh-v1.5') model.eval() # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # for s2p(short query to long passage) retrieval task, add an instruction to query (not add instruction for passages) # encoded_input = tokenizer([instruction + q for q in queries], padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, cls pooling. sentence_embeddings = model_output[0][:, 0] # normalize embeddings sentence_embeddings = torch.nn.functional.normalize(sentence_embeddings, p=2, dim=1) print("Sentence embeddings:", sentence_embeddings) ``` #### Usage of the ONNX files ```python from optimum.onnxruntime import ORTModelForFeatureExtraction # type: ignore import torch from transformers import AutoModel, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-large-en-v1.5') model = AutoModel.from_pretrained('BAAI/bge-large-en-v1.5', revision="refs/pr/13") model_ort = ORTModelForFeatureExtraction.from_pretrained('BAAI/bge-large-en-v1.5', revision="refs/pr/13",file_name="onnx/model.onnx") # Sentences we want sentence embeddings for sentences = ["样例数据-1", "样例数据-2"] # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # for s2p(short query to long passage) retrieval task, add an instruction to query (not add instruction for passages) # encoded_input = tokenizer([instruction + q for q in queries], padding=True, truncation=True, return_tensors='pt') model_output_ort = model_ort(**encoded_input) # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # model_output and model_output_ort are identical ``` #### Usage via infinity Its also possible to deploy the onnx files with the [infinity_emb](https://github.com/michaelfeil/infinity) pip package. ```python import asyncio from infinity_emb import AsyncEmbeddingEngine, EngineArgs sentences = ["Embed this is sentence via Infinity.", "Paris is in France."] engine = AsyncEmbeddingEngine.from_args( EngineArgs(model_name_or_path = "BAAI/bge-large-en-v1.5", device="cpu", engine="optimum" # or engine="torch" )) async def main(): async with engine: embeddings, usage = await engine.embed(sentences=sentences) asyncio.run(main()) ``` ### Usage for Reranker Different from embedding model, reranker uses question and document as input and directly output similarity instead of embedding. You can get a relevance score by inputting query and passage to the reranker. The reranker is optimized based cross-entropy loss, so the relevance score is not bounded to a specific range. #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` Get relevance scores (higher scores indicate more relevance): ```python from FlagEmbedding import FlagReranker reranker = FlagReranker('BAAI/bge-reranker-large', use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation score = reranker.compute_score(['query', 'passage']) print(score) scores = reranker.compute_score([['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']]) print(scores) ``` #### Using Huggingface transformers ```python import torch from transformers import AutoModelForSequenceClassification, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-reranker-large') model = AutoModelForSequenceClassification.from_pretrained('BAAI/bge-reranker-large') model.eval() pairs = [['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']] with torch.no_grad(): inputs = tokenizer(pairs, padding=True, truncation=True, return_tensors='pt', max_length=512) scores = model(**inputs, return_dict=True).logits.view(-1, ).float() print(scores) ``` ## Evaluation `baai-general-embedding` models achieve **state-of-the-art performance on both MTEB and C-MTEB leaderboard!** For more details and evaluation tools see our [scripts](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md). - **MTEB**: | Model Name | Dimension | Sequence Length | Average (56) | Retrieval (15) |Clustering (11) | Pair Classification (3) | Reranking (4) | STS (10) | Summarization (1) | Classification (12) | |:----:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:| | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | 1024 | 512 | **64.23** | **54.29** | 46.08 | 87.12 | 60.03 | 83.11 | 31.61 | 75.97 | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | 768 | 512 | 63.55 | 53.25 | 45.77 | 86.55 | 58.86 | 82.4 | 31.07 | 75.53 | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | 384 | 512 | 62.17 |51.68 | 43.82 | 84.92 | 58.36 | 81.59 | 30.12 | 74.14 | | [bge-large-en](https://huggingface.co/BAAI/bge-large-en) | 1024 | 512 | 63.98 | 53.9 | 46.98 | 85.8 | 59.48 | 81.56 | 32.06 | 76.21 | | [bge-base-en](https://huggingface.co/BAAI/bge-base-en) | 768 | 512 | 63.36 | 53.0 | 46.32 | 85.86 | 58.7 | 81.84 | 29.27 | 75.27 | | [gte-large](https://huggingface.co/thenlper/gte-large) | 1024 | 512 | 63.13 | 52.22 | 46.84 | 85.00 | 59.13 | 83.35 | 31.66 | 73.33 | | [gte-base](https://huggingface.co/thenlper/gte-base) | 768 | 512 | 62.39 | 51.14 | 46.2 | 84.57 | 58.61 | 82.3 | 31.17 | 73.01 | | [e5-large-v2](https://huggingface.co/intfloat/e5-large-v2) | 1024| 512 | 62.25 | 50.56 | 44.49 | 86.03 | 56.61 | 82.05 | 30.19 | 75.24 | | [bge-small-en](https://huggingface.co/BAAI/bge-small-en) | 384 | 512 | 62.11 | 51.82 | 44.31 | 83.78 | 57.97 | 80.72 | 30.53 | 74.37 | | [instructor-xl](https://huggingface.co/hkunlp/instructor-xl) | 768 | 512 | 61.79 | 49.26 | 44.74 | 86.62 | 57.29 | 83.06 | 32.32 | 61.79 | | [e5-base-v2](https://huggingface.co/intfloat/e5-base-v2) | 768 | 512 | 61.5 | 50.29 | 43.80 | 85.73 | 55.91 | 81.05 | 30.28 | 73.84 | | [gte-small](https://huggingface.co/thenlper/gte-small) | 384 | 512 | 61.36 | 49.46 | 44.89 | 83.54 | 57.7 | 82.07 | 30.42 | 72.31 | | [text-embedding-ada-002](https://platform.openai.com/docs/guides/embeddings) | 1536 | 8192 | 60.99 | 49.25 | 45.9 | 84.89 | 56.32 | 80.97 | 30.8 | 70.93 | | [e5-small-v2](https://huggingface.co/intfloat/e5-base-v2) | 384 | 512 | 59.93 | 49.04 | 39.92 | 84.67 | 54.32 | 80.39 | 31.16 | 72.94 | | [sentence-t5-xxl](https://huggingface.co/sentence-transformers/sentence-t5-xxl) | 768 | 512 | 59.51 | 42.24 | 43.72 | 85.06 | 56.42 | 82.63 | 30.08 | 73.42 | | [all-mpnet-base-v2](https://huggingface.co/sentence-transformers/all-mpnet-base-v2) | 768 | 514 | 57.78 | 43.81 | 43.69 | 83.04 | 59.36 | 80.28 | 27.49 | 65.07 | | [sgpt-bloom-7b1-msmarco](https://huggingface.co/bigscience/sgpt-bloom-7b1-msmarco) | 4096 | 2048 | 57.59 | 48.22 | 38.93 | 81.9 | 55.65 | 77.74 | 33.6 | 66.19 | - **C-MTEB**: We create the benchmark C-MTEB for Chinese text embedding which consists of 31 datasets from 6 tasks. Please refer to [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md) for a detailed introduction. | Model | Embedding dimension | Avg | Retrieval | STS | PairClassification | Classification | Reranking | Clustering | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | [**BAAI/bge-large-zh-v1.5**](https://huggingface.co/BAAI/bge-large-zh-v1.5) | 1024 | **64.53** | 70.46 | 56.25 | 81.6 | 69.13 | 65.84 | 48.99 | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | 768 | 63.13 | 69.49 | 53.72 | 79.75 | 68.07 | 65.39 | 47.53 | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | 512 | 57.82 | 61.77 | 49.11 | 70.41 | 63.96 | 60.92 | 44.18 | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | 1024 | 64.20 | 71.53 | 54.98 | 78.94 | 68.32 | 65.11 | 48.39 | | [bge-large-zh-noinstruct](https://huggingface.co/BAAI/bge-large-zh-noinstruct) | 1024 | 63.53 | 70.55 | 53 | 76.77 | 68.58 | 64.91 | 50.01 | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | 768 | 62.96 | 69.53 | 54.12 | 77.5 | 67.07 | 64.91 | 47.63 | | [multilingual-e5-large](https://huggingface.co/intfloat/multilingual-e5-large) | 1024 | 58.79 | 63.66 | 48.44 | 69.89 | 67.34 | 56.00 | 48.23 | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | 512 | 58.27 | 63.07 | 49.45 | 70.35 | 63.64 | 61.48 | 45.09 | | [m3e-base](https://huggingface.co/moka-ai/m3e-base) | 768 | 57.10 | 56.91 | 50.47 | 63.99 | 67.52 | 59.34 | 47.68 | | [m3e-large](https://huggingface.co/moka-ai/m3e-large) | 1024 | 57.05 | 54.75 | 50.42 | 64.3 | 68.2 | 59.66 | 48.88 | | [multilingual-e5-base](https://huggingface.co/intfloat/multilingual-e5-base) | 768 | 55.48 | 61.63 | 46.49 | 67.07 | 65.35 | 54.35 | 40.68 | | [multilingual-e5-small](https://huggingface.co/intfloat/multilingual-e5-small) | 384 | 55.38 | 59.95 | 45.27 | 66.45 | 65.85 | 53.86 | 45.26 | | [text-embedding-ada-002(OpenAI)](https://platform.openai.com/docs/guides/embeddings/what-are-embeddings) | 1536 | 53.02 | 52.0 | 43.35 | 69.56 | 64.31 | 54.28 | 45.68 | | [luotuo](https://huggingface.co/silk-road/luotuo-bert-medium) | 1024 | 49.37 | 44.4 | 42.78 | 66.62 | 61 | 49.25 | 44.39 | | [text2vec-base](https://huggingface.co/shibing624/text2vec-base-chinese) | 768 | 47.63 | 38.79 | 43.41 | 67.41 | 62.19 | 49.45 | 37.66 | | [text2vec-large](https://huggingface.co/GanymedeNil/text2vec-large-chinese) | 1024 | 47.36 | 41.94 | 44.97 | 70.86 | 60.66 | 49.16 | 30.02 | - **Reranking**: See [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/) for evaluation script. | Model | T2Reranking | T2RerankingZh2En\* | T2RerankingEn2Zh\* | MMarcoReranking | CMedQAv1 | CMedQAv2 | Avg | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | text2vec-base-multilingual | 64.66 | 62.94 | 62.51 | 14.37 | 48.46 | 48.6 | 50.26 | | multilingual-e5-small | 65.62 | 60.94 | 56.41 | 29.91 | 67.26 | 66.54 | 57.78 | | multilingual-e5-large | 64.55 | 61.61 | 54.28 | 28.6 | 67.42 | 67.92 | 57.4 | | multilingual-e5-base | 64.21 | 62.13 | 54.68 | 29.5 | 66.23 | 66.98 | 57.29 | | m3e-base | 66.03 | 62.74 | 56.07 | 17.51 | 77.05 | 76.76 | 59.36 | | m3e-large | 66.13 | 62.72 | 56.1 | 16.46 | 77.76 | 78.27 | 59.57 | | bge-base-zh-v1.5 | 66.49 | 63.25 | 57.02 | 29.74 | 80.47 | 84.88 | 63.64 | | bge-large-zh-v1.5 | 65.74 | 63.39 | 57.03 | 28.74 | 83.45 | 85.44 | 63.97 | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | 67.28 | 63.95 | 60.45 | 35.46 | 81.26 | 84.1 | 65.42 | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | 67.6 | 64.03 | 61.44 | 37.16 | 82.15 | 84.18 | 66.09 | \* : T2RerankingZh2En and T2RerankingEn2Zh are cross-language retrieval tasks ## Train ### BAAI Embedding We pre-train the models using [retromae](https://github.com/staoxiao/RetroMAE) and train them on large-scale pairs data using contrastive learning. **You can fine-tune the embedding model on your data following our [examples](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune).** We also provide a [pre-train example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/pretrain). Note that the goal of pre-training is to reconstruct the text, and the pre-trained model cannot be used for similarity calculation directly, it needs to be fine-tuned. More training details for bge see [baai_general_embedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md). ### BGE Reranker Cross-encoder will perform full-attention over the input pair, which is more accurate than embedding model (i.e., bi-encoder) but more time-consuming than embedding model. Therefore, it can be used to re-rank the top-k documents returned by embedding model. We train the cross-encoder on a multilingual pair data, The data format is the same as embedding model, so you can fine-tune it easily following our [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker). More details please refer to [./FlagEmbedding/reranker/README.md](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker) ## Contact If you have any question or suggestion related to this project, feel free to open an issue or pull request. You also can email Shitao Xiao(stxiao@baai.ac.cn) and Zheng Liu(liuzheng@baai.ac.cn). ## Citation If you find this repository useful, please consider giving a star :star: and citation ``` @misc{bge_embedding, title={C-Pack: Packaged Resources To Advance General Chinese Embedding}, author={Shitao Xiao and Zheng Liu and Peitian Zhang and Niklas Muennighoff}, year={2023}, eprint={2309.07597}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` ## License FlagEmbedding is licensed under the [MIT License](https://github.com/FlagOpen/FlagEmbedding/blob/master/LICENSE). The released models can be used for commercial purposes free of charge.

petals-team/StableBeluga2

petals-team

transformers

text-generation

--- datasets: - conceptofmind/cot_submix_original - conceptofmind/flan2021_submix_original - conceptofmind/t0_submix_original - conceptofmind/niv2_submix_original language: - en pipeline_tag: text-generation --- # Stable Beluga 2 ## Changes in this fork This repository contains the model from the [stabilityai/StableBeluga2](https://huggingface.co/stabilityai/StableBeluga2) repository with the following changes: 1. **Storing weights in `bfloat16` instead of `float32`.** This leads to 2x smaller files and a small quality loss, which is not significant compared to the loss caused by NF4 quantization used in Petals by default. 1. **Storing weights in small shards.** Each transformer block is stored in its own shard (1.71 GB each). The input and output embeddings and adjacent layernorms are in a separate shard (1.05 GB) too. This way, Petals clients and servers don't have to download any excess data besides the layers they actually use. 1. **Using [Safetensors](https://github.com/huggingface/safetensors) instead of Pickle.** This allows faster loading with smaller RAM requirements. We provide the original README below. Please refer there for model details and licensing information. ## Model Description `Stable Beluga 2` is a Llama2 70B model finetuned on an Orca style Dataset ## Usage Start chatting with `Stable Beluga 2` using the following code snippet: ```python import torch from transformers import AutoModelForCausalLM, AutoTokenizer, pipeline tokenizer = AutoTokenizer.from_pretrained("stabilityai/StableBeluga2", use_fast=False) model = AutoModelForCausalLM.from_pretrained("stabilityai/StableBeluga2", torch_dtype=torch.float16, low_cpu_mem_usage=True, device_map="auto") system_prompt = "### System:\nYou are Stable Beluga, an AI that follows instructions extremely well. Help as much as you can. Remember, be safe, and don't do anything illegal.\n\n" message = "Write me a poem please" prompt = f"{system_prompt}### User: {message}\n\n### Assistant:\n" inputs = tokenizer(prompt, return_tensors="pt").to("cuda") output = model.generate(**inputs, do_sample=True, top_p=0.95, top_k=0, max_new_tokens=256) print(tokenizer.decode(output[0], skip_special_tokens=True)) ``` Stable Beluga 2 should be used with this prompt format: ``` ### System: This is a system prompt, please behave and help the user. ### User: Your prompt here ### Assistant: The output of Stable Beluga 2 ``` ## Other Beluga Models [StableBeluga 1 - Delta](https://huggingface.co/stabilityai/StableBeluga1-Delta) [StableBeluga 13B](https://huggingface.co/stabilityai/StableBeluga-13B) [StableBeluga 7B](https://huggingface.co/stabilityai/StableBeluga-7B) ## Model Details * **Developed by**: [Stability AI](https://stability.ai/) * **Model type**: Stable Beluga 2 is an auto-regressive language model fine-tuned on Llama2 70B. * **Language(s)**: English * **Library**: [HuggingFace Transformers](https://github.com/huggingface/transformers) * **License**: Fine-tuned checkpoints (`Stable Beluga 2`) is licensed under the [STABLE BELUGA NON-COMMERCIAL COMMUNITY LICENSE AGREEMENT](https://huggingface.co/stabilityai/StableBeluga2/blob/main/LICENSE.txt) * **Contact**: For questions and comments about the model, please email `lm@stability.ai` ### Training Dataset ` Stable Beluga 2` is trained on our internal Orca-style dataset ### Training Procedure Models are learned via supervised fine-tuning on the aforementioned datasets, trained in mixed-precision (BF16), and optimized with AdamW. We outline the following hyperparameters: | Dataset | Batch Size | Learning Rate |Learning Rate Decay| Warm-up | Weight Decay | Betas | |-------------------|------------|---------------|-------------------|---------|--------------|-------------| | Orca pt1 packed | 256 | 3e-5 | Cosine to 3e-6 | 100 | 1e-6 | (0.9, 0.95) | | Orca pt2 unpacked | 512 | 3e-5 | Cosine to 3e-6 | 100 | 1e-6 | (0.9, 0.95) | ## Ethical Considerations and Limitations Beluga is a new technology that carries risks with use. Testing conducted to date has been in English, and has not covered, nor could it cover all scenarios. For these reasons, as with all LLMs, Beluga's potential outputs cannot be predicted in advance, and the model may in some instances produce inaccurate, biased or other objectionable responses to user prompts. Therefore, before deploying any applications of Beluga, developers should perform safety testing and tuning tailored to their specific applications of the model. ## How to cite ```bibtex @misc{StableBelugaModels, url={[https://huggingface.co/stabilityai/StableBeluga2](https://huggingface.co/stabilityai/StableBeluga2)}, title={Stable Beluga models}, author={Mahan, Dakota and Carlow, Ryan and Castricato, Louis and Cooper, Nathan and Laforte, Christian} } ``` ## Citations ```bibtext @misc{touvron2023llama, title={Llama 2: Open Foundation and Fine-Tuned Chat Models}, author={Hugo Touvron and Louis Martin and Kevin Stone and Peter Albert and Amjad Almahairi and Yasmine Babaei and Nikolay Bashlykov and Soumya Batra and Prajjwal Bhargava and Shruti Bhosale and Dan Bikel and Lukas Blecher and Cristian Canton Ferrer and Moya Chen and Guillem Cucurull and David Esiobu and Jude Fernandes and Jeremy Fu and Wenyin Fu and Brian Fuller and Cynthia Gao and Vedanuj Goswami and Naman Goyal and Anthony Hartshorn and Saghar Hosseini and Rui Hou and Hakan Inan and Marcin Kardas and Viktor Kerkez and Madian Khabsa and Isabel Kloumann and Artem Korenev and Punit Singh Koura and Marie-Anne Lachaux and Thibaut Lavril and Jenya Lee and Diana Liskovich and Yinghai Lu and Yuning Mao and Xavier Martinet and Todor Mihaylov and Pushkar Mishra and Igor Molybog and Yixin Nie and Andrew Poulton and Jeremy Reizenstein and Rashi Rungta and Kalyan Saladi and Alan Schelten and Ruan Silva and Eric Michael Smith and Ranjan Subramanian and Xiaoqing Ellen Tan and Binh Tang and Ross Taylor and Adina Williams and Jian Xiang Kuan and Puxin Xu and Zheng Yan and Iliyan Zarov and Yuchen Zhang and Angela Fan and Melanie Kambadur and Sharan Narang and Aurelien Rodriguez and Robert Stojnic and Sergey Edunov and Thomas Scialom}, year={2023}, eprint={2307.09288}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` ```bibtext @misc{mukherjee2023orca, title={Orca: Progressive Learning from Complex Explanation Traces of GPT-4}, author={Subhabrata Mukherjee and Arindam Mitra and Ganesh Jawahar and Sahaj Agarwal and Hamid Palangi and Ahmed Awadallah}, year={2023}, eprint={2306.02707}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

timm/mobilenetv3_large_100.ra_in1k

timm

timm

image-classification

--- tags: - image-classification - timm library_name: timm license: apache-2.0 datasets: - imagenet-1k --- # Model card for mobilenetv3_large_100.ra_in1k A MobileNet-v3 image classification model. Trained on ImageNet-1k in `timm` using recipe template described below. Recipe details: * RandAugment `RA` recipe. Inspired by and evolved from EfficientNet RandAugment recipes. Published as `B` recipe in [ResNet Strikes Back](https://arxiv.org/abs/2110.00476). * RMSProp (TF 1.0 behaviour) optimizer, EMA weight averaging * Step (exponential decay w/ staircase) LR schedule with warmup ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 5.5 - GMACs: 0.2 - Activations (M): 4.4 - Image size: 224 x 224 - **Papers:** - Searching for MobileNetV3: https://arxiv.org/abs/1905.02244 - ResNet strikes back: An improved training procedure in timm: https://arxiv.org/abs/2110.00476 - **Dataset:** ImageNet-1k - **Original:** https://github.com/huggingface/pytorch-image-models ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('mobilenetv3_large_100.ra_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Feature Map Extraction ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'mobilenetv3_large_100.ra_in1k', pretrained=True, features_only=True, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 for o in output: # print shape of each feature map in output # e.g.: # torch.Size([1, 16, 112, 112]) # torch.Size([1, 24, 56, 56]) # torch.Size([1, 40, 28, 28]) # torch.Size([1, 112, 14, 14]) # torch.Size([1, 960, 7, 7]) print(o.shape) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'mobilenetv3_large_100.ra_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled, a (1, 960, 7, 7) shaped tensor output = model.forward_head(output, pre_logits=True) # output is a (1, num_features) shaped tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). ## Citation ```bibtex @inproceedings{howard2019searching, title={Searching for mobilenetv3}, author={Howard, Andrew and Sandler, Mark and Chu, Grace and Chen, Liang-Chieh and Chen, Bo and Tan, Mingxing and Wang, Weijun and Zhu, Yukun and Pang, Ruoming and Vasudevan, Vijay and others}, booktitle={Proceedings of the IEEE/CVF international conference on computer vision}, pages={1314--1324}, year={2019} } ``` ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ``` ```bibtex @inproceedings{wightman2021resnet, title={ResNet strikes back: An improved training procedure in timm}, author={Wightman, Ross and Touvron, Hugo and Jegou, Herve}, booktitle={NeurIPS 2021 Workshop on ImageNet: Past, Present, and Future} } ```

CompVis/stable-diffusion-v1-4

CompVis

diffusers

text-to-image

--- license: creativeml-openrail-m tags: - stable-diffusion - stable-diffusion-diffusers - text-to-image widget: - text: "A high tech solarpunk utopia in the Amazon rainforest" example_title: Amazon rainforest - text: "A pikachu fine dining with a view to the Eiffel Tower" example_title: Pikachu in Paris - text: "A mecha robot in a favela in expressionist style" example_title: Expressionist robot - text: "an insect robot preparing a delicious meal" example_title: Insect robot - text: "A small cabin on top of a snowy mountain in the style of Disney, artstation" example_title: Snowy disney cabin extra_gated_prompt: |- This model is open access and available to all, with a CreativeML OpenRAIL-M license further specifying rights and usage. The CreativeML OpenRAIL License specifies: 1. You can't use the model to deliberately produce nor share illegal or harmful outputs or content 2. The authors claim no rights on the outputs you generate, you are free to use them and are accountable for their use which must not go against the provisions set in the license 3. You may re-distribute the weights and use the model commercially and/or as a service. If you do, please be aware you have to include the same use restrictions as the ones in the license and share a copy of the CreativeML OpenRAIL-M to all your users (please read the license entirely and carefully) Please read the full license carefully here: https://huggingface.co/spaces/CompVis/stable-diffusion-license extra_gated_heading: Please read the LICENSE to access this model --- # Stable Diffusion v1-4 Model Card Stable Diffusion is a latent text-to-image diffusion model capable of generating photo-realistic images given any text input. For more information about how Stable Diffusion functions, please have a look at [🤗's Stable Diffusion with 🧨Diffusers blog](https://huggingface.co/blog/stable_diffusion). The **Stable-Diffusion-v1-4** checkpoint was initialized with the weights of the [Stable-Diffusion-v1-2](https:/steps/huggingface.co/CompVis/stable-diffusion-v1-2) checkpoint and subsequently fine-tuned on 225k steps at resolution 512x512 on "laion-aesthetics v2 5+" and 10% dropping of the text-conditioning to improve [classifier-free guidance sampling](https://arxiv.org/abs/2207.12598). This weights here are intended to be used with the 🧨 Diffusers library. If you are looking for the weights to be loaded into the CompVis Stable Diffusion codebase, [come here](https://huggingface.co/CompVis/stable-diffusion-v-1-4-original) ## Model Details - **Developed by:** Robin Rombach, Patrick Esser - **Model type:** Diffusion-based text-to-image generation model - **Language(s):** English - **License:** [The CreativeML OpenRAIL M license](https://huggingface.co/spaces/CompVis/stable-diffusion-license) is an [Open RAIL M license](https://www.licenses.ai/blog/2022/8/18/naming-convention-of-responsible-ai-licenses), adapted from the work that [BigScience](https://bigscience.huggingface.co/) and [the RAIL Initiative](https://www.licenses.ai/) are jointly carrying in the area of responsible AI licensing. See also [the article about the BLOOM Open RAIL license](https://bigscience.huggingface.co/blog/the-bigscience-rail-license) on which our license is based. - **Model Description:** This is a model that can be used to generate and modify images based on text prompts. It is a [Latent Diffusion Model](https://arxiv.org/abs/2112.10752) that uses a fixed, pretrained text encoder ([CLIP ViT-L/14](https://arxiv.org/abs/2103.00020)) as suggested in the [Imagen paper](https://arxiv.org/abs/2205.11487). - **Resources for more information:** [GitHub Repository](https://github.com/CompVis/stable-diffusion), [Paper](https://arxiv.org/abs/2112.10752). - **Cite as:** @InProceedings{Rombach_2022_CVPR, author = {Rombach, Robin and Blattmann, Andreas and Lorenz, Dominik and Esser, Patrick and Ommer, Bj\"orn}, title = {High-Resolution Image Synthesis With Latent Diffusion Models}, booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition (CVPR)}, month = {June}, year = {2022}, pages = {10684-10695} } ## Examples We recommend using [🤗's Diffusers library](https://github.com/huggingface/diffusers) to run Stable Diffusion. ### PyTorch ```bash pip install --upgrade diffusers transformers scipy ``` Running the pipeline with the default PNDM scheduler: ```python import torch from diffusers import StableDiffusionPipeline model_id = "CompVis/stable-diffusion-v1-4" device = "cuda" pipe = StableDiffusionPipeline.from_pretrained(model_id, torch_dtype=torch.float16) pipe = pipe.to(device) prompt = "a photo of an astronaut riding a horse on mars" image = pipe(prompt).images[0] image.save("astronaut_rides_horse.png") ``` **Note**: If you are limited by GPU memory and have less than 4GB of GPU RAM available, please make sure to load the StableDiffusionPipeline in float16 precision instead of the default float32 precision as done above. You can do so by telling diffusers to expect the weights to be in float16 precision: ```py import torch pipe = StableDiffusionPipeline.from_pretrained(model_id, torch_dtype=torch.float16) pipe = pipe.to(device) pipe.enable_attention_slicing() prompt = "a photo of an astronaut riding a horse on mars" image = pipe(prompt).images[0] image.save("astronaut_rides_horse.png") ``` To swap out the noise scheduler, pass it to `from_pretrained`: ```python from diffusers import StableDiffusionPipeline, EulerDiscreteScheduler model_id = "CompVis/stable-diffusion-v1-4" # Use the Euler scheduler here instead scheduler = EulerDiscreteScheduler.from_pretrained(model_id, subfolder="scheduler") pipe = StableDiffusionPipeline.from_pretrained(model_id, scheduler=scheduler, torch_dtype=torch.float16) pipe = pipe.to("cuda") prompt = "a photo of an astronaut riding a horse on mars" image = pipe(prompt).images[0] image.save("astronaut_rides_horse.png") ``` ### JAX/Flax To use StableDiffusion on TPUs and GPUs for faster inference you can leverage JAX/Flax. Running the pipeline with default PNDMScheduler ```python import jax import numpy as np from flax.jax_utils import replicate from flax.training.common_utils import shard from diffusers import FlaxStableDiffusionPipeline pipeline, params = FlaxStableDiffusionPipeline.from_pretrained( "CompVis/stable-diffusion-v1-4", revision="flax", dtype=jax.numpy.bfloat16 ) prompt = "a photo of an astronaut riding a horse on mars" prng_seed = jax.random.PRNGKey(0) num_inference_steps = 50 num_samples = jax.device_count() prompt = num_samples * [prompt] prompt_ids = pipeline.prepare_inputs(prompt) # shard inputs and rng params = replicate(params) prng_seed = jax.random.split(prng_seed, num_samples) prompt_ids = shard(prompt_ids) images = pipeline(prompt_ids, params, prng_seed, num_inference_steps, jit=True).images images = pipeline.numpy_to_pil(np.asarray(images.reshape((num_samples,) + images.shape[-3:]))) ``` **Note**: If you are limited by TPU memory, please make sure to load the `FlaxStableDiffusionPipeline` in `bfloat16` precision instead of the default `float32` precision as done above. You can do so by telling diffusers to load the weights from "bf16" branch. ```python import jax import numpy as np from flax.jax_utils import replicate from flax.training.common_utils import shard from diffusers import FlaxStableDiffusionPipeline pipeline, params = FlaxStableDiffusionPipeline.from_pretrained( "CompVis/stable-diffusion-v1-4", revision="bf16", dtype=jax.numpy.bfloat16 ) prompt = "a photo of an astronaut riding a horse on mars" prng_seed = jax.random.PRNGKey(0) num_inference_steps = 50 num_samples = jax.device_count() prompt = num_samples * [prompt] prompt_ids = pipeline.prepare_inputs(prompt) # shard inputs and rng params = replicate(params) prng_seed = jax.random.split(prng_seed, num_samples) prompt_ids = shard(prompt_ids) images = pipeline(prompt_ids, params, prng_seed, num_inference_steps, jit=True).images images = pipeline.numpy_to_pil(np.asarray(images.reshape((num_samples,) + images.shape[-3:]))) ``` # Uses ## Direct Use The model is intended for research purposes only. Possible research areas and tasks include - Safe deployment of models which have the potential to generate harmful content. - Probing and understanding the limitations and biases of generative models. - Generation of artworks and use in design and other artistic processes. - Applications in educational or creative tools. - Research on generative models. Excluded uses are described below. ### Misuse, Malicious Use, and Out-of-Scope Use _Note: This section is taken from the [DALLE-MINI model card](https://huggingface.co/dalle-mini/dalle-mini), but applies in the same way to Stable Diffusion v1_. The model should not be used to intentionally create or disseminate images that create hostile or alienating environments for people. This includes generating images that people would foreseeably find disturbing, distressing, or offensive; or content that propagates historical or current stereotypes. #### Out-of-Scope Use The model was not trained to be factual or true representations of people or events, and therefore using the model to generate such content is out-of-scope for the abilities of this model. #### Misuse and Malicious Use Using the model to generate content that is cruel to individuals is a misuse of this model. This includes, but is not limited to: - Generating demeaning, dehumanizing, or otherwise harmful representations of people or their environments, cultures, religions, etc. - Intentionally promoting or propagating discriminatory content or harmful stereotypes. - Impersonating individuals without their consent. - Sexual content without consent of the people who might see it. - Mis- and disinformation - Representations of egregious violence and gore - Sharing of copyrighted or licensed material in violation of its terms of use. - Sharing content that is an alteration of copyrighted or licensed material in violation of its terms of use. ## Limitations and Bias ### Limitations - The model does not achieve perfect photorealism - The model cannot render legible text - The model does not perform well on more difficult tasks which involve compositionality, such as rendering an image corresponding to “A red cube on top of a blue sphere” - Faces and people in general may not be generated properly. - The model was trained mainly with English captions and will not work as well in other languages. - The autoencoding part of the model is lossy - The model was trained on a large-scale dataset [LAION-5B](https://laion.ai/blog/laion-5b/) which contains adult material and is not fit for product use without additional safety mechanisms and considerations. - No additional measures were used to deduplicate the dataset. As a result, we observe some degree of memorization for images that are duplicated in the training data. The training data can be searched at [https://rom1504.github.io/clip-retrieval/](https://rom1504.github.io/clip-retrieval/) to possibly assist in the detection of memorized images. ### Bias While the capabilities of image generation models are impressive, they can also reinforce or exacerbate social biases. Stable Diffusion v1 was trained on subsets of [LAION-2B(en)](https://laion.ai/blog/laion-5b/), which consists of images that are primarily limited to English descriptions. Texts and images from communities and cultures that use other languages are likely to be insufficiently accounted for. This affects the overall output of the model, as white and western cultures are often set as the default. Further, the ability of the model to generate content with non-English prompts is significantly worse than with English-language prompts. ### Safety Module The intended use of this model is with the [Safety Checker](https://github.com/huggingface/diffusers/blob/main/src/diffusers/pipelines/stable_diffusion/safety_checker.py) in Diffusers. This checker works by checking model outputs against known hard-coded NSFW concepts. The concepts are intentionally hidden to reduce the likelihood of reverse-engineering this filter. Specifically, the checker compares the class probability of harmful concepts in the embedding space of the `CLIPTextModel` *after generation* of the images. The concepts are passed into the model with the generated image and compared to a hand-engineered weight for each NSFW concept. ## Training **Training Data** The model developers used the following dataset for training the model: - LAION-2B (en) and subsets thereof (see next section) **Training Procedure** Stable Diffusion v1-4 is a latent diffusion model which combines an autoencoder with a diffusion model that is trained in the latent space of the autoencoder. During training, - Images are encoded through an encoder, which turns images into latent representations. The autoencoder uses a relative downsampling factor of 8 and maps images of shape H x W x 3 to latents of shape H/f x W/f x 4 - Text prompts are encoded through a ViT-L/14 text-encoder. - The non-pooled output of the text encoder is fed into the UNet backbone of the latent diffusion model via cross-attention. - The loss is a reconstruction objective between the noise that was added to the latent and the prediction made by the UNet. We currently provide four checkpoints, which were trained as follows. - [`stable-diffusion-v1-1`](https://huggingface.co/CompVis/stable-diffusion-v1-1): 237,000 steps at resolution `256x256` on [laion2B-en](https://huggingface.co/datasets/laion/laion2B-en). 194,000 steps at resolution `512x512` on [laion-high-resolution](https://huggingface.co/datasets/laion/laion-high-resolution) (170M examples from LAION-5B with resolution `>= 1024x1024`). - [`stable-diffusion-v1-2`](https://huggingface.co/CompVis/stable-diffusion-v1-2): Resumed from `stable-diffusion-v1-1`. 515,000 steps at resolution `512x512` on "laion-improved-aesthetics" (a subset of laion2B-en, filtered to images with an original size `>= 512x512`, estimated aesthetics score `> 5.0`, and an estimated watermark probability `< 0.5`. The watermark estimate is from the LAION-5B metadata, the aesthetics score is estimated using an [improved aesthetics estimator](https://github.com/christophschuhmann/improved-aesthetic-predictor)). - [`stable-diffusion-v1-3`](https://huggingface.co/CompVis/stable-diffusion-v1-3): Resumed from `stable-diffusion-v1-2`. 195,000 steps at resolution `512x512` on "laion-improved-aesthetics" and 10 % dropping of the text-conditioning to improve [classifier-free guidance sampling](https://arxiv.org/abs/2207.12598). - [`stable-diffusion-v1-4`](https://huggingface.co/CompVis/stable-diffusion-v1-4) Resumed from `stable-diffusion-v1-2`.225,000 steps at resolution `512x512` on "laion-aesthetics v2 5+" and 10 % dropping of the text-conditioning to improve [classifier-free guidance sampling](https://arxiv.org/abs/2207.12598). - **Hardware:** 32 x 8 x A100 GPUs - **Optimizer:** AdamW - **Gradient Accumulations**: 2 - **Batch:** 32 x 8 x 2 x 4 = 2048 - **Learning rate:** warmup to 0.0001 for 10,000 steps and then kept constant ## Evaluation Results Evaluations with different classifier-free guidance scales (1.5, 2.0, 3.0, 4.0, 5.0, 6.0, 7.0, 8.0) and 50 PLMS sampling steps show the relative improvements of the checkpoints:  Evaluated using 50 PLMS steps and 10000 random prompts from the COCO2017 validation set, evaluated at 512x512 resolution. Not optimized for FID scores. ## Environmental Impact **Stable Diffusion v1** **Estimated Emissions** Based on that information, we estimate the following CO2 emissions using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). The hardware, runtime, cloud provider, and compute region were utilized to estimate the carbon impact. - **Hardware Type:** A100 PCIe 40GB - **Hours used:** 150000 - **Cloud Provider:** AWS - **Compute Region:** US-east - **Carbon Emitted (Power consumption x Time x Carbon produced based on location of power grid):** 11250 kg CO2 eq. ## Citation ```bibtex @InProceedings{Rombach_2022_CVPR, author = {Rombach, Robin and Blattmann, Andreas and Lorenz, Dominik and Esser, Patrick and Ommer, Bj\"orn}, title = {High-Resolution Image Synthesis With Latent Diffusion Models}, booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition (CVPR)}, month = {June}, year = {2022}, pages = {10684-10695} } ``` *This model card was written by: Robin Rombach and Patrick Esser and is based on the [DALL-E Mini model card](https://huggingface.co/dalle-mini/dalle-mini).*

ckiplab/bert-base-chinese-ner

ckiplab

transformers

token-classification

--- language: - zh thumbnail: https://ckip.iis.sinica.edu.tw/files/ckip_logo.png tags: - pytorch - token-classification - bert - zh license: gpl-3.0 --- # CKIP BERT Base Chinese This project provides traditional Chinese transformers models (including ALBERT, BERT, GPT2) and NLP tools (including word segmentation, part-of-speech tagging, named entity recognition). 這個專案提供了繁體中文的 transformers 模型（包含 ALBERT、BERT、GPT2）及自然語言處理工具（包含斷詞、詞性標記、實體辨識）。 ## Homepage - https://github.com/ckiplab/ckip-transformers ## Contributers - [Mu Yang](https://muyang.pro) at [CKIP](https://ckip.iis.sinica.edu.tw) (Author & Maintainer) ## Usage Please use BertTokenizerFast as tokenizer instead of AutoTokenizer. 請使用 BertTokenizerFast 而非 AutoTokenizer。 ``` from transformers import ( BertTokenizerFast, AutoModel, ) tokenizer = BertTokenizerFast.from_pretrained('bert-base-chinese') model = AutoModel.from_pretrained('ckiplab/bert-base-chinese-ner') ``` For full usage and more information, please refer to https://github.com/ckiplab/ckip-transformers. 有關完整使用方法及其他資訊，請參見 https://github.com/ckiplab/ckip-transformers 。

facebook/encodec_24khz

facebook

transformers

feature-extraction

--- inference: false ---  # Model Card for EnCodec This model card provides details and information about EnCodec, a state-of-the-art real-time audio codec developed by Meta AI. ## Model Details ### Model Description EnCodec is a high-fidelity audio codec leveraging neural networks. It introduces a streaming encoder-decoder architecture with quantized latent space, trained in an end-to-end fashion. The model simplifies and speeds up training using a single multiscale spectrogram adversary that efficiently reduces artifacts and produces high-quality samples. It also includes a novel loss balancer mechanism that stabilizes training by decoupling the choice of hyperparameters from the typical scale of the loss. Additionally, lightweight Transformer models are used to further compress the obtained representation while maintaining real-time performance. - **Developed by:** Meta AI - **Model type:** Audio Codec ### Model Sources - **Repository:** [GitHub Repository](https://github.com/facebookresearch/encodec) - **Paper:** [EnCodec: End-to-End Neural Audio Codec](https://arxiv.org/abs/2210.13438) ## Uses <!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. --> ### Direct Use <!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. --> EnCodec can be used directly as an audio codec for real-time compression and decompression of audio signals. It provides high-quality audio compression and efficient decoding. The model was trained on various bandwiths, which can be specified when encoding (compressing) and decoding (decompressing). Two different setup exist for EnCodec: - Non-streamable: the input audio is split into chunks of 1 seconds, with an overlap of 10 ms, which are then encoded. - Streamable: weight normalizationis used on the convolution layers, and the input is not split into chunks but rather padded on the left. ### Downstream Use EnCodec can be fine-tuned for specific audio tasks or integrated into larger audio processing pipelines for applications such as speech generation, music generation, or text to speech tasks. <!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app --> [More Information Needed] ## How to Get Started with the Model Use the following code to get started with the EnCodec model using a dummy example from the LibriSpeech dataset (~9MB). First, install the required Python packages: ``` pip install --upgrade pip pip install --upgrade datasets[audio] pip install git+https://github.com/huggingface/transformers.git@main ``` Then load an audio sample, and run a forward pass of the model: ```python from datasets import load_dataset, Audio from transformers import EncodecModel, AutoProcessor # load a demonstration datasets librispeech_dummy = load_dataset("hf-internal-testing/librispeech_asr_dummy", "clean", split="validation") # load the model + processor (for pre-processing the audio) model = EncodecModel.from_pretrained("facebook/encodec_24khz") processor = AutoProcessor.from_pretrained("facebook/encodec_24khz") # cast the audio data to the correct sampling rate for the model librispeech_dummy = librispeech_dummy.cast_column("audio", Audio(sampling_rate=processor.sampling_rate)) audio_sample = librispeech_dummy[0]["audio"]["array"] # pre-process the inputs inputs = processor(raw_audio=audio_sample, sampling_rate=processor.sampling_rate, return_tensors="pt") # explicitly encode then decode the audio inputs encoder_outputs = model.encode(inputs["input_values"], inputs["padding_mask"]) audio_values = model.decode(encoder_outputs.audio_codes, encoder_outputs.audio_scales, inputs["padding_mask"])[0] # or the equivalent with a forward pass audio_values = model(inputs["input_values"], inputs["padding_mask"]).audio_values ``` ## Training Details The model was trained for 300 epochs, with one epoch being 2,000 updates with the Adam optimizer with a batch size of 64 examples of 1 second each, a learning rate of 3 · 10−4 , β1 = 0.5, and β2 = 0.9. All the models are traind using 8 A100 GPUs. ### Training Data <!-- This should link to a Data Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. --> - For speech: - DNS Challenge 4 - [Common Voice](https://huggingface.co/datasets/common_voice) - For general audio: - [AudioSet](https://huggingface.co/datasets/Fhrozen/AudioSet2K22) - [FSD50K](https://huggingface.co/datasets/Fhrozen/FSD50k) - For music: - [Jamendo dataset](https://huggingface.co/datasets/rkstgr/mtg-jamendo) They used four different training strategies to sample for these datasets: - (s1) sample a single source from Jamendo with probability 0.32; - (s2) sample a single source from the other datasets with the same probability; - (s3) mix two sources from all datasets with a probability of 0.24; - (s4) mix three sources from all datasets except music with a probability of 0.12. The audio is normalized by file and a random gain between -10 and 6 dB id applied. ## Evaluation <!-- This section describes the evaluation protocols and provides the results. --> ### Subjectif metric for restoration: This models was evalutated using the MUSHRA protocol (Series, 2014), using both a hidden reference and a low anchor. Annotators were recruited using a crowd-sourcing platform, in which they were asked to rate the perceptual quality of the provided samples in a range between 1 to 100. They randomly select 50 samples of 5 seconds from each category of the the test set and force at least 10 annotations per samples. To filter noisy annotations and outliers we remove annotators who rate the reference recordings less then 90 in at least 20% of the cases, or rate the low-anchor recording above 80 more than 50% of the time. ### Objective metric for restoration: The ViSQOL()ink) metric was used together with the Scale-Invariant Signal-to-Noise Ration (SI-SNR) (Luo & Mesgarani, 2019; Nachmani et al., 2020; Chazan et al., 2021). ### Results The results of the evaluation demonstrate the superiority of EnCodec compared to the baselines across different bandwidths (1.5, 3, 6, and 12 kbps). When comparing EnCodec with the baselines at the same bandwidth, EnCodec consistently outperforms them in terms of MUSHRA score. Notably, EnCodec achieves better performance, on average, at 3 kbps compared to Lyra-v2 at 6 kbps and Opus at 12 kbps. Additionally, by incorporating the language model over the codes, it is possible to achieve a bandwidth reduction of approximately 25-40%. For example, the bandwidth of the 3 kbps model can be reduced to 1.9 kbps. #### Summary EnCodec is a state-of-the-art real-time neural audio compression model that excels in producing high-fidelity audio samples at various sample rates and bandwidths. The model's performance was evaluated across different settings, ranging from 24kHz monophonic at 1.5 kbps to 48kHz stereophonic, showcasing both subjective and objective results. Notably, EnCodec incorporates a novel spectrogram-only adversarial loss, effectively reducing artifacts and enhancing sample quality. Training stability and interpretability were further enhanced through the introduction of a gradient balancer for the loss weights. Additionally, the study demonstrated that a compact Transformer model can be employed to achieve an additional bandwidth reduction of up to 40% without compromising quality, particularly in applications where low latency is not critical (e.g., music streaming). ## Citation <!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. --> **BibTeX:** ``` @misc{défossez2022high, title={High Fidelity Neural Audio Compression}, author={Alexandre Défossez and Jade Copet and Gabriel Synnaeve and Yossi Adi}, year={2022}, eprint={2210.13438}, archivePrefix={arXiv}, primaryClass={eess.AS} } ```

timm/vit_base_patch16_224.augreg2_in21k_ft_in1k

timm

timm

image-classification

--- tags: - image-classification - timm library_name: timm license: apache-2.0 datasets: - imagenet-1k - imagenet-21k --- # Model card for vit_base_patch16_224.augreg2_in21k_ft_in1k A Vision Transformer (ViT) image classification model. Trained on ImageNet-21k by paper authors and (re) fine-tuned on ImageNet-1k with additional augmentation and regularization by Ross Wightman. ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 86.6 - GMACs: 16.9 - Activations (M): 16.5 - Image size: 224 x 224 - **Papers:** - How to train your ViT? Data, Augmentation, and Regularization in Vision Transformers: https://arxiv.org/abs/2106.10270 - An Image is Worth 16x16 Words: Transformers for Image Recognition at Scale: https://arxiv.org/abs/2010.11929v2 - **Dataset:** ImageNet-1k - **Pretrain Dataset:** ImageNet-21k - **Original:** https://github.com/google-research/vision_transformer ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('vit_base_patch16_224.augreg2_in21k_ft_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'vit_base_patch16_224.augreg2_in21k_ft_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled, a (1, 197, 768) shaped tensor output = model.forward_head(output, pre_logits=True) # output is a (1, num_features) shaped tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). ## Citation ```bibtex @article{steiner2021augreg, title={How to train your ViT? Data, Augmentation, and Regularization in Vision Transformers}, author={Steiner, Andreas and Kolesnikov, Alexander and and Zhai, Xiaohua and Wightman, Ross and Uszkoreit, Jakob and Beyer, Lucas}, journal={arXiv preprint arXiv:2106.10270}, year={2021} } ``` ```bibtex @article{dosovitskiy2020vit, title={An Image is Worth 16x16 Words: Transformers for Image Recognition at Scale}, author={Dosovitskiy, Alexey and Beyer, Lucas and Kolesnikov, Alexander and Weissenborn, Dirk and Zhai, Xiaohua and Unterthiner, Thomas and Dehghani, Mostafa and Minderer, Matthias and Heigold, Georg and Gelly, Sylvain and Uszkoreit, Jakob and Houlsby, Neil}, journal={ICLR}, year={2021} } ``` ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ```

cambridgeltl/SapBERT-from-PubMedBERT-fulltext

cambridgeltl

transformers

feature-extraction

--- license: apache-2.0 language: - en tags: - biomedical - lexical semantics - bionlp - biology - science - embedding - entity linking --- --- datasets: - UMLS **[news]** A cross-lingual extension of SapBERT will appear in the main onference of **ACL 2021**! <br> **[news]** SapBERT will appear in the conference proceedings of **NAACL 2021**! ### SapBERT-PubMedBERT SapBERT by [Liu et al. (2020)](https://arxiv.org/pdf/2010.11784.pdf). Trained with [UMLS](https://www.nlm.nih.gov/research/umls/licensedcontent/umlsknowledgesources.html) 2020AA (English only), using [microsoft/BiomedNLP-PubMedBERT-base-uncased-abstract-fulltext](https://huggingface.co/microsoft/BiomedNLP-PubMedBERT-base-uncased-abstract-fulltext) as the base model. ### Expected input and output The input should be a string of biomedical entity names, e.g., "covid infection" or "Hydroxychloroquine". The [CLS] embedding of the last layer is regarded as the output. #### Extracting embeddings from SapBERT The following script converts a list of strings (entity names) into embeddings. ```python import numpy as np import torch from tqdm.auto import tqdm from transformers import AutoTokenizer, AutoModel tokenizer = AutoTokenizer.from_pretrained("cambridgeltl/SapBERT-from-PubMedBERT-fulltext") model = AutoModel.from_pretrained("cambridgeltl/SapBERT-from-PubMedBERT-fulltext").cuda() # replace with your own list of entity names all_names = ["covid-19", "Coronavirus infection", "high fever", "Tumor of posterior wall of oropharynx"] bs = 128 # batch size during inference all_embs = [] for i in tqdm(np.arange(0, len(all_names), bs)): toks = tokenizer.batch_encode_plus(all_names[i:i+bs], padding="max_length", max_length=25, truncation=True, return_tensors="pt") toks_cuda = {} for k,v in toks.items(): toks_cuda[k] = v.cuda() cls_rep = model(**toks_cuda)[0][:,0,:] # use CLS representation as the embedding all_embs.append(cls_rep.cpu().detach().numpy()) all_embs = np.concatenate(all_embs, axis=0) ``` For more details about training and eval, see SapBERT [github repo](https://github.com/cambridgeltl/sapbert). ### Citation ```bibtex @inproceedings{liu-etal-2021-self, title = "Self-Alignment Pretraining for Biomedical Entity Representations", author = "Liu, Fangyu and Shareghi, Ehsan and Meng, Zaiqiao and Basaldella, Marco and Collier, Nigel", booktitle = "Proceedings of the 2021 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies", month = jun, year = "2021", address = "Online", publisher = "Association for Computational Linguistics", url = "https://www.aclweb.org/anthology/2021.naacl-main.334", pages = "4228--4238", abstract = "Despite the widespread success of self-supervised learning via masked language models (MLM), accurately capturing fine-grained semantic relationships in the biomedical domain remains a challenge. This is of paramount importance for entity-level tasks such as entity linking where the ability to model entity relations (especially synonymy) is pivotal. To address this challenge, we propose SapBERT, a pretraining scheme that self-aligns the representation space of biomedical entities. We design a scalable metric learning framework that can leverage UMLS, a massive collection of biomedical ontologies with 4M+ concepts. In contrast with previous pipeline-based hybrid systems, SapBERT offers an elegant one-model-for-all solution to the problem of medical entity linking (MEL), achieving a new state-of-the-art (SOTA) on six MEL benchmarking datasets. In the scientific domain, we achieve SOTA even without task-specific supervision. With substantial improvement over various domain-specific pretrained MLMs such as BioBERT, SciBERTand and PubMedBERT, our pretraining scheme proves to be both effective and robust.", } ```

stabilityai/sd-vae-ft-mse

stabilityai

diffusers

--- license: mit tags: - stable-diffusion - stable-diffusion-diffusers inference: false --- # Improved Autoencoders ## Utilizing These weights are intended to be used with the [🧨 diffusers library](https://github.com/huggingface/diffusers). If you are looking for the model to use with the original [CompVis Stable Diffusion codebase](https://github.com/CompVis/stable-diffusion), [come here](https://huggingface.co/stabilityai/sd-vae-ft-mse-original). #### How to use with 🧨 diffusers You can integrate this fine-tuned VAE decoder to your existing `diffusers` workflows, by including a `vae` argument to the `StableDiffusionPipeline` ```py from diffusers.models import AutoencoderKL from diffusers import StableDiffusionPipeline model = "CompVis/stable-diffusion-v1-4" vae = AutoencoderKL.from_pretrained("stabilityai/sd-vae-ft-mse") pipe = StableDiffusionPipeline.from_pretrained(model, vae=vae) ``` ## Decoder Finetuning We publish two kl-f8 autoencoder versions, finetuned from the original [kl-f8 autoencoder](https://github.com/CompVis/latent-diffusion#pretrained-autoencoding-models) on a 1:1 ratio of [LAION-Aesthetics](https://laion.ai/blog/laion-aesthetics/) and LAION-Humans, an unreleased subset containing only SFW images of humans. The intent was to fine-tune on the Stable Diffusion training set (the autoencoder was originally trained on OpenImages) but also enrich the dataset with images of humans to improve the reconstruction of faces. The first, _ft-EMA_, was resumed from the original checkpoint, trained for 313198 steps and uses EMA weights. It uses the same loss configuration as the original checkpoint (L1 + LPIPS). The second, _ft-MSE_, was resumed from _ft-EMA_ and uses EMA weights and was trained for another 280k steps using a different loss, with more emphasis on MSE reconstruction (MSE + 0.1 * LPIPS). It produces somewhat ``smoother'' outputs. The batch size for both versions was 192 (16 A100s, batch size 12 per GPU). To keep compatibility with existing models, only the decoder part was finetuned; the checkpoints can be used as a drop-in replacement for the existing autoencoder. _Original kl-f8 VAE vs f8-ft-EMA vs f8-ft-MSE_ ## Evaluation ### COCO 2017 (256x256, val, 5000 images) | Model | train steps | rFID | PSNR | SSIM | PSIM | Link | Comments |----------|---------|------|--------------|---------------|---------------|-----------------------------------------------------------------------------------|-------------------------------------------------------------------------------------------------| | | | | | | | | | | original | 246803 | 4.99 | 23.4 +/- 3.8 | 0.69 +/- 0.14 | 1.01 +/- 0.28 | https://ommer-lab.com/files/latent-diffusion/kl-f8.zip | as used in SD | | ft-EMA | 560001 | 4.42 | 23.8 +/- 3.9 | 0.69 +/- 0.13 | 0.96 +/- 0.27 | https://huggingface.co/stabilityai/sd-vae-ft-ema-original/resolve/main/vae-ft-ema-560000-ema-pruned.ckpt | slightly better overall, with EMA | | ft-MSE | 840001 | 4.70 | 24.5 +/- 3.7 | 0.71 +/- 0.13 | 0.92 +/- 0.27 | https://huggingface.co/stabilityai/sd-vae-ft-mse-original/resolve/main/vae-ft-mse-840000-ema-pruned.ckpt | resumed with EMA from ft-EMA, emphasis on MSE (rec. loss = MSE + 0.1 * LPIPS), smoother outputs | ### LAION-Aesthetics 5+ (256x256, subset, 10000 images) | Model | train steps | rFID | PSNR | SSIM | PSIM | Link | Comments |----------|-----------|------|--------------|---------------|---------------|-----------------------------------------------------------------------------------|-------------------------------------------------------------------------------------------------| | | | | | | | | | | original | 246803 | 2.61 | 26.0 +/- 4.4 | 0.81 +/- 0.12 | 0.75 +/- 0.36 | https://ommer-lab.com/files/latent-diffusion/kl-f8.zip | as used in SD | | ft-EMA | 560001 | 1.77 | 26.7 +/- 4.8 | 0.82 +/- 0.12 | 0.67 +/- 0.34 | https://huggingface.co/stabilityai/sd-vae-ft-ema-original/resolve/main/vae-ft-ema-560000-ema-pruned.ckpt | slightly better overall, with EMA | | ft-MSE | 840001 | 1.88 | 27.3 +/- 4.7 | 0.83 +/- 0.11 | 0.65 +/- 0.34 | https://huggingface.co/stabilityai/sd-vae-ft-mse-original/resolve/main/vae-ft-mse-840000-ema-pruned.ckpt | resumed with EMA from ft-EMA, emphasis on MSE (rec. loss = MSE + 0.1 * LPIPS), smoother outputs | ### Visual _Visualization of reconstructions on 256x256 images from the COCO2017 validation dataset._ <p align="center"> <br> <b> 256x256: ft-EMA (left), ft-MSE (middle), original (right)</b> </p> <p align="center"> <img src=https://huggingface.co/stabilityai/stable-diffusion-decoder-finetune/resolve/main/eval/ae-decoder-tuning-reconstructions/merged/00025_merged.png /> </p> <p align="center"> <img src=https://huggingface.co/stabilityai/stable-diffusion-decoder-finetune/resolve/main/eval/ae-decoder-tuning-reconstructions/merged/00011_merged.png /> </p> <p align="center"> <img src=https://huggingface.co/stabilityai/stable-diffusion-decoder-finetune/resolve/main/eval/ae-decoder-tuning-reconstructions/merged/00037_merged.png /> </p> <p align="center"> <img src=https://huggingface.co/stabilityai/stable-diffusion-decoder-finetune/resolve/main/eval/ae-decoder-tuning-reconstructions/merged/00043_merged.png /> </p> <p align="center"> <img src=https://huggingface.co/stabilityai/stable-diffusion-decoder-finetune/resolve/main/eval/ae-decoder-tuning-reconstructions/merged/00053_merged.png /> </p> <p align="center"> <img src=https://huggingface.co/stabilityai/stable-diffusion-decoder-finetune/resolve/main/eval/ae-decoder-tuning-reconstructions/merged/00029_merged.png /> </p>

Helsinki-NLP/opus-mt-it-en

Helsinki-NLP

transformers

translation

--- tags: - translation license: apache-2.0 --- ### opus-mt-it-en * source languages: it * target languages: en * OPUS readme: [it-en](https://github.com/Helsinki-NLP/OPUS-MT-train/blob/master/models/it-en/README.md) * dataset: opus * model: transformer-align * pre-processing: normalization + SentencePiece * download original weights: [opus-2019-12-18.zip](https://object.pouta.csc.fi/OPUS-MT-models/it-en/opus-2019-12-18.zip) * test set translations: [opus-2019-12-18.test.txt](https://object.pouta.csc.fi/OPUS-MT-models/it-en/opus-2019-12-18.test.txt) * test set scores: [opus-2019-12-18.eval.txt](https://object.pouta.csc.fi/OPUS-MT-models/it-en/opus-2019-12-18.eval.txt) ## Benchmarks | testset | BLEU | chr-F | |-----------------------|-------|-------| | newssyscomb2009.it.en | 35.3 | 0.600 | | newstest2009.it.en | 34.0 | 0.594 | | Tatoeba.it.en | 70.9 | 0.808 |

dmis-lab/biobert-v1.1

dmis-lab

transformers

feature-extraction

Entry not found

benjamin/wtp-canine-s-1l

benjamin

transformers

token-classification

--- license: mit language: - multilingual - am - ar - az - be - bg - bn - ca - ceb - cs - cy - da - de - el - en - eo - es - et - eu - fa - fi - fr - fy - ga - gd - gl - gu - ha - he - hi - hu - hy - id - ig - is - it - ja - jv - ka - kk - km - kn - ko - ku - ky - la - lt - lv - mg - mk - ml - mn - mr - ms - mt - my - ne - nl - no - pa - pl - ps - pt - ro - ru - si - sk - sl - sq - sr - sv - ta - te - tg - th - tr - uk - ur - uz - vi - xh - yi - yo - zh - zu --- # wtp-canine-s-1l Model for [`wtpsplit`](https://github.com/bminixhofer/wtpsplit).

Ashishkr/query_wellformedness_score

Ashishkr

transformers

text-classification

--- license: apache-2.0 inference: false datasets: google_wellformed_query --- ```DOI @misc {ashish_kumar_2024, author = { {Ashish Kumar} }, title = { query_wellformedness_score (Revision 55a424c) }, year = 2024, url = { https://huggingface.co/Ashishkr/query_wellformedness_score }, doi = { 10.57967/hf/1980 }, publisher = { Hugging Face } } ``` **Intended Use Cases** *Content Creation*: Validate the well-formedness of written content. *Educational Platforms*: Helps students check the grammaticality of their sentences. *Chatbots & Virtual Assistants*: To validate user queries or generate well-formed responses. **contact: kua613@g.harvard.edu** **Model name**: Query Wellformedness Scoring **Description** : Evaluate the well-formedness of sentences by checking grammatical correctness and completeness. Sensitive to case and penalizes sentences for incorrect grammar and case. **Features**: - *Wellformedness Score*: Provides a score indicating grammatical correctness and completeness. - *Case Sensitivity*: Recognizes and penalizes incorrect casing in sentences. - *Broad Applicability*: Can be used on a wide range of sentences. **Example**: 1. Dogs are mammals. 2. she loves to read books on history. 3. When the rain in Spain. 4. Eating apples are healthy for you. 5. The Eiffel Tower is in Paris. Among these sentences: Sentences 1 and 5 are well-formed and have correct grammar and case. Sentence 2 starts with a lowercase letter. Sentence 3 is a fragment and is not well-formed. Sentence 4 has a subject-verb agreement error. **example_usage:** *library: HuggingFace transformers* ```python import torch from transformers import AutoTokenizer, AutoModelForSequenceClassification tokenizer = AutoTokenizer.from_pretrained("Ashishkr/query_wellformedness_score") model = AutoModelForSequenceClassification.from_pretrained("Ashishkr/query_wellformedness_score") sentences = [ "The quarterly financial report are showing an increase.", # Incorrect "Him has completed the audit for last fiscal year.", # Incorrect "Please to inform the board about the recent developments.", # Incorrect "The team successfully achieved all its targets for the last quarter.", # Correct "Our company is exploring new ventures in the European market." # Correct ] features = tokenizer(sentences, padding=True, truncation=True, return_tensors="pt") model.eval() with torch.no_grad(): scores = model(**features).logits print(scores) ``` Cite Ashishkr/query_wellformedness_score

facebook/detr-resnet-50

facebook

transformers

object-detection

--- license: apache-2.0 tags: - object-detection - vision datasets: - coco widget: - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/savanna.jpg example_title: Savanna - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/football-match.jpg example_title: Football Match - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/airport.jpg example_title: Airport --- # DETR (End-to-End Object Detection) model with ResNet-50 backbone DEtection TRansformer (DETR) model trained end-to-end on COCO 2017 object detection (118k annotated images). It was introduced in the paper [End-to-End Object Detection with Transformers](https://arxiv.org/abs/2005.12872) by Carion et al. and first released in [this repository](https://github.com/facebookresearch/detr). Disclaimer: The team releasing DETR did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description The DETR model is an encoder-decoder transformer with a convolutional backbone. Two heads are added on top of the decoder outputs in order to perform object detection: a linear layer for the class labels and a MLP (multi-layer perceptron) for the bounding boxes. The model uses so-called object queries to detect objects in an image. Each object query looks for a particular object in the image. For COCO, the number of object queries is set to 100. The model is trained using a "bipartite matching loss": one compares the predicted classes + bounding boxes of each of the N = 100 object queries to the ground truth annotations, padded up to the same length N (so if an image only contains 4 objects, 96 annotations will just have a "no object" as class and "no bounding box" as bounding box). The Hungarian matching algorithm is used to create an optimal one-to-one mapping between each of the N queries and each of the N annotations. Next, standard cross-entropy (for the classes) and a linear combination of the L1 and generalized IoU loss (for the bounding boxes) are used to optimize the parameters of the model.  ## Intended uses & limitations You can use the raw model for object detection. See the [model hub](https://huggingface.co/models?search=facebook/detr) to look for all available DETR models. ### How to use Here is how to use this model: ```python from transformers import DetrImageProcessor, DetrForObjectDetection import torch from PIL import Image import requests url = "http://images.cocodataset.org/val2017/000000039769.jpg" image = Image.open(requests.get(url, stream=True).raw) # you can specify the revision tag if you don't want the timm dependency processor = DetrImageProcessor.from_pretrained("facebook/detr-resnet-50", revision="no_timm") model = DetrForObjectDetection.from_pretrained("facebook/detr-resnet-50", revision="no_timm") inputs = processor(images=image, return_tensors="pt") outputs = model(**inputs) # convert outputs (bounding boxes and class logits) to COCO API # let's only keep detections with score > 0.9 target_sizes = torch.tensor([image.size[::-1]]) results = processor.post_process_object_detection(outputs, target_sizes=target_sizes, threshold=0.9)[0] for score, label, box in zip(results["scores"], results["labels"], results["boxes"]): box = [round(i, 2) for i in box.tolist()] print( f"Detected {model.config.id2label[label.item()]} with confidence " f"{round(score.item(), 3)} at location {box}" ) ``` This should output: ``` Detected remote with confidence 0.998 at location [40.16, 70.81, 175.55, 117.98] Detected remote with confidence 0.996 at location [333.24, 72.55, 368.33, 187.66] Detected couch with confidence 0.995 at location [-0.02, 1.15, 639.73, 473.76] Detected cat with confidence 0.999 at location [13.24, 52.05, 314.02, 470.93] Detected cat with confidence 0.999 at location [345.4, 23.85, 640.37, 368.72] ``` Currently, both the feature extractor and model support PyTorch. ## Training data The DETR model was trained on [COCO 2017 object detection](https://cocodataset.org/#download), a dataset consisting of 118k/5k annotated images for training/validation respectively. ## Training procedure ### Preprocessing The exact details of preprocessing of images during training/validation can be found [here](https://github.com/google-research/vision_transformer/blob/master/vit_jax/input_pipeline.py). Images are resized/rescaled such that the shortest side is at least 800 pixels and the largest side at most 1333 pixels, and normalized across the RGB channels with the ImageNet mean (0.485, 0.456, 0.406) and standard deviation (0.229, 0.224, 0.225). ### Training The model was trained for 300 epochs on 16 V100 GPUs. This takes 3 days, with 4 images per GPU (hence a total batch size of 64). ## Evaluation results This model achieves an AP (average precision) of **42.0** on COCO 2017 validation. For more details regarding evaluation results, we refer to table 1 of the original paper. ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-2005-12872, author = {Nicolas Carion and Francisco Massa and Gabriel Synnaeve and Nicolas Usunier and Alexander Kirillov and Sergey Zagoruyko}, title = {End-to-End Object Detection with Transformers}, journal = {CoRR}, volume = {abs/2005.12872}, year = {2020}, url = {https://arxiv.org/abs/2005.12872}, archivePrefix = {arXiv}, eprint = {2005.12872}, timestamp = {Thu, 28 May 2020 17:38:09 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2005-12872.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

deepset/roberta-base-squad2

deepset

transformers

question-answering

--- language: en license: cc-by-4.0 datasets: - squad_v2 model-index: - name: deepset/roberta-base-squad2 results: - task: type: question-answering name: Question Answering dataset: name: squad_v2 type: squad_v2 config: squad_v2 split: validation metrics: - type: exact_match value: 79.9309 name: Exact Match verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMDhhNjg5YzNiZGQ1YTIyYTAwZGUwOWEzZTRiYzdjM2QzYjA3ZTUxNDM1NjE1MTUyMjE1MGY1YzEzMjRjYzVjYiIsInZlcnNpb24iOjF9.EH5JJo8EEFwU7osPz3s7qanw_tigeCFhCXjSfyN0Y1nWVnSfulSxIk_DbAEI5iE80V4EKLyp5-mYFodWvL2KDA - type: f1 value: 82.9501 name: F1 verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMjk5ZDYwOGQyNjNkMWI0OTE4YzRmOTlkY2JjNjQ0YTZkNTMzMzNkYTA0MDFmNmI3NjA3NjNlMjhiMDQ2ZjJjNSIsInZlcnNpb24iOjF9.DDm0LNTkdLbGsue58bg1aH_s67KfbcmkvL-6ZiI2s8IoxhHJMSf29H_uV2YLyevwx900t-MwTVOW3qfFnMMEAQ - type: total value: 11869 name: total verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMGFkMmI2ODM0NmY5NGNkNmUxYWViOWYxZDNkY2EzYWFmOWI4N2VhYzY5MGEzMTVhOTU4Zjc4YWViOGNjOWJjMCIsInZlcnNpb24iOjF9.fexrU1icJK5_MiifBtZWkeUvpmFISqBLDXSQJ8E6UnrRof-7cU0s4tX_dIsauHWtUpIHMPZCf5dlMWQKXZuAAA - task: type: question-answering name: Question Answering dataset: name: squad type: squad config: plain_text split: validation metrics: - type: exact_match value: 85.289 name: Exact Match - type: f1 value: 91.841 name: F1 - task: type: question-answering name: Question Answering dataset: name: adversarial_qa type: adversarial_qa config: adversarialQA split: validation metrics: - type: exact_match value: 29.500 name: Exact Match - type: f1 value: 40.367 name: F1 - task: type: question-answering name: Question Answering dataset: name: squad_adversarial type: squad_adversarial config: AddOneSent split: validation metrics: - type: exact_match value: 78.567 name: Exact Match - type: f1 value: 84.469 name: F1 - task: type: question-answering name: Question Answering dataset: name: squadshifts amazon type: squadshifts config: amazon split: test metrics: - type: exact_match value: 69.924 name: Exact Match - type: f1 value: 83.284 name: F1 - task: type: question-answering name: Question Answering dataset: name: squadshifts new_wiki type: squadshifts config: new_wiki split: test metrics: - type: exact_match value: 81.204 name: Exact Match - type: f1 value: 90.595 name: F1 - task: type: question-answering name: Question Answering dataset: name: squadshifts nyt type: squadshifts config: nyt split: test metrics: - type: exact_match value: 82.931 name: Exact Match - type: f1 value: 90.756 name: F1 - task: type: question-answering name: Question Answering dataset: name: squadshifts reddit type: squadshifts config: reddit split: test metrics: - type: exact_match value: 71.550 name: Exact Match - type: f1 value: 82.939 name: F1 --- # roberta-base for QA This is the [roberta-base](https://huggingface.co/roberta-base) model, fine-tuned using the [SQuAD2.0](https://huggingface.co/datasets/squad_v2) dataset. It's been trained on question-answer pairs, including unanswerable questions, for the task of Question Answering. ## Overview **Language model:** roberta-base **Language:** English **Downstream-task:** Extractive QA **Training data:** SQuAD 2.0 **Eval data:** SQuAD 2.0 **Code:** See [an example QA pipeline on Haystack](https://haystack.deepset.ai/tutorials/first-qa-system) **Infrastructure**: 4x Tesla v100 ## Hyperparameters ``` batch_size = 96 n_epochs = 2 base_LM_model = "roberta-base" max_seq_len = 386 learning_rate = 3e-5 lr_schedule = LinearWarmup warmup_proportion = 0.2 doc_stride=128 max_query_length=64 ``` ## Using a distilled model instead Please note that we have also released a distilled version of this model called [deepset/tinyroberta-squad2](https://huggingface.co/deepset/tinyroberta-squad2). The distilled model has a comparable prediction quality and runs at twice the speed of the base model. ## Usage ### In Haystack Haystack is an NLP framework by deepset. You can use this model in a Haystack pipeline to do question answering at scale (over many documents). To load the model in [Haystack](https://github.com/deepset-ai/haystack/): ```python reader = FARMReader(model_name_or_path="deepset/roberta-base-squad2") # or reader = TransformersReader(model_name_or_path="deepset/roberta-base-squad2",tokenizer="deepset/roberta-base-squad2") ``` For a complete example of ``roberta-base-squad2`` being used for Question Answering, check out the [Tutorials in Haystack Documentation](https://haystack.deepset.ai/tutorials/first-qa-system) ### In Transformers ```python from transformers import AutoModelForQuestionAnswering, AutoTokenizer, pipeline model_name = "deepset/roberta-base-squad2" # a) Get predictions nlp = pipeline('question-answering', model=model_name, tokenizer=model_name) QA_input = { 'question': 'Why is model conversion important?', 'context': 'The option to convert models between FARM and transformers gives freedom to the user and let people easily switch between frameworks.' } res = nlp(QA_input) # b) Load model & tokenizer model = AutoModelForQuestionAnswering.from_pretrained(model_name) tokenizer = AutoTokenizer.from_pretrained(model_name) ``` ## Performance Evaluated on the SQuAD 2.0 dev set with the [official eval script](https://worksheets.codalab.org/rest/bundles/0x6b567e1cf2e041ec80d7098f031c5c9e/contents/blob/). ``` "exact": 79.87029394424324, "f1": 82.91251169582613, "total": 11873, "HasAns_exact": 77.93522267206478, "HasAns_f1": 84.02838248389763, "HasAns_total": 5928, "NoAns_exact": 81.79983179142137, "NoAns_f1": 81.79983179142137, "NoAns_total": 5945 ``` ## Authors **Branden Chan:** branden.chan@deepset.ai **Timo Möller:** timo.moeller@deepset.ai **Malte Pietsch:** malte.pietsch@deepset.ai **Tanay Soni:** tanay.soni@deepset.ai ## About us <div class="grid lg:grid-cols-2 gap-x-4 gap-y-3"> <div class="w-full h-40 object-cover mb-2 rounded-lg flex items-center justify-center"> <img alt="" src="https://raw.githubusercontent.com/deepset-ai/.github/main/deepset-logo-colored.png" class="w-40"/> </div> <div class="w-full h-40 object-cover mb-2 rounded-lg flex items-center justify-center"> <img alt="" src="https://raw.githubusercontent.com/deepset-ai/.github/main/haystack-logo-colored.png" class="w-40"/> </div> </div> [deepset](http://deepset.ai/) is the company behind the open-source NLP framework [Haystack](https://haystack.deepset.ai/) which is designed to help you build production ready NLP systems that use: Question answering, summarization, ranking etc. Some of our other work: - [Distilled roberta-base-squad2 (aka "tinyroberta-squad2")](https://huggingface.co/deepset/tinyroberta-squad2) - [German BERT (aka "bert-base-german-cased")](https://deepset.ai/german-bert) - [GermanQuAD and GermanDPR datasets and models (aka "gelectra-base-germanquad", "gbert-base-germandpr")](https://deepset.ai/germanquad) ## Get in touch and join the Haystack community <p>For more info on Haystack, visit our <strong><a href="https://github.com/deepset-ai/haystack">GitHub</a></strong> repo and <strong><a href="https://docs.haystack.deepset.ai">Documentation</a></strong>. We also have a <strong><a class="h-7" href="https://haystack.deepset.ai/community">Discord community open to everyone!</a></strong></p> [Twitter](https://twitter.com/deepset_ai) | [LinkedIn](https://www.linkedin.com/company/deepset-ai/) | [Discord](https://haystack.deepset.ai/community) | [GitHub Discussions](https://github.com/deepset-ai/haystack/discussions) | [Website](https://deepset.ai) By the way: [we're hiring!](http://www.deepset.ai/jobs)

allenai/specter2_base

allenai

transformers

feature-extraction

--- license: apache-2.0 datasets: - allenai/scirepeval language: - en --- <!-- Provide a quick summary of what the model is/does. --> ## SPECTER2 <!-- Provide a quick summary of what the model is/does. --> SPECTER2 is the successor to [SPECTER](https://huggingface.co/allenai/specter) and is capable of generating task specific embeddings for scientific tasks when paired with [adapters](https://huggingface.co/models?search=allenai/specter-2_). This is the base model to be used along with the adapters. Given the combination of title and abstract of a scientific paper or a short texual query, the model can be used to generate effective embeddings to be used in downstream applications. **Note:For general embedding purposes, please use [allenai/specter2](https://huggingface.co/allenai/specter2).** **To get the best performance on a downstream task type please load the associated adapter with the base model as in the example below.** **Dec 2023 Update:** Model usage updated to be compatible with latest versions of transformers and adapters (newly released update to adapter-transformers) libraries. **Aug 2023 Update:** 1. **The SPECTER2 Base and proximity adapter models have been renamed in Hugging Face based upon usage patterns as follows:** |Old Name|New Name| |--|--| |allenai/specter2|[allenai/specter2_base](https://huggingface.co/allenai/specter2_base)| |allenai/specter2_proximity|[allenai/specter2](https://huggingface.co/allenai/specter2)| 2. **We have a parallel version (termed [aug2023refresh](https://huggingface.co/allenai/specter2_aug2023refresh)) where the base transformer encoder version is pre-trained on a collection of newer papers (published after 2018). However, for benchmarking purposes, please continue using the current version.** An [adapter](https://adapterhub.ml) for the [allenai/specter2_base](https://huggingface.co/allenai/specter2_base) model that was trained on the [allenai/scirepeval](https://huggingface.co/datasets/allenai/scirepeval/) dataset. This adapter was created for usage with the **[adapters](https://github.com/adapter-hub/adapters)** library. # Model Details ## Model Description SPECTER2 has been trained on over 6M triplets of scientific paper citations, which are available [here](https://huggingface.co/datasets/allenai/scirepeval/viewer/cite_prediction_new/evaluation). Post that it is trained with additionally attached task format specific adapter modules on all the [SciRepEval](https://huggingface.co/datasets/allenai/scirepeval) training tasks. Task Formats trained on: - Classification - Regression - Proximity (Retrieval) - Adhoc Search It builds on the work done in [SciRepEval: A Multi-Format Benchmark for Scientific Document Representations](https://api.semanticscholar.org/CorpusID:254018137) and we evaluate the trained model on this benchmark as well. - **Developed by:** Amanpreet Singh, Mike D'Arcy, Arman Cohan, Doug Downey, Sergey Feldman - **Shared by :** Allen AI - **Model type:** bert-base-uncased + adapters - **License:** Apache 2.0 - **Finetuned from model:** [allenai/scibert](https://huggingface.co/allenai/scibert_scivocab_uncased). ## Model Sources <!-- Provide the basic links for the model. --> - **Repository:** [https://github.com/allenai/SPECTER2](https://github.com/allenai/SPECTER2) - **Paper:** [https://api.semanticscholar.org/CorpusID:254018137](https://api.semanticscholar.org/CorpusID:254018137) - **Demo:** [Usage](https://github.com/allenai/SPECTER2/blob/main/README.md) # Uses <!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. --> ## Direct Use |Model|Name and HF link|Description| |--|--|--| |Proximity*|[allenai/specter2](https://huggingface.co/allenai/specter2)|Encode papers as queries and candidates eg. Link Prediction, Nearest Neighbor Search| |Adhoc Query|[allenai/specter2_adhoc_query](https://huggingface.co/allenai/specter2_adhoc_query)|Encode short raw text queries for search tasks. (Candidate papers can be encoded with the proximity adapter)| |Classification|[allenai/specter2_classification](https://huggingface.co/allenai/specter2_classification)|Encode papers to feed into linear classifiers as features| |Regression|[allenai/specter2_regression](https://huggingface.co/allenai/specter2_regression)|Encode papers to feed into linear regressors as features| *Proximity model should suffice for downstream task types not mentioned above ```python from transformers import AutoTokenizer from adapters import AutoAdapterModel # load model and tokenizer tokenizer = AutoTokenizer.from_pretrained('allenai/specter2_base') #load base model model = AutoAdapterModel.from_pretrained('allenai/specter2_base') #load the adapter(s) as per the required task, provide an identifier for the adapter in load_as argument and activate it model.load_adapter("allenai/specter2", source="hf", load_as="proximity", set_active=True) #other possibilities: allenai/specter2_<classification|regression|adhoc_query> papers = [{'title': 'BERT', 'abstract': 'We introduce a new language representation model called BERT'}, {'title': 'Attention is all you need', 'abstract': ' The dominant sequence transduction models are based on complex recurrent or convolutional neural networks'}] # concatenate title and abstract text_batch = [d['title'] + tokenizer.sep_token + (d.get('abstract') or '') for d in papers] # preprocess the input inputs = self.tokenizer(text_batch, padding=True, truncation=True, return_tensors="pt", return_token_type_ids=False, max_length=512) output = model(**inputs) # take the first token in the batch as the embedding embeddings = output.last_hidden_state[:, 0, :] ``` ## Downstream Use <!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app --> For evaluation and downstream usage, please refer to [https://github.com/allenai/scirepeval/blob/main/evaluation/INFERENCE.md](https://github.com/allenai/scirepeval/blob/main/evaluation/INFERENCE.md). # Training Details ## Training Data <!-- This should link to a Data Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. --> The base model is trained on citation links between papers and the adapters are trained on 8 large scale tasks across the four formats. All the data is a part of SciRepEval benchmark and is available [here](https://huggingface.co/datasets/allenai/scirepeval). The citation link are triplets in the form ```json {"query": {"title": ..., "abstract": ...}, "pos": {"title": ..., "abstract": ...}, "neg": {"title": ..., "abstract": ...}} ``` consisting of a query paper, a positive citation and a negative which can be from the same/different field of study as the query or citation of a citation. ## Training Procedure Please refer to the [SPECTER paper](https://api.semanticscholar.org/CorpusID:215768677). ### Training Hyperparameters The model is trained in two stages using [SciRepEval](https://github.com/allenai/scirepeval/blob/main/training/TRAINING.md): - Base Model: First a base model is trained on the above citation triplets. ``` batch size = 1024, max input length = 512, learning rate = 2e-5, epochs = 2 warmup steps = 10% fp16``` - Adapters: Thereafter, task format specific adapters are trained on the SciRepEval training tasks, where 600K triplets are sampled from above and added to the training data as well. ``` batch size = 256, max input length = 512, learning rate = 1e-4, epochs = 6 warmup = 1000 steps fp16``` # Evaluation We evaluate the model on [SciRepEval](https://github.com/allenai/scirepeval), a large scale eval benchmark for scientific embedding tasks which which has [SciDocs] as a subset. We also evaluate and establish a new SoTA on [MDCR](https://github.com/zoranmedic/mdcr), a large scale citation recommendation benchmark. |Model|SciRepEval In-Train|SciRepEval Out-of-Train|SciRepEval Avg|MDCR(MAP, Recall@5)| |--|--|--|--|--| |[BM-25](https://api.semanticscholar.org/CorpusID:252199740)|n/a|n/a|n/a|(33.7, 28.5)| |[SPECTER](https://huggingface.co/allenai/specter)|54.7|57.4|68.0|(30.6, 25.5)| |[SciNCL](https://huggingface.co/malteos/scincl)|55.6|57.8|69.0|(32.6, 27.3)| |[SciRepEval-Adapters](https://huggingface.co/models?search=scirepeval)|61.9|59.0|70.9|(35.3, 29.6)| |[SPECTER2 Base](allenai/specter2_base)|56.3|73.6|69.1|(38.0, 32.4)| |[SPECTER2-Adapters](https://huggingface.co/models?search=allenai/specter-2)|**62.3**|**59.2**|**71.2**|**(38.4, 33.0)**| Please cite the following works if you end up using SPECTER2: ``` [SciRepEval paper](https://api.semanticscholar.org/CorpusID:254018137) ```bibtex @article{Singh2022SciRepEvalAM, title={SciRepEval: A Multi-Format Benchmark for Scientific Document Representations}, author={Amanpreet Singh and Mike D'Arcy and Arman Cohan and Doug Downey and Sergey Feldman}, journal={ArXiv}, year={2022}, volume={abs/2211.13308} } ```

Helsinki-NLP/opus-mt-sv-en

Helsinki-NLP

transformers

translation

--- pipeline_tag: translation license: apache-2.0 --- ### opus-mt-sv-en * source languages: sv * target languages: en * OPUS readme: [sv-en](https://github.com/Helsinki-NLP/OPUS-MT-train/blob/master/models/sv-en/README.md) * dataset: opus * model: transformer-align * pre-processing: normalization + SentencePiece * download original weights: [opus-2020-02-26.zip](https://object.pouta.csc.fi/OPUS-MT-models/sv-en/opus-2020-02-26.zip) * test set translations: [opus-2020-02-26.test.txt](https://object.pouta.csc.fi/OPUS-MT-models/sv-en/opus-2020-02-26.test.txt) * test set scores: [opus-2020-02-26.eval.txt](https://object.pouta.csc.fi/OPUS-MT-models/sv-en/opus-2020-02-26.eval.txt) ## Benchmarks | testset | BLEU | chr-F | |-----------------------|-------|-------| | Tatoeba.sv.en | 64.5 | 0.763 |

google/bert_uncased_L-2_H-128_A-2

google

transformers

--- thumbnail: https://huggingface.co/front/thumbnails/google.png license: apache-2.0 --- BERT Miniatures === This is the set of 24 BERT models referenced in [Well-Read Students Learn Better: On the Importance of Pre-training Compact Models](https://arxiv.org/abs/1908.08962) (English only, uncased, trained with WordPiece masking). We have shown that the standard BERT recipe (including model architecture and training objective) is effective on a wide range of model sizes, beyond BERT-Base and BERT-Large. The smaller BERT models are intended for environments with restricted computational resources. They can be fine-tuned in the same manner as the original BERT models. However, they are most effective in the context of knowledge distillation, where the fine-tuning labels are produced by a larger and more accurate teacher. Our goal is to enable research in institutions with fewer computational resources and encourage the community to seek directions of innovation alternative to increasing model capacity. You can download the 24 BERT miniatures either from the [official BERT Github page](https://github.com/google-research/bert/), or via HuggingFace from the links below: | |H=128|H=256|H=512|H=768| |---|:---:|:---:|:---:|:---:| | **L=2** |[**2/128 (BERT-Tiny)**][2_128]|[2/256][2_256]|[2/512][2_512]|[2/768][2_768]| | **L=4** |[4/128][4_128]|[**4/256 (BERT-Mini)**][4_256]|[**4/512 (BERT-Small)**][4_512]|[4/768][4_768]| | **L=6** |[6/128][6_128]|[6/256][6_256]|[6/512][6_512]|[6/768][6_768]| | **L=8** |[8/128][8_128]|[8/256][8_256]|[**8/512 (BERT-Medium)**][8_512]|[8/768][8_768]| | **L=10** |[10/128][10_128]|[10/256][10_256]|[10/512][10_512]|[10/768][10_768]| | **L=12** |[12/128][12_128]|[12/256][12_256]|[12/512][12_512]|[**12/768 (BERT-Base)**][12_768]| Note that the BERT-Base model in this release is included for completeness only; it was re-trained under the same regime as the original model. Here are the corresponding GLUE scores on the test set: |Model|Score|CoLA|SST-2|MRPC|STS-B|QQP|MNLI-m|MNLI-mm|QNLI(v2)|RTE|WNLI|AX| |---|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:| |BERT-Tiny|64.2|0.0|83.2|81.1/71.1|74.3/73.6|62.2/83.4|70.2|70.3|81.5|57.2|62.3|21.0| |BERT-Mini|65.8|0.0|85.9|81.1/71.8|75.4/73.3|66.4/86.2|74.8|74.3|84.1|57.9|62.3|26.1| |BERT-Small|71.2|27.8|89.7|83.4/76.2|78.8/77.0|68.1/87.0|77.6|77.0|86.4|61.8|62.3|28.6| |BERT-Medium|73.5|38.0|89.6|86.6/81.6|80.4/78.4|69.6/87.9|80.0|79.1|87.7|62.2|62.3|30.5| For each task, we selected the best fine-tuning hyperparameters from the lists below, and trained for 4 epochs: - batch sizes: 8, 16, 32, 64, 128 - learning rates: 3e-4, 1e-4, 5e-5, 3e-5 If you use these models, please cite the following paper: ``` @article{turc2019, title={Well-Read Students Learn Better: On the Importance of Pre-training Compact Models}, author={Turc, Iulia and Chang, Ming-Wei and Lee, Kenton and Toutanova, Kristina}, journal={arXiv preprint arXiv:1908.08962v2 }, year={2019} } ``` [2_128]: https://huggingface.co/google/bert_uncased_L-2_H-128_A-2 [2_256]: https://huggingface.co/google/bert_uncased_L-2_H-256_A-4 [2_512]: https://huggingface.co/google/bert_uncased_L-2_H-512_A-8 [2_768]: https://huggingface.co/google/bert_uncased_L-2_H-768_A-12 [4_128]: https://huggingface.co/google/bert_uncased_L-4_H-128_A-2 [4_256]: https://huggingface.co/google/bert_uncased_L-4_H-256_A-4 [4_512]: https://huggingface.co/google/bert_uncased_L-4_H-512_A-8 [4_768]: https://huggingface.co/google/bert_uncased_L-4_H-768_A-12 [6_128]: https://huggingface.co/google/bert_uncased_L-6_H-128_A-2 [6_256]: https://huggingface.co/google/bert_uncased_L-6_H-256_A-4 [6_512]: https://huggingface.co/google/bert_uncased_L-6_H-512_A-8 [6_768]: https://huggingface.co/google/bert_uncased_L-6_H-768_A-12 [8_128]: https://huggingface.co/google/bert_uncased_L-8_H-128_A-2 [8_256]: https://huggingface.co/google/bert_uncased_L-8_H-256_A-4 [8_512]: https://huggingface.co/google/bert_uncased_L-8_H-512_A-8 [8_768]: https://huggingface.co/google/bert_uncased_L-8_H-768_A-12 [10_128]: https://huggingface.co/google/bert_uncased_L-10_H-128_A-2 [10_256]: https://huggingface.co/google/bert_uncased_L-10_H-256_A-4 [10_512]: https://huggingface.co/google/bert_uncased_L-10_H-512_A-8 [10_768]: https://huggingface.co/google/bert_uncased_L-10_H-768_A-12 [12_128]: https://huggingface.co/google/bert_uncased_L-12_H-128_A-2 [12_256]: https://huggingface.co/google/bert_uncased_L-12_H-256_A-4 [12_512]: https://huggingface.co/google/bert_uncased_L-12_H-512_A-8 [12_768]: https://huggingface.co/google/bert_uncased_L-12_H-768_A-12

obi/deid_roberta_i2b2

obi

transformers

token-classification

--- language: - en thumbnail: "https://www.onebraveidea.org/wp-content/uploads/2019/07/OBI-Logo-Website.png" tags: - deidentification - medical notes - ehr - phi datasets: - I2B2 metrics: - F1 - Recall - Precision widget: - text: "Physician Discharge Summary Admit date: 10/12/1982 Discharge date: 10/22/1982 Patient Information Jack Reacher, 54 y.o. male (DOB = 1/21/1928)." - text: "Home Address: 123 Park Drive, San Diego, CA, 03245. Home Phone: 202-555-0199 (home)." - text: "Hospital Care Team Service: Orthopedics Inpatient Attending: Roger C Kelly, MD Attending phys phone: (634)743-5135 Discharge Unit: HCS843 Primary Care Physician: Hassan V Kim, MD 512-832-5025." license: mit --- # Model Description * A RoBERTa [[Liu et al., 2019]](https://arxiv.org/pdf/1907.11692.pdf) model fine-tuned for de-identification of medical notes. * Sequence Labeling (token classification): The model was trained to predict protected health information (PHI/PII) entities (spans). A list of protected health information categories is given by [HIPAA](https://www.hhs.gov/hipaa/for-professionals/privacy/laws-regulations/index.html). * A token can either be classified as non-PHI or as one of the 11 PHI types. Token predictions are aggregated to spans by making use of BILOU tagging. * The PHI labels that were used for training and other details can be found here: [Annotation Guidelines](https://github.com/obi-ml-public/ehr_deidentification/blob/master/AnnotationGuidelines.md) * More details on how to use this model, the format of data and other useful information is present in the GitHub repo: [Robust DeID](https://github.com/obi-ml-public/ehr_deidentification). # How to use * A demo on how the model works (using model predictions to de-identify a medical note) is on this space: [Medical-Note-Deidentification](https://huggingface.co/spaces/obi/Medical-Note-Deidentification). * Steps on how this model can be used to run a forward pass can be found here: [Forward Pass](https://github.com/obi-ml-public/ehr_deidentification/tree/master/steps/forward_pass) * In brief, the steps are: * Sentencize (the model aggregates the sentences back to the note level) and tokenize the dataset. * Use the predict function of this model to gather the predictions (i.e., predictions for each token). * Additionally, the model predictions can be used to remove PHI from the original note/text. # Dataset * The I2B2 2014 [[Stubbs and Uzuner, 2015]](https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4978170/) dataset was used to train this model. | | I2B2 | | I2B2 | | | --------- | --------------------- | ---------- | -------------------- | ---------- | | | TRAIN SET - 790 NOTES | | TEST SET - 514 NOTES | | | PHI LABEL | COUNT | PERCENTAGE | COUNT | PERCENTAGE | | DATE | 7502 | 43.69 | 4980 | 44.14 | | STAFF | 3149 | 18.34 | 2004 | 17.76 | | HOSP | 1437 | 8.37 | 875 | 7.76 | | AGE | 1233 | 7.18 | 764 | 6.77 | | LOC | 1206 | 7.02 | 856 | 7.59 | | PATIENT | 1316 | 7.66 | 879 | 7.79 | | PHONE | 317 | 1.85 | 217 | 1.92 | | ID | 881 | 5.13 | 625 | 5.54 | | PATORG | 124 | 0.72 | 82 | 0.73 | | EMAIL | 4 | 0.02 | 1 | 0.01 | | OTHERPHI | 2 | 0.01 | 0 | 0 | | TOTAL | 17171 | 100 | 11283 | 100 | # Training procedure * Steps on how this model was trained can be found here: [Training](https://github.com/obi-ml-public/ehr_deidentification/tree/master/steps/train). The "model_name_or_path" was set to: "roberta-large". * The dataset was sentencized with the en_core_sci_sm sentencizer from spacy. * The dataset was then tokenized with a custom tokenizer built on top of the en_core_sci_sm tokenizer from spacy. * For each sentence we added 32 tokens on the left (from previous sentences) and 32 tokens on the right (from the next sentences). * The added tokens are not used for learning - i.e, the loss is not computed on these tokens - they are used as additional context. * Each sequence contained a maximum of 128 tokens (including the 32 tokens added on). Longer sequences were split. * The sentencized and tokenized dataset with the token level labels based on the BILOU notation was used to train the model. * The model is fine-tuned from a pre-trained RoBERTa model. * Training details: * Input sequence length: 128 * Batch size: 32 (16 with 2 gradient accumulation steps) * Optimizer: AdamW * Learning rate: 5e-5 * Dropout: 0.1 ## Results # Questions? Post a Github issue on the repo: [Robust DeID](https://github.com/obi-ml-public/ehr_deidentification).

Salesforce/blip-image-captioning-base

Salesforce

transformers

image-to-text

--- pipeline_tag: image-to-text tags: - image-captioning languages: - en license: bsd-3-clause --- # BLIP: Bootstrapping Language-Image Pre-training for Unified Vision-Language Understanding and Generation Model card for image captioning pretrained on COCO dataset - base architecture (with ViT base backbone). |  | |:--:| | <b> Pull figure from BLIP official repo | Image source: https://github.com/salesforce/BLIP </b>| ## TL;DR Authors from the [paper](https://arxiv.org/abs/2201.12086) write in the abstract: *Vision-Language Pre-training (VLP) has advanced the performance for many vision-language tasks. However, most existing pre-trained models only excel in either understanding-based tasks or generation-based tasks. Furthermore, performance improvement has been largely achieved by scaling up the dataset with noisy image-text pairs collected from the web, which is a suboptimal source of supervision. In this paper, we propose BLIP, a new VLP framework which transfers flexibly to both vision-language understanding and generation tasks. BLIP effectively utilizes the noisy web data by bootstrapping the captions, where a captioner generates synthetic captions and a filter removes the noisy ones. We achieve state-of-the-art results on a wide range of vision-language tasks, such as image-text retrieval (+2.7% in average recall@1), image captioning (+2.8% in CIDEr), and VQA (+1.6% in VQA score). BLIP also demonstrates strong generalization ability when directly transferred to videolanguage tasks in a zero-shot manner. Code, models, and datasets are released.* ## Usage You can use this model for conditional and un-conditional image captioning ### Using the Pytorch model #### Running the model on CPU <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import BlipProcessor, BlipForConditionalGeneration processor = BlipProcessor.from_pretrained("Salesforce/blip-image-captioning-base") model = BlipForConditionalGeneration.from_pretrained("Salesforce/blip-image-captioning-base") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') # conditional image captioning text = "a photography of" inputs = processor(raw_image, text, return_tensors="pt") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) # >>> a photography of a woman and her dog # unconditional image captioning inputs = processor(raw_image, return_tensors="pt") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) >>> a woman sitting on the beach with her dog ``` </details> #### Running the model on GPU ##### In full precision <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import BlipProcessor, BlipForConditionalGeneration processor = BlipProcessor.from_pretrained("Salesforce/blip-image-captioning-base") model = BlipForConditionalGeneration.from_pretrained("Salesforce/blip-image-captioning-base").to("cuda") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') # conditional image captioning text = "a photography of" inputs = processor(raw_image, text, return_tensors="pt").to("cuda") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) # >>> a photography of a woman and her dog # unconditional image captioning inputs = processor(raw_image, return_tensors="pt").to("cuda") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) >>> a woman sitting on the beach with her dog ``` </details> ##### In half precision (`float16`) <details> <summary> Click to expand </summary> ```python import torch import requests from PIL import Image from transformers import BlipProcessor, BlipForConditionalGeneration processor = BlipProcessor.from_pretrained("Salesforce/blip-image-captioning-base") model = BlipForConditionalGeneration.from_pretrained("Salesforce/blip-image-captioning-base", torch_dtype=torch.float16).to("cuda") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') # conditional image captioning text = "a photography of" inputs = processor(raw_image, text, return_tensors="pt").to("cuda", torch.float16) out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) # >>> a photography of a woman and her dog # unconditional image captioning inputs = processor(raw_image, return_tensors="pt").to("cuda", torch.float16) out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) >>> a woman sitting on the beach with her dog ``` </details> ## BibTex and citation info ``` @misc{https://doi.org/10.48550/arxiv.2201.12086, doi = {10.48550/ARXIV.2201.12086}, url = {https://arxiv.org/abs/2201.12086}, author = {Li, Junnan and Li, Dongxu and Xiong, Caiming and Hoi, Steven}, keywords = {Computer Vision and Pattern Recognition (cs.CV), FOS: Computer and information sciences, FOS: Computer and information sciences}, title = {BLIP: Bootstrapping Language-Image Pre-training for Unified Vision-Language Understanding and Generation}, publisher = {arXiv}, year = {2022}, copyright = {Creative Commons Attribution 4.0 International} } ```

google-bert/bert-large-uncased

google-bert

transformers

fill-mask

--- language: en license: apache-2.0 datasets: - bookcorpus - wikipedia --- # BERT large model (uncased) Pretrained model on English language using a masked language modeling (MLM) objective. It was introduced in [this paper](https://arxiv.org/abs/1810.04805) and first released in [this repository](https://github.com/google-research/bert). This model is uncased: it does not make a difference between english and English. Disclaimer: The team releasing BERT did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description BERT is a transformers model pretrained on a large corpus of English data in a self-supervised fashion. This means it was pretrained on the raw texts only, with no humans labelling them in any way (which is why it can use lots of publicly available data) with an automatic process to generate inputs and labels from those texts. More precisely, it was pretrained with two objectives: - Masked language modeling (MLM): taking a sentence, the model randomly masks 15% of the words in the input then run the entire masked sentence through the model and has to predict the masked words. This is different from traditional recurrent neural networks (RNNs) that usually see the words one after the other, or from autoregressive models like GPT which internally mask the future tokens. It allows the model to learn a bidirectional representation of the sentence. - Next sentence prediction (NSP): the models concatenates two masked sentences as inputs during pretraining. Sometimes they correspond to sentences that were next to each other in the original text, sometimes not. The model then has to predict if the two sentences were following each other or not. This way, the model learns an inner representation of the English language that can then be used to extract features useful for downstream tasks: if you have a dataset of labeled sentences for instance, you can train a standard classifier using the features produced by the BERT model as inputs. This model has the following configuration: - 24-layer - 1024 hidden dimension - 16 attention heads - 336M parameters. ## Intended uses & limitations You can use the raw model for either masked language modeling or next sentence prediction, but it's mostly intended to be fine-tuned on a downstream task. See the [model hub](https://huggingface.co/models?filter=bert) to look for fine-tuned versions on a task that interests you. Note that this model is primarily aimed at being fine-tuned on tasks that use the whole sentence (potentially masked) to make decisions, such as sequence classification, token classification or question answering. For tasks such as text generation you should look at model like GPT2. ### How to use You can use this model directly with a pipeline for masked language modeling: ```python >>> from transformers import pipeline >>> unmasker = pipeline('fill-mask', model='bert-large-uncased') >>> unmasker("Hello I'm a [MASK] model.") [{'sequence': "[CLS] hello i'm a fashion model. [SEP]", 'score': 0.1886913776397705, 'token': 4827, 'token_str': 'fashion'}, {'sequence': "[CLS] hello i'm a professional model. [SEP]", 'score': 0.07157472521066666, 'token': 2658, 'token_str': 'professional'}, {'sequence': "[CLS] hello i'm a male model. [SEP]", 'score': 0.04053466394543648, 'token': 3287, 'token_str': 'male'}, {'sequence': "[CLS] hello i'm a role model. [SEP]", 'score': 0.03891477733850479, 'token': 2535, 'token_str': 'role'}, {'sequence': "[CLS] hello i'm a fitness model. [SEP]", 'score': 0.03038121573626995, 'token': 10516, 'token_str': 'fitness'}] ``` Here is how to use this model to get the features of a given text in PyTorch: ```python from transformers import BertTokenizer, BertModel tokenizer = BertTokenizer.from_pretrained('bert-large-uncased') model = BertModel.from_pretrained("bert-large-uncased") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='pt') output = model(**encoded_input) ``` and in TensorFlow: ```python from transformers import BertTokenizer, TFBertModel tokenizer = BertTokenizer.from_pretrained('bert-large-uncased') model = TFBertModel.from_pretrained("bert-large-uncased") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='tf') output = model(encoded_input) ``` ### Limitations and bias Even if the training data used for this model could be characterized as fairly neutral, this model can have biased predictions: ```python >>> from transformers import pipeline >>> unmasker = pipeline('fill-mask', model='bert-large-uncased') >>> unmasker("The man worked as a [MASK].") [{'sequence': '[CLS] the man worked as a bartender. [SEP]', 'score': 0.10426565259695053, 'token': 15812, 'token_str': 'bartender'}, {'sequence': '[CLS] the man worked as a waiter. [SEP]', 'score': 0.10232779383659363, 'token': 15610, 'token_str': 'waiter'}, {'sequence': '[CLS] the man worked as a mechanic. [SEP]', 'score': 0.06281787157058716, 'token': 15893, 'token_str': 'mechanic'}, {'sequence': '[CLS] the man worked as a lawyer. [SEP]', 'score': 0.050936125218868256, 'token': 5160, 'token_str': 'lawyer'}, {'sequence': '[CLS] the man worked as a carpenter. [SEP]', 'score': 0.041034240275621414, 'token': 10533, 'token_str': 'carpenter'}] >>> unmasker("The woman worked as a [MASK].") [{'sequence': '[CLS] the woman worked as a waitress. [SEP]', 'score': 0.28473711013793945, 'token': 13877, 'token_str': 'waitress'}, {'sequence': '[CLS] the woman worked as a nurse. [SEP]', 'score': 0.11336520314216614, 'token': 6821, 'token_str': 'nurse'}, {'sequence': '[CLS] the woman worked as a bartender. [SEP]', 'score': 0.09574324637651443, 'token': 15812, 'token_str': 'bartender'}, {'sequence': '[CLS] the woman worked as a maid. [SEP]', 'score': 0.06351090222597122, 'token': 10850, 'token_str': 'maid'}, {'sequence': '[CLS] the woman worked as a secretary. [SEP]', 'score': 0.048970773816108704, 'token': 3187, 'token_str': 'secretary'}] ``` This bias will also affect all fine-tuned versions of this model. ## Training data The BERT model was pretrained on [BookCorpus](https://yknzhu.wixsite.com/mbweb), a dataset consisting of 11,038 unpublished books and [English Wikipedia](https://en.wikipedia.org/wiki/English_Wikipedia) (excluding lists, tables and headers). ## Training procedure ### Preprocessing The texts are lowercased and tokenized using WordPiece and a vocabulary size of 30,000. The inputs of the model are then of the form: ``` [CLS] Sentence A [SEP] Sentence B [SEP] ``` With probability 0.5, sentence A and sentence B correspond to two consecutive sentences in the original corpus and in the other cases, it's another random sentence in the corpus. Note that what is considered a sentence here is a consecutive span of text usually longer than a single sentence. The only constrain is that the result with the two "sentences" has a combined length of less than 512 tokens. The details of the masking procedure for each sentence are the following: - 15% of the tokens are masked. - In 80% of the cases, the masked tokens are replaced by `[MASK]`. - In 10% of the cases, the masked tokens are replaced by a random token (different) from the one they replace. - In the 10% remaining cases, the masked tokens are left as is. ### Pretraining The model was trained on 4 cloud TPUs in Pod configuration (16 TPU chips total) for one million steps with a batch size of 256. The sequence length was limited to 128 tokens for 90% of the steps and 512 for the remaining 10%. The optimizer used is Adam with a learning rate of 1e-4, \\(\beta_{1} = 0.9\\) and \\(\beta_{2} = 0.999\\), a weight decay of 0.01, learning rate warmup for 10,000 steps and linear decay of the learning rate after. ## Evaluation results When fine-tuned on downstream tasks, this model achieves the following results: Model | SQUAD 1.1 F1/EM | Multi NLI Accuracy ---------------------------------------- | :-------------: | :----------------: BERT-Large, Uncased (Original) | 91.0/84.3 | 86.05 ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-1810-04805, author = {Jacob Devlin and Ming{-}Wei Chang and Kenton Lee and Kristina Toutanova}, title = {{BERT:} Pre-training of Deep Bidirectional Transformers for Language Understanding}, journal = {CoRR}, volume = {abs/1810.04805}, year = {2018}, url = {http://arxiv.org/abs/1810.04805}, archivePrefix = {arXiv}, eprint = {1810.04805}, timestamp = {Tue, 30 Oct 2018 20:39:56 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1810-04805.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

marieke93/MiniLM-evidence-types

marieke93

transformers

text-classification

--- license: mit tags: - generated_from_trainer metrics: - accuracy model-index: - name: MiniLM-evidence-types results: [] --- <!-- This model card has been generated automatically according to the information the Trainer had access to. You should probably proofread and complete it, then remove this comment. --> # MiniLM-evidence-types This model is a fine-tuned version of [microsoft/MiniLM-L12-H384-uncased](https://huggingface.co/microsoft/MiniLM-L12-H384-uncased) on the evidence types dataset. It achieved the following results on the evaluation set: - Loss: 1.8672 - Macro f1: 0.3726 - Weighted f1: 0.7030 - Accuracy: 0.7161 - Balanced accuracy: 0.3616 ## Training and evaluation data The data set, as well as the code that was used to fine tune this model can be found in the GitHub repository [BA-Thesis-Information-Science-Persuasion-Strategies](https://github.com/mariekevdh/BA-Thesis-Information-Science-Persuasion-Strategies) ### Training hyperparameters The following hyperparameters were used during training: - learning_rate: 2e-05 - train_batch_size: 16 - eval_batch_size: 16 - seed: 42 - optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 - lr_scheduler_type: linear - num_epochs: 20 - mixed_precision_training: Native AMP ### Training results | Training Loss | Epoch | Step | Validation Loss | Macro f1 | Weighted f1 | Accuracy | Balanced accuracy | |:-------------:|:-----:|:----:|:---------------:|:--------:|:-----------:|:--------:|:-----------------:| | 1.4106 | 1.0 | 250 | 1.2698 | 0.1966 | 0.6084 | 0.6735 | 0.2195 | | 1.1437 | 2.0 | 500 | 1.0985 | 0.3484 | 0.6914 | 0.7116 | 0.3536 | | 0.9714 | 3.0 | 750 | 1.0901 | 0.2606 | 0.6413 | 0.6446 | 0.2932 | | 0.8382 | 4.0 | 1000 | 1.0197 | 0.2764 | 0.7024 | 0.7237 | 0.2783 | | 0.7192 | 5.0 | 1250 | 1.0895 | 0.2847 | 0.6824 | 0.6963 | 0.2915 | | 0.6249 | 6.0 | 1500 | 1.1296 | 0.3487 | 0.6888 | 0.6948 | 0.3377 | | 0.5336 | 7.0 | 1750 | 1.1515 | 0.3591 | 0.6982 | 0.7024 | 0.3496 | | 0.4694 | 8.0 | 2000 | 1.1962 | 0.3626 | 0.7185 | 0.7314 | 0.3415 | | 0.4058 | 9.0 | 2250 | 1.3313 | 0.3121 | 0.6920 | 0.7085 | 0.3033 | | 0.3746 | 10.0 | 2500 | 1.3993 | 0.3628 | 0.6976 | 0.7047 | 0.3495 | | 0.3267 | 11.0 | 2750 | 1.5078 | 0.3560 | 0.6958 | 0.7055 | 0.3464 | | 0.2939 | 12.0 | 3000 | 1.5875 | 0.3685 | 0.6968 | 0.7062 | 0.3514 | | 0.2677 | 13.0 | 3250 | 1.6470 | 0.3606 | 0.6976 | 0.7070 | 0.3490 | | 0.2425 | 14.0 | 3500 | 1.7164 | 0.3714 | 0.7069 | 0.7207 | 0.3551 | | 0.2301 | 15.0 | 3750 | 1.8151 | 0.3597 | 0.6975 | 0.7123 | 0.3466 | | 0.2268 | 16.0 | 4000 | 1.7838 | 0.3940 | 0.7034 | 0.7123 | 0.3869 | | 0.201 | 17.0 | 4250 | 1.8328 | 0.3725 | 0.6964 | 0.7062 | 0.3704 | | 0.1923 | 18.0 | 4500 | 1.8788 | 0.3708 | 0.7019 | 0.7154 | 0.3591 | | 0.1795 | 19.0 | 4750 | 1.8574 | 0.3752 | 0.7031 | 0.7161 | 0.3619 | | 0.1713 | 20.0 | 5000 | 1.8672 | 0.3726 | 0.7030 | 0.7161 | 0.3616 | ### Framework versions - Transformers 4.19.2 - Pytorch 1.11.0+cu113 - Datasets 2.2.2 - Tokenizers 0.12.1

tiiuae/falcon-40b-instruct

tiiuae

transformers

text-generation

--- datasets: - tiiuae/falcon-refinedweb language: - en inference: false license: apache-2.0 --- # ✨ Falcon-40B-Instruct **Falcon-40B-Instruct is a 40B parameters causal decoder-only model built by [TII](https://www.tii.ae) based on [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b) and finetuned on a mixture of [Baize](https://github.com/project-baize/baize-chatbot). It is made available under the Apache 2.0 license.** *Paper coming soon 😊.* 🤗 To get started with Falcon (inference, finetuning, quantization, etc.), we recommend reading [this great blogpost fron HF](https://huggingface.co/blog/falcon)! ## Why use Falcon-40B-Instruct? * **You are looking for a ready-to-use chat/instruct model based on [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b).** * **Falcon-40B is the best open-source model available.** It outperforms [LLaMA](https://github.com/facebookresearch/llama), [StableLM](https://github.com/Stability-AI/StableLM), [RedPajama](https://huggingface.co/togethercomputer/RedPajama-INCITE-Base-7B-v0.1), [MPT](https://huggingface.co/mosaicml/mpt-7b), etc. See the [OpenLLM Leaderboard](https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard). * **It features an architecture optimized for inference**, with FlashAttention ([Dao et al., 2022](https://arxiv.org/abs/2205.14135)) and multiquery ([Shazeer et al., 2019](https://arxiv.org/abs/1911.02150)). 💬 **This is an instruct model, which may not be ideal for further finetuning.** If you are interested in building your own instruct/chat model, we recommend starting from [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b). 💸 **Looking for a smaller, less expensive model?** [Falcon-7B-Instruct](https://huggingface.co/tiiuae/falcon-7b-instruct) is Falcon-40B-Instruct's little brother! ```python from transformers import AutoTokenizer, AutoModelForCausalLM import transformers import torch model = "tiiuae/falcon-40b-instruct" tokenizer = AutoTokenizer.from_pretrained(model) pipeline = transformers.pipeline( "text-generation", model=model, tokenizer=tokenizer, torch_dtype=torch.bfloat16, trust_remote_code=True, device_map="auto", ) sequences = pipeline( "Girafatron is obsessed with giraffes, the most glorious animal on the face of this Earth. Giraftron believes all other animals are irrelevant when compared to the glorious majesty of the giraffe.\nDaniel: Hello, Girafatron!\nGirafatron:", max_length=200, do_sample=True, top_k=10, num_return_sequences=1, eos_token_id=tokenizer.eos_token_id, ) for seq in sequences: print(f"Result: {seq['generated_text']}") ``` For fast inference with Falcon, check-out [Text Generation Inference](https://github.com/huggingface/text-generation-inference)! Read more in this [blogpost]((https://huggingface.co/blog/falcon). You will need **at least 85-100GB of memory** to swiftly run inference with Falcon-40B. # Model Card for Falcon-40B-Instruct ## Model Details ### Model Description - **Developed by:** [https://www.tii.ae](https://www.tii.ae); - **Model type:** Causal decoder-only; - **Language(s) (NLP):** English and French; - **License:** Apache 2.0; - **Finetuned from model:** [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b). ### Model Source - **Paper:** *coming soon*. ## Uses ### Direct Use Falcon-40B-Instruct has been finetuned on a chat dataset. ### Out-of-Scope Use Production use without adequate assessment of risks and mitigation; any use cases which may be considered irresponsible or harmful. ## Bias, Risks, and Limitations Falcon-40B-Instruct is mostly trained on English data, and will not generalize appropriately to other languages. Furthermore, as it is trained on a large-scale corpora representative of the web, it will carry the stereotypes and biases commonly encountered online. ### Recommendations We recommend users of Falcon-40B-Instruct to develop guardrails and to take appropriate precautions for any production use. ## How to Get Started with the Model ```python from transformers import AutoTokenizer, AutoModelForCausalLM import transformers import torch model = "tiiuae/falcon-40b-instruct" tokenizer = AutoTokenizer.from_pretrained(model) pipeline = transformers.pipeline( "text-generation", model=model, tokenizer=tokenizer, torch_dtype=torch.bfloat16, trust_remote_code=True, device_map="auto", ) sequences = pipeline( "Girafatron is obsessed with giraffes, the most glorious animal on the face of this Earth. Giraftron believes all other animals are irrelevant when compared to the glorious majesty of the giraffe.\nDaniel: Hello, Girafatron!\nGirafatron:", max_length=200, do_sample=True, top_k=10, num_return_sequences=1, eos_token_id=tokenizer.eos_token_id, ) for seq in sequences: print(f"Result: {seq['generated_text']}") ``` ## Training Details ### Training Data Falcon-40B-Instruct was finetuned on a 150M tokens from [Bai ze](https://github.com/project-baize/baize-chatbot) mixed with 5% of [RefinedWeb](https://huggingface.co/datasets/tiiuae/falcon-refinedweb) data. The data was tokenized with the Falcon-[7B](https://huggingface.co/tiiuae/falcon-7b)/[40B](https://huggingface.co/tiiuae/falcon-40b) tokenizer. ## Evaluation *Paper coming soon.* See the [OpenLLM Leaderboard](https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard) for early results. ## Technical Specifications For more information about pretraining, see [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b). ### Model Architecture and Objective Falcon-40B is a causal decoder-only model trained on a causal language modeling task (i.e., predict the next token). The architecture is broadly adapted from the GPT-3 paper ([Brown et al., 2020](https://arxiv.org/abs/2005.14165)), with the following differences: * **Positionnal embeddings:** rotary ([Su et al., 2021](https://arxiv.org/abs/2104.09864)); * **Attention:** multiquery ([Shazeer et al., 2019](https://arxiv.org/abs/1911.02150)) and FlashAttention ([Dao et al., 2022](https://arxiv.org/abs/2205.14135)); * **Decoder-block:** parallel attention/MLP with a single layer norm. For multiquery, we are using an internal variant which uses independent key and values per tensor parallel degree. | **Hyperparameter** | **Value** | **Comment** | |--------------------|-----------|----------------------------------------| | Layers | 60 | | | `d_model` | 8192 | | | `head_dim` | 64 | Reduced to optimise for FlashAttention | | Vocabulary | 65024 | | | Sequence length | 2048 | | ### Compute Infrastructure #### Hardware Falcon-40B-Instruct was trained on AWS SageMaker, on 64 A100 40GB GPUs in P4d instances. #### Software Falcon-40B-Instruct was trained a custom distributed training codebase, Gigatron. It uses a 3D parallelism approach combined with ZeRO and high-performance Triton kernels (FlashAttention, etc.) ## Citation *Paper coming soon* 😊. In the meanwhile, you can use the following information to cite: ``` @article{falcon40b, title={{Falcon-40B}: an open large language model with state-of-the-art performance}, author={Almazrouei, Ebtesam and Alobeidli, Hamza and Alshamsi, Abdulaziz and Cappelli, Alessandro and Cojocaru, Ruxandra and Debbah, Merouane and Goffinet, Etienne and Heslow, Daniel and Launay, Julien and Malartic, Quentin and Noune, Badreddine and Pannier, Baptiste and Penedo, Guilherme}, year={2023} } ``` To learn more about the pretraining dataset, see the 📓 [RefinedWeb paper](https://arxiv.org/abs/2306.01116). ``` @article{refinedweb, title={The {R}efined{W}eb dataset for {F}alcon {LLM}: outperforming curated corpora with web data, and web data only}, author={Guilherme Penedo and Quentin Malartic and Daniel Hesslow and Ruxandra Cojocaru and Alessandro Cappelli and Hamza Alobeidli and Baptiste Pannier and Ebtesam Almazrouei and Julien Launay}, journal={arXiv preprint arXiv:2306.01116}, eprint={2306.01116}, eprinttype = {arXiv}, url={https://arxiv.org/abs/2306.01116}, year={2023} } ``` To cite the [Baize](https://github.com/project-baize/baize-chatbot) instruction dataset used for this model: ``` @article{xu2023baize, title={Baize: An Open-Source Chat Model with Parameter-Efficient Tuning on Self-Chat Data}, author={Xu, Canwen and Guo, Daya and Duan, Nan and McAuley, Julian}, journal={arXiv preprint arXiv:2304.01196}, year={2023} } ``` ## License Falcon-40B-Instruct is made available under the Apache 2.0 license. ## Contact falconllm@tii.ae

knowledgator/IUPAC2SMILES-canonical-base

knowledgator

transformers

text2text-generation

--- license: apache-2.0 metrics: - accuracy - bleu pipeline_tag: text2text-generation tags: - chemistry - biology - medical - smiles - iupac - text-generation-inference widget: - text: ethanol example_title: CCO --- # IUPAC2SMILES-canonical-base IUPAC2SMILES-canonical-base was designed to accurately translate IUPAC chemical names to SMILES. ## Model Details ### Model Description IUPAC2SMILES-canonical-base is based on the MT5 model with optimizations in implementing different tokenizers for the encoder and decoder. - **Developed by:** Knowladgator Engineering - **Model type:** Encoder-Decoder with attention mechanism - **Language(s) (NLP):** SMILES, IUPAC (English) - **License:** Apache License 2.0 ### Model Sources - **Paper:** coming soon - **Demo:** [ChemicalConverters](https://huggingface.co/spaces/knowledgator/ChemicalConverters) ## Quickstart Firstly, install the library: ```commandline pip install chemical-converters ``` ### IUPAC to SMILES #### To perform simple translation, follow the example: ```python from chemicalconverters import NamesConverter converter = NamesConverter(model_name="knowledgator/IUPAC2SMILES-canonical-base") print(converter.iupac_to_smiles('ethanol')) print(converter.iupac_to_smiles(['ethanol', 'ethanol', 'ethanol'])) ``` ```text ['CCO'] ['CCO', 'CCO', 'CCO'] ``` #### Processing in batches: ```python from chemicalconverters import NamesConverter converter = NamesConverter(model_name="knowledgator/IUPAC2SMILES-canonical-base") print(converter.iupac_to_smiles(["buta-1,3-diene" for _ in range(10)], num_beams=1, process_in_batch=True, batch_size=1000)) ``` ```text ['<SYST>C=CC=C', '<SYST>C=CC=C'...] ``` Our models also predict IUPAC styles from the table: | Style Token | Description | |-------------|----------------------------------------------------------------------------------------------------| | `<BASE>` | The most known name of the substance, sometimes is the mixture of traditional and systematic style | | `<SYST>` | The totally systematic style without trivial names | | `<TRAD>` | The style is based on trivial names of the parts of substances | ## Bias, Risks, and Limitations This model has limited accuracy in processing large molecules and currently, doesn't support isomeric and isotopic SMILES. ### Training Procedure <!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. --> The model was trained on 100M examples of SMILES-IUPAC pairs with lr=0.00001, batch_size=512 for 2 epochs. ## Evaluation | Model | Accuracy | BLEU-4 score | Size(MB) | |-------------------------------------|---------|------------------|----------| | IUPAC2SMILES-canonical-small |88.9% |0.966 |23 | | IUPAC2SMILES-canonical-base |93.7% |0.974 |180 | | STOUT V2.0\* |68.47% |0.92 |128 | *According to the original paper https://jcheminf.biomedcentral.com/articles/10.1186/s13321-021-00512-4 ## Citation Coming soon. ## Model Card Authors [Mykhailo Shtopko](https://huggingface.co/BioMike) ## Model Card Contact info@knowledgator.com

BAAI/bge-large-en-v1.5

BAAI

sentence-transformers

feature-extraction

--- tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers - mteb model-index: - name: bge-large-en-v1.5 results: - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en) config: en split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 75.8507462686567 - type: ap value: 38.566457320228245 - type: f1 value: 69.69386648043475 - task: type: Classification dataset: type: mteb/amazon_polarity name: MTEB AmazonPolarityClassification config: default split: test revision: e2d317d38cd51312af73b3d32a06d1a08b442046 metrics: - type: accuracy value: 92.416675 - type: ap value: 89.1928861155922 - type: f1 value: 92.39477019574215 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (en) config: en split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 48.175999999999995 - type: f1 value: 47.80712792870253 - task: type: Retrieval dataset: type: arguana name: MTEB ArguAna config: default split: test revision: None metrics: - type: map_at_1 value: 40.184999999999995 - type: map_at_10 value: 55.654 - type: map_at_100 value: 56.25 - type: map_at_1000 value: 56.255 - type: map_at_3 value: 51.742999999999995 - type: map_at_5 value: 54.129000000000005 - type: mrr_at_1 value: 40.967 - type: mrr_at_10 value: 55.96 - type: mrr_at_100 value: 56.54900000000001 - type: mrr_at_1000 value: 56.554 - type: mrr_at_3 value: 51.980000000000004 - type: mrr_at_5 value: 54.44 - type: ndcg_at_1 value: 40.184999999999995 - type: ndcg_at_10 value: 63.542 - type: ndcg_at_100 value: 65.96499999999999 - type: ndcg_at_1000 value: 66.08699999999999 - type: ndcg_at_3 value: 55.582 - type: ndcg_at_5 value: 59.855000000000004 - type: precision_at_1 value: 40.184999999999995 - type: precision_at_10 value: 8.841000000000001 - type: precision_at_100 value: 0.987 - type: precision_at_1000 value: 0.1 - type: precision_at_3 value: 22.238 - type: precision_at_5 value: 15.405 - type: recall_at_1 value: 40.184999999999995 - type: recall_at_10 value: 88.407 - type: recall_at_100 value: 98.72 - type: recall_at_1000 value: 99.644 - type: recall_at_3 value: 66.714 - type: recall_at_5 value: 77.027 - task: type: Clustering dataset: type: mteb/arxiv-clustering-p2p name: MTEB ArxivClusteringP2P config: default split: test revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d metrics: - type: v_measure value: 48.567077926750066 - task: type: Clustering dataset: type: mteb/arxiv-clustering-s2s name: MTEB ArxivClusteringS2S config: default split: test revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 metrics: - type: v_measure value: 43.19453389182364 - task: type: Reranking dataset: type: mteb/askubuntudupquestions-reranking name: MTEB AskUbuntuDupQuestions config: default split: test revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 metrics: - type: map value: 64.46555939623092 - type: mrr value: 77.82361605768807 - task: type: STS dataset: type: mteb/biosses-sts name: MTEB BIOSSES config: default split: test revision: d3fb88f8f02e40887cd149695127462bbcf29b4a metrics: - type: cos_sim_pearson value: 84.9554128814735 - type: cos_sim_spearman value: 84.65373612172036 - type: euclidean_pearson value: 83.2905059954138 - type: euclidean_spearman value: 84.52240782811128 - type: manhattan_pearson value: 82.99533802997436 - type: manhattan_spearman value: 84.20673798475734 - task: type: Classification dataset: type: mteb/banking77 name: MTEB Banking77Classification config: default split: test revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 metrics: - type: accuracy value: 87.78896103896103 - type: f1 value: 87.77189310964883 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-p2p name: MTEB BiorxivClusteringP2P config: default split: test revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 metrics: - type: v_measure value: 39.714538337650495 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-s2s name: MTEB BiorxivClusteringS2S config: default split: test revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 metrics: - type: v_measure value: 36.90108349284447 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackAndroidRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 32.795 - type: map_at_10 value: 43.669000000000004 - type: map_at_100 value: 45.151 - type: map_at_1000 value: 45.278 - type: map_at_3 value: 40.006 - type: map_at_5 value: 42.059999999999995 - type: mrr_at_1 value: 39.771 - type: mrr_at_10 value: 49.826 - type: mrr_at_100 value: 50.504000000000005 - type: mrr_at_1000 value: 50.549 - type: mrr_at_3 value: 47.115 - type: mrr_at_5 value: 48.832 - type: ndcg_at_1 value: 39.771 - type: ndcg_at_10 value: 50.217999999999996 - type: ndcg_at_100 value: 55.454 - type: ndcg_at_1000 value: 57.37 - type: ndcg_at_3 value: 44.885000000000005 - type: ndcg_at_5 value: 47.419 - type: precision_at_1 value: 39.771 - type: precision_at_10 value: 9.642000000000001 - type: precision_at_100 value: 1.538 - type: precision_at_1000 value: 0.198 - type: precision_at_3 value: 21.268 - type: precision_at_5 value: 15.536 - type: recall_at_1 value: 32.795 - type: recall_at_10 value: 62.580999999999996 - type: recall_at_100 value: 84.438 - type: recall_at_1000 value: 96.492 - type: recall_at_3 value: 47.071000000000005 - type: recall_at_5 value: 54.079 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackEnglishRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 32.671 - type: map_at_10 value: 43.334 - type: map_at_100 value: 44.566 - type: map_at_1000 value: 44.702999999999996 - type: map_at_3 value: 40.343 - type: map_at_5 value: 41.983 - type: mrr_at_1 value: 40.764 - type: mrr_at_10 value: 49.382 - type: mrr_at_100 value: 49.988 - type: mrr_at_1000 value: 50.03300000000001 - type: mrr_at_3 value: 47.293 - type: mrr_at_5 value: 48.51 - type: ndcg_at_1 value: 40.764 - type: ndcg_at_10 value: 49.039 - type: ndcg_at_100 value: 53.259 - type: ndcg_at_1000 value: 55.253 - type: ndcg_at_3 value: 45.091 - type: ndcg_at_5 value: 46.839999999999996 - type: precision_at_1 value: 40.764 - type: precision_at_10 value: 9.191 - type: precision_at_100 value: 1.476 - type: precision_at_1000 value: 0.19499999999999998 - type: precision_at_3 value: 21.72 - type: precision_at_5 value: 15.299 - type: recall_at_1 value: 32.671 - type: recall_at_10 value: 58.816 - type: recall_at_100 value: 76.654 - type: recall_at_1000 value: 89.05999999999999 - type: recall_at_3 value: 46.743 - type: recall_at_5 value: 51.783 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGamingRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 40.328 - type: map_at_10 value: 53.32599999999999 - type: map_at_100 value: 54.37499999999999 - type: map_at_1000 value: 54.429 - type: map_at_3 value: 49.902 - type: map_at_5 value: 52.002 - type: mrr_at_1 value: 46.332 - type: mrr_at_10 value: 56.858 - type: mrr_at_100 value: 57.522 - type: mrr_at_1000 value: 57.54899999999999 - type: mrr_at_3 value: 54.472 - type: mrr_at_5 value: 55.996 - type: ndcg_at_1 value: 46.332 - type: ndcg_at_10 value: 59.313 - type: ndcg_at_100 value: 63.266999999999996 - type: ndcg_at_1000 value: 64.36 - type: ndcg_at_3 value: 53.815000000000005 - type: ndcg_at_5 value: 56.814 - type: precision_at_1 value: 46.332 - type: precision_at_10 value: 9.53 - type: precision_at_100 value: 1.238 - type: precision_at_1000 value: 0.13699999999999998 - type: precision_at_3 value: 24.054000000000002 - type: precision_at_5 value: 16.589000000000002 - type: recall_at_1 value: 40.328 - type: recall_at_10 value: 73.421 - type: recall_at_100 value: 90.059 - type: recall_at_1000 value: 97.81 - type: recall_at_3 value: 59.009 - type: recall_at_5 value: 66.352 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGisRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.424 - type: map_at_10 value: 36.332 - type: map_at_100 value: 37.347 - type: map_at_1000 value: 37.422 - type: map_at_3 value: 33.743 - type: map_at_5 value: 35.176 - type: mrr_at_1 value: 29.153000000000002 - type: mrr_at_10 value: 38.233 - type: mrr_at_100 value: 39.109 - type: mrr_at_1000 value: 39.164 - type: mrr_at_3 value: 35.876000000000005 - type: mrr_at_5 value: 37.169000000000004 - type: ndcg_at_1 value: 29.153000000000002 - type: ndcg_at_10 value: 41.439 - type: ndcg_at_100 value: 46.42 - type: ndcg_at_1000 value: 48.242000000000004 - type: ndcg_at_3 value: 36.362 - type: ndcg_at_5 value: 38.743 - type: precision_at_1 value: 29.153000000000002 - type: precision_at_10 value: 6.315999999999999 - type: precision_at_100 value: 0.927 - type: precision_at_1000 value: 0.11199999999999999 - type: precision_at_3 value: 15.443000000000001 - type: precision_at_5 value: 10.644 - type: recall_at_1 value: 27.424 - type: recall_at_10 value: 55.364000000000004 - type: recall_at_100 value: 78.211 - type: recall_at_1000 value: 91.74600000000001 - type: recall_at_3 value: 41.379 - type: recall_at_5 value: 47.14 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackMathematicaRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 19.601 - type: map_at_10 value: 27.826 - type: map_at_100 value: 29.017 - type: map_at_1000 value: 29.137 - type: map_at_3 value: 25.125999999999998 - type: map_at_5 value: 26.765 - type: mrr_at_1 value: 24.005000000000003 - type: mrr_at_10 value: 32.716 - type: mrr_at_100 value: 33.631 - type: mrr_at_1000 value: 33.694 - type: mrr_at_3 value: 29.934 - type: mrr_at_5 value: 31.630999999999997 - type: ndcg_at_1 value: 24.005000000000003 - type: ndcg_at_10 value: 33.158 - type: ndcg_at_100 value: 38.739000000000004 - type: ndcg_at_1000 value: 41.495 - type: ndcg_at_3 value: 28.185 - type: ndcg_at_5 value: 30.796 - type: precision_at_1 value: 24.005000000000003 - type: precision_at_10 value: 5.908 - type: precision_at_100 value: 1.005 - type: precision_at_1000 value: 0.13899999999999998 - type: precision_at_3 value: 13.391 - type: precision_at_5 value: 9.876 - type: recall_at_1 value: 19.601 - type: recall_at_10 value: 44.746 - type: recall_at_100 value: 68.82300000000001 - type: recall_at_1000 value: 88.215 - type: recall_at_3 value: 31.239 - type: recall_at_5 value: 37.695 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackPhysicsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 30.130000000000003 - type: map_at_10 value: 40.96 - type: map_at_100 value: 42.282 - type: map_at_1000 value: 42.392 - type: map_at_3 value: 37.889 - type: map_at_5 value: 39.661 - type: mrr_at_1 value: 36.958999999999996 - type: mrr_at_10 value: 46.835 - type: mrr_at_100 value: 47.644 - type: mrr_at_1000 value: 47.688 - type: mrr_at_3 value: 44.562000000000005 - type: mrr_at_5 value: 45.938 - type: ndcg_at_1 value: 36.958999999999996 - type: ndcg_at_10 value: 47.06 - type: ndcg_at_100 value: 52.345 - type: ndcg_at_1000 value: 54.35 - type: ndcg_at_3 value: 42.301 - type: ndcg_at_5 value: 44.635999999999996 - type: precision_at_1 value: 36.958999999999996 - type: precision_at_10 value: 8.479000000000001 - type: precision_at_100 value: 1.284 - type: precision_at_1000 value: 0.163 - type: precision_at_3 value: 20.244 - type: precision_at_5 value: 14.224999999999998 - type: recall_at_1 value: 30.130000000000003 - type: recall_at_10 value: 59.27 - type: recall_at_100 value: 81.195 - type: recall_at_1000 value: 94.21199999999999 - type: recall_at_3 value: 45.885 - type: recall_at_5 value: 52.016 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackProgrammersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 26.169999999999998 - type: map_at_10 value: 36.451 - type: map_at_100 value: 37.791000000000004 - type: map_at_1000 value: 37.897 - type: map_at_3 value: 33.109 - type: map_at_5 value: 34.937000000000005 - type: mrr_at_1 value: 32.877 - type: mrr_at_10 value: 42.368 - type: mrr_at_100 value: 43.201 - type: mrr_at_1000 value: 43.259 - type: mrr_at_3 value: 39.763999999999996 - type: mrr_at_5 value: 41.260000000000005 - type: ndcg_at_1 value: 32.877 - type: ndcg_at_10 value: 42.659000000000006 - type: ndcg_at_100 value: 48.161 - type: ndcg_at_1000 value: 50.345 - type: ndcg_at_3 value: 37.302 - type: ndcg_at_5 value: 39.722 - type: precision_at_1 value: 32.877 - type: precision_at_10 value: 7.9 - type: precision_at_100 value: 1.236 - type: precision_at_1000 value: 0.158 - type: precision_at_3 value: 17.846 - type: precision_at_5 value: 12.9 - type: recall_at_1 value: 26.169999999999998 - type: recall_at_10 value: 55.35 - type: recall_at_100 value: 78.755 - type: recall_at_1000 value: 93.518 - type: recall_at_3 value: 40.176 - type: recall_at_5 value: 46.589000000000006 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.15516666666667 - type: map_at_10 value: 36.65741666666667 - type: map_at_100 value: 37.84991666666666 - type: map_at_1000 value: 37.96316666666667 - type: map_at_3 value: 33.74974999999999 - type: map_at_5 value: 35.3765 - type: mrr_at_1 value: 32.08233333333334 - type: mrr_at_10 value: 41.033833333333334 - type: mrr_at_100 value: 41.84524999999999 - type: mrr_at_1000 value: 41.89983333333333 - type: mrr_at_3 value: 38.62008333333333 - type: mrr_at_5 value: 40.03441666666666 - type: ndcg_at_1 value: 32.08233333333334 - type: ndcg_at_10 value: 42.229 - type: ndcg_at_100 value: 47.26716666666667 - type: ndcg_at_1000 value: 49.43466666666667 - type: ndcg_at_3 value: 37.36408333333333 - type: ndcg_at_5 value: 39.6715 - type: precision_at_1 value: 32.08233333333334 - type: precision_at_10 value: 7.382583333333334 - type: precision_at_100 value: 1.16625 - type: precision_at_1000 value: 0.15408333333333332 - type: precision_at_3 value: 17.218 - type: precision_at_5 value: 12.21875 - type: recall_at_1 value: 27.15516666666667 - type: recall_at_10 value: 54.36683333333333 - type: recall_at_100 value: 76.37183333333333 - type: recall_at_1000 value: 91.26183333333333 - type: recall_at_3 value: 40.769916666666674 - type: recall_at_5 value: 46.702333333333335 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackStatsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 25.749 - type: map_at_10 value: 33.001999999999995 - type: map_at_100 value: 33.891 - type: map_at_1000 value: 33.993 - type: map_at_3 value: 30.703999999999997 - type: map_at_5 value: 31.959 - type: mrr_at_1 value: 28.834 - type: mrr_at_10 value: 35.955 - type: mrr_at_100 value: 36.709 - type: mrr_at_1000 value: 36.779 - type: mrr_at_3 value: 33.947 - type: mrr_at_5 value: 35.089 - type: ndcg_at_1 value: 28.834 - type: ndcg_at_10 value: 37.329 - type: ndcg_at_100 value: 41.79 - type: ndcg_at_1000 value: 44.169000000000004 - type: ndcg_at_3 value: 33.184999999999995 - type: ndcg_at_5 value: 35.107 - type: precision_at_1 value: 28.834 - type: precision_at_10 value: 5.7669999999999995 - type: precision_at_100 value: 0.876 - type: precision_at_1000 value: 0.11399999999999999 - type: precision_at_3 value: 14.213000000000001 - type: precision_at_5 value: 9.754999999999999 - type: recall_at_1 value: 25.749 - type: recall_at_10 value: 47.791 - type: recall_at_100 value: 68.255 - type: recall_at_1000 value: 85.749 - type: recall_at_3 value: 36.199 - type: recall_at_5 value: 41.071999999999996 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackTexRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 17.777 - type: map_at_10 value: 25.201 - type: map_at_100 value: 26.423999999999996 - type: map_at_1000 value: 26.544 - type: map_at_3 value: 22.869 - type: map_at_5 value: 24.023 - type: mrr_at_1 value: 21.473 - type: mrr_at_10 value: 29.12 - type: mrr_at_100 value: 30.144 - type: mrr_at_1000 value: 30.215999999999998 - type: mrr_at_3 value: 26.933 - type: mrr_at_5 value: 28.051 - type: ndcg_at_1 value: 21.473 - type: ndcg_at_10 value: 30.003 - type: ndcg_at_100 value: 35.766 - type: ndcg_at_1000 value: 38.501000000000005 - type: ndcg_at_3 value: 25.773000000000003 - type: ndcg_at_5 value: 27.462999999999997 - type: precision_at_1 value: 21.473 - type: precision_at_10 value: 5.482 - type: precision_at_100 value: 0.975 - type: precision_at_1000 value: 0.13799999999999998 - type: precision_at_3 value: 12.205 - type: precision_at_5 value: 8.692 - type: recall_at_1 value: 17.777 - type: recall_at_10 value: 40.582 - type: recall_at_100 value: 66.305 - type: recall_at_1000 value: 85.636 - type: recall_at_3 value: 28.687 - type: recall_at_5 value: 33.089 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackUnixRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 26.677 - type: map_at_10 value: 36.309000000000005 - type: map_at_100 value: 37.403999999999996 - type: map_at_1000 value: 37.496 - type: map_at_3 value: 33.382 - type: map_at_5 value: 34.98 - type: mrr_at_1 value: 31.343 - type: mrr_at_10 value: 40.549 - type: mrr_at_100 value: 41.342 - type: mrr_at_1000 value: 41.397 - type: mrr_at_3 value: 38.029 - type: mrr_at_5 value: 39.451 - type: ndcg_at_1 value: 31.343 - type: ndcg_at_10 value: 42.1 - type: ndcg_at_100 value: 47.089999999999996 - type: ndcg_at_1000 value: 49.222 - type: ndcg_at_3 value: 36.836999999999996 - type: ndcg_at_5 value: 39.21 - type: precision_at_1 value: 31.343 - type: precision_at_10 value: 7.164 - type: precision_at_100 value: 1.0959999999999999 - type: precision_at_1000 value: 0.13899999999999998 - type: precision_at_3 value: 16.915 - type: precision_at_5 value: 11.940000000000001 - type: recall_at_1 value: 26.677 - type: recall_at_10 value: 55.54599999999999 - type: recall_at_100 value: 77.094 - type: recall_at_1000 value: 92.01 - type: recall_at_3 value: 41.191 - type: recall_at_5 value: 47.006 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWebmastersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 24.501 - type: map_at_10 value: 33.102 - type: map_at_100 value: 34.676 - type: map_at_1000 value: 34.888000000000005 - type: map_at_3 value: 29.944 - type: map_at_5 value: 31.613999999999997 - type: mrr_at_1 value: 29.447000000000003 - type: mrr_at_10 value: 37.996 - type: mrr_at_100 value: 38.946 - type: mrr_at_1000 value: 38.995000000000005 - type: mrr_at_3 value: 35.079 - type: mrr_at_5 value: 36.69 - type: ndcg_at_1 value: 29.447000000000003 - type: ndcg_at_10 value: 39.232 - type: ndcg_at_100 value: 45.247 - type: ndcg_at_1000 value: 47.613 - type: ndcg_at_3 value: 33.922999999999995 - type: ndcg_at_5 value: 36.284 - type: precision_at_1 value: 29.447000000000003 - type: precision_at_10 value: 7.648000000000001 - type: precision_at_100 value: 1.516 - type: precision_at_1000 value: 0.23900000000000002 - type: precision_at_3 value: 16.008 - type: precision_at_5 value: 11.779 - type: recall_at_1 value: 24.501 - type: recall_at_10 value: 51.18899999999999 - type: recall_at_100 value: 78.437 - type: recall_at_1000 value: 92.842 - type: recall_at_3 value: 35.808 - type: recall_at_5 value: 42.197 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWordpressRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 22.039 - type: map_at_10 value: 30.377 - type: map_at_100 value: 31.275 - type: map_at_1000 value: 31.379 - type: map_at_3 value: 27.98 - type: map_at_5 value: 29.358 - type: mrr_at_1 value: 24.03 - type: mrr_at_10 value: 32.568000000000005 - type: mrr_at_100 value: 33.403 - type: mrr_at_1000 value: 33.475 - type: mrr_at_3 value: 30.436999999999998 - type: mrr_at_5 value: 31.796000000000003 - type: ndcg_at_1 value: 24.03 - type: ndcg_at_10 value: 35.198 - type: ndcg_at_100 value: 39.668 - type: ndcg_at_1000 value: 42.296 - type: ndcg_at_3 value: 30.709999999999997 - type: ndcg_at_5 value: 33.024 - type: precision_at_1 value: 24.03 - type: precision_at_10 value: 5.564 - type: precision_at_100 value: 0.828 - type: precision_at_1000 value: 0.117 - type: precision_at_3 value: 13.309000000000001 - type: precision_at_5 value: 9.39 - type: recall_at_1 value: 22.039 - type: recall_at_10 value: 47.746 - type: recall_at_100 value: 68.23599999999999 - type: recall_at_1000 value: 87.852 - type: recall_at_3 value: 35.852000000000004 - type: recall_at_5 value: 41.410000000000004 - task: type: Retrieval dataset: type: climate-fever name: MTEB ClimateFEVER config: default split: test revision: None metrics: - type: map_at_1 value: 15.692999999999998 - type: map_at_10 value: 26.903 - type: map_at_100 value: 28.987000000000002 - type: map_at_1000 value: 29.176999999999996 - type: map_at_3 value: 22.137 - type: map_at_5 value: 24.758 - type: mrr_at_1 value: 35.57 - type: mrr_at_10 value: 47.821999999999996 - type: mrr_at_100 value: 48.608000000000004 - type: mrr_at_1000 value: 48.638999999999996 - type: mrr_at_3 value: 44.452000000000005 - type: mrr_at_5 value: 46.546 - type: ndcg_at_1 value: 35.57 - type: ndcg_at_10 value: 36.567 - type: ndcg_at_100 value: 44.085 - type: ndcg_at_1000 value: 47.24 - type: ndcg_at_3 value: 29.964000000000002 - type: ndcg_at_5 value: 32.511 - type: precision_at_1 value: 35.57 - type: precision_at_10 value: 11.485 - type: precision_at_100 value: 1.9619999999999997 - type: precision_at_1000 value: 0.256 - type: precision_at_3 value: 22.237000000000002 - type: precision_at_5 value: 17.471999999999998 - type: recall_at_1 value: 15.692999999999998 - type: recall_at_10 value: 43.056 - type: recall_at_100 value: 68.628 - type: recall_at_1000 value: 86.075 - type: recall_at_3 value: 26.918999999999997 - type: recall_at_5 value: 34.14 - task: type: Retrieval dataset: type: dbpedia-entity name: MTEB DBPedia config: default split: test revision: None metrics: - type: map_at_1 value: 9.53 - type: map_at_10 value: 20.951 - type: map_at_100 value: 30.136000000000003 - type: map_at_1000 value: 31.801000000000002 - type: map_at_3 value: 15.021 - type: map_at_5 value: 17.471999999999998 - type: mrr_at_1 value: 71.0 - type: mrr_at_10 value: 79.176 - type: mrr_at_100 value: 79.418 - type: mrr_at_1000 value: 79.426 - type: mrr_at_3 value: 78.125 - type: mrr_at_5 value: 78.61200000000001 - type: ndcg_at_1 value: 58.5 - type: ndcg_at_10 value: 44.106 - type: ndcg_at_100 value: 49.268 - type: ndcg_at_1000 value: 56.711999999999996 - type: ndcg_at_3 value: 48.934 - type: ndcg_at_5 value: 45.826 - type: precision_at_1 value: 71.0 - type: precision_at_10 value: 35.0 - type: precision_at_100 value: 11.360000000000001 - type: precision_at_1000 value: 2.046 - type: precision_at_3 value: 52.833 - type: precision_at_5 value: 44.15 - type: recall_at_1 value: 9.53 - type: recall_at_10 value: 26.811 - type: recall_at_100 value: 55.916999999999994 - type: recall_at_1000 value: 79.973 - type: recall_at_3 value: 16.413 - type: recall_at_5 value: 19.980999999999998 - task: type: Classification dataset: type: mteb/emotion name: MTEB EmotionClassification config: default split: test revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 metrics: - type: accuracy value: 51.519999999999996 - type: f1 value: 46.36601294761231 - task: type: Retrieval dataset: type: fever name: MTEB FEVER config: default split: test revision: None metrics: - type: map_at_1 value: 74.413 - type: map_at_10 value: 83.414 - type: map_at_100 value: 83.621 - type: map_at_1000 value: 83.635 - type: map_at_3 value: 82.337 - type: map_at_5 value: 83.039 - type: mrr_at_1 value: 80.19800000000001 - type: mrr_at_10 value: 87.715 - type: mrr_at_100 value: 87.778 - type: mrr_at_1000 value: 87.779 - type: mrr_at_3 value: 87.106 - type: mrr_at_5 value: 87.555 - type: ndcg_at_1 value: 80.19800000000001 - type: ndcg_at_10 value: 87.182 - type: ndcg_at_100 value: 87.90299999999999 - type: ndcg_at_1000 value: 88.143 - type: ndcg_at_3 value: 85.60600000000001 - type: ndcg_at_5 value: 86.541 - type: precision_at_1 value: 80.19800000000001 - type: precision_at_10 value: 10.531 - type: precision_at_100 value: 1.113 - type: precision_at_1000 value: 0.11499999999999999 - type: precision_at_3 value: 32.933 - type: precision_at_5 value: 20.429 - type: recall_at_1 value: 74.413 - type: recall_at_10 value: 94.363 - type: recall_at_100 value: 97.165 - type: recall_at_1000 value: 98.668 - type: recall_at_3 value: 90.108 - type: recall_at_5 value: 92.52 - task: type: Retrieval dataset: type: fiqa name: MTEB FiQA2018 config: default split: test revision: None metrics: - type: map_at_1 value: 22.701 - type: map_at_10 value: 37.122 - type: map_at_100 value: 39.178000000000004 - type: map_at_1000 value: 39.326 - type: map_at_3 value: 32.971000000000004 - type: map_at_5 value: 35.332 - type: mrr_at_1 value: 44.753 - type: mrr_at_10 value: 53.452 - type: mrr_at_100 value: 54.198 - type: mrr_at_1000 value: 54.225 - type: mrr_at_3 value: 50.952 - type: mrr_at_5 value: 52.464 - type: ndcg_at_1 value: 44.753 - type: ndcg_at_10 value: 45.021 - type: ndcg_at_100 value: 52.028 - type: ndcg_at_1000 value: 54.596000000000004 - type: ndcg_at_3 value: 41.622 - type: ndcg_at_5 value: 42.736000000000004 - type: precision_at_1 value: 44.753 - type: precision_at_10 value: 12.284 - type: precision_at_100 value: 1.955 - type: precision_at_1000 value: 0.243 - type: precision_at_3 value: 27.828999999999997 - type: precision_at_5 value: 20.061999999999998 - type: recall_at_1 value: 22.701 - type: recall_at_10 value: 51.432 - type: recall_at_100 value: 77.009 - type: recall_at_1000 value: 92.511 - type: recall_at_3 value: 37.919000000000004 - type: recall_at_5 value: 44.131 - task: type: Retrieval dataset: type: hotpotqa name: MTEB HotpotQA config: default split: test revision: None metrics: - type: map_at_1 value: 40.189 - type: map_at_10 value: 66.24600000000001 - type: map_at_100 value: 67.098 - type: map_at_1000 value: 67.149 - type: map_at_3 value: 62.684 - type: map_at_5 value: 64.974 - type: mrr_at_1 value: 80.378 - type: mrr_at_10 value: 86.127 - type: mrr_at_100 value: 86.29299999999999 - type: mrr_at_1000 value: 86.297 - type: mrr_at_3 value: 85.31400000000001 - type: mrr_at_5 value: 85.858 - type: ndcg_at_1 value: 80.378 - type: ndcg_at_10 value: 74.101 - type: ndcg_at_100 value: 76.993 - type: ndcg_at_1000 value: 77.948 - type: ndcg_at_3 value: 69.232 - type: ndcg_at_5 value: 72.04599999999999 - type: precision_at_1 value: 80.378 - type: precision_at_10 value: 15.595999999999998 - type: precision_at_100 value: 1.7840000000000003 - type: precision_at_1000 value: 0.191 - type: precision_at_3 value: 44.884 - type: precision_at_5 value: 29.145 - type: recall_at_1 value: 40.189 - type: recall_at_10 value: 77.981 - type: recall_at_100 value: 89.21 - type: recall_at_1000 value: 95.48299999999999 - type: recall_at_3 value: 67.326 - type: recall_at_5 value: 72.863 - task: type: Classification dataset: type: mteb/imdb name: MTEB ImdbClassification config: default split: test revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 metrics: - type: accuracy value: 92.84599999999999 - type: ap value: 89.4710787567357 - type: f1 value: 92.83752676932258 - task: type: Retrieval dataset: type: msmarco name: MTEB MSMARCO config: default split: dev revision: None metrics: - type: map_at_1 value: 23.132 - type: map_at_10 value: 35.543 - type: map_at_100 value: 36.702 - type: map_at_1000 value: 36.748999999999995 - type: map_at_3 value: 31.737 - type: map_at_5 value: 33.927 - type: mrr_at_1 value: 23.782 - type: mrr_at_10 value: 36.204 - type: mrr_at_100 value: 37.29 - type: mrr_at_1000 value: 37.330999999999996 - type: mrr_at_3 value: 32.458999999999996 - type: mrr_at_5 value: 34.631 - type: ndcg_at_1 value: 23.782 - type: ndcg_at_10 value: 42.492999999999995 - type: ndcg_at_100 value: 47.985 - type: ndcg_at_1000 value: 49.141 - type: ndcg_at_3 value: 34.748000000000005 - type: ndcg_at_5 value: 38.651 - type: precision_at_1 value: 23.782 - type: precision_at_10 value: 6.665 - type: precision_at_100 value: 0.941 - type: precision_at_1000 value: 0.104 - type: precision_at_3 value: 14.776 - type: precision_at_5 value: 10.84 - type: recall_at_1 value: 23.132 - type: recall_at_10 value: 63.794 - type: recall_at_100 value: 89.027 - type: recall_at_1000 value: 97.807 - type: recall_at_3 value: 42.765 - type: recall_at_5 value: 52.11 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (en) config: en split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 94.59188326493388 - type: f1 value: 94.3842594786827 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (en) config: en split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 79.49384404924761 - type: f1 value: 59.7580539534629 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (en) config: en split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 77.56220578345663 - type: f1 value: 75.27228165561478 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (en) config: en split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 80.53463349024884 - type: f1 value: 80.4893958236536 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-p2p name: MTEB MedrxivClusteringP2P config: default split: test revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 metrics: - type: v_measure value: 32.56100273484962 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-s2s name: MTEB MedrxivClusteringS2S config: default split: test revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 metrics: - type: v_measure value: 31.470380028839607 - task: type: Reranking dataset: type: mteb/mind_small name: MTEB MindSmallReranking config: default split: test revision: 3bdac13927fdc888b903db93b2ffdbd90b295a69 metrics: - type: map value: 32.06102792457849 - type: mrr value: 33.30709199672238 - task: type: Retrieval dataset: type: nfcorpus name: MTEB NFCorpus config: default split: test revision: None metrics: - type: map_at_1 value: 6.776999999999999 - type: map_at_10 value: 14.924000000000001 - type: map_at_100 value: 18.955 - type: map_at_1000 value: 20.538999999999998 - type: map_at_3 value: 10.982 - type: map_at_5 value: 12.679000000000002 - type: mrr_at_1 value: 47.988 - type: mrr_at_10 value: 57.232000000000006 - type: mrr_at_100 value: 57.818999999999996 - type: mrr_at_1000 value: 57.847 - type: mrr_at_3 value: 54.901999999999994 - type: mrr_at_5 value: 56.481 - type: ndcg_at_1 value: 46.594 - type: ndcg_at_10 value: 38.129000000000005 - type: ndcg_at_100 value: 35.54 - type: ndcg_at_1000 value: 44.172 - type: ndcg_at_3 value: 43.025999999999996 - type: ndcg_at_5 value: 41.052 - type: precision_at_1 value: 47.988 - type: precision_at_10 value: 28.111000000000004 - type: precision_at_100 value: 8.929 - type: precision_at_1000 value: 2.185 - type: precision_at_3 value: 40.144000000000005 - type: precision_at_5 value: 35.232 - type: recall_at_1 value: 6.776999999999999 - type: recall_at_10 value: 19.289 - type: recall_at_100 value: 36.359 - type: recall_at_1000 value: 67.54 - type: recall_at_3 value: 11.869 - type: recall_at_5 value: 14.999 - task: type: Retrieval dataset: type: nq name: MTEB NQ config: default split: test revision: None metrics: - type: map_at_1 value: 31.108000000000004 - type: map_at_10 value: 47.126000000000005 - type: map_at_100 value: 48.171 - type: map_at_1000 value: 48.199 - type: map_at_3 value: 42.734 - type: map_at_5 value: 45.362 - type: mrr_at_1 value: 34.936 - type: mrr_at_10 value: 49.571 - type: mrr_at_100 value: 50.345 - type: mrr_at_1000 value: 50.363 - type: mrr_at_3 value: 45.959 - type: mrr_at_5 value: 48.165 - type: ndcg_at_1 value: 34.936 - type: ndcg_at_10 value: 55.028999999999996 - type: ndcg_at_100 value: 59.244 - type: ndcg_at_1000 value: 59.861 - type: ndcg_at_3 value: 46.872 - type: ndcg_at_5 value: 51.217999999999996 - type: precision_at_1 value: 34.936 - type: precision_at_10 value: 9.099 - type: precision_at_100 value: 1.145 - type: precision_at_1000 value: 0.12 - type: precision_at_3 value: 21.456 - type: precision_at_5 value: 15.411 - type: recall_at_1 value: 31.108000000000004 - type: recall_at_10 value: 76.53999999999999 - type: recall_at_100 value: 94.39 - type: recall_at_1000 value: 98.947 - type: recall_at_3 value: 55.572 - type: recall_at_5 value: 65.525 - task: type: Retrieval dataset: type: quora name: MTEB QuoraRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 71.56400000000001 - type: map_at_10 value: 85.482 - type: map_at_100 value: 86.114 - type: map_at_1000 value: 86.13 - type: map_at_3 value: 82.607 - type: map_at_5 value: 84.405 - type: mrr_at_1 value: 82.42 - type: mrr_at_10 value: 88.304 - type: mrr_at_100 value: 88.399 - type: mrr_at_1000 value: 88.399 - type: mrr_at_3 value: 87.37 - type: mrr_at_5 value: 88.024 - type: ndcg_at_1 value: 82.45 - type: ndcg_at_10 value: 89.06500000000001 - type: ndcg_at_100 value: 90.232 - type: ndcg_at_1000 value: 90.305 - type: ndcg_at_3 value: 86.375 - type: ndcg_at_5 value: 87.85300000000001 - type: precision_at_1 value: 82.45 - type: precision_at_10 value: 13.486999999999998 - type: precision_at_100 value: 1.534 - type: precision_at_1000 value: 0.157 - type: precision_at_3 value: 37.813 - type: precision_at_5 value: 24.773999999999997 - type: recall_at_1 value: 71.56400000000001 - type: recall_at_10 value: 95.812 - type: recall_at_100 value: 99.7 - type: recall_at_1000 value: 99.979 - type: recall_at_3 value: 87.966 - type: recall_at_5 value: 92.268 - task: type: Clustering dataset: type: mteb/reddit-clustering name: MTEB RedditClustering config: default split: test revision: 24640382cdbf8abc73003fb0fa6d111a705499eb metrics: - type: v_measure value: 57.241876648614145 - task: type: Clustering dataset: type: mteb/reddit-clustering-p2p name: MTEB RedditClusteringP2P config: default split: test revision: 282350215ef01743dc01b456c7f5241fa8937f16 metrics: - type: v_measure value: 64.66212576446223 - task: type: Retrieval dataset: type: scidocs name: MTEB SCIDOCS config: default split: test revision: None metrics: - type: map_at_1 value: 5.308 - type: map_at_10 value: 13.803 - type: map_at_100 value: 16.176 - type: map_at_1000 value: 16.561 - type: map_at_3 value: 9.761000000000001 - type: map_at_5 value: 11.802 - type: mrr_at_1 value: 26.200000000000003 - type: mrr_at_10 value: 37.621 - type: mrr_at_100 value: 38.767 - type: mrr_at_1000 value: 38.815 - type: mrr_at_3 value: 34.117 - type: mrr_at_5 value: 36.107 - type: ndcg_at_1 value: 26.200000000000003 - type: ndcg_at_10 value: 22.64 - type: ndcg_at_100 value: 31.567 - type: ndcg_at_1000 value: 37.623 - type: ndcg_at_3 value: 21.435000000000002 - type: ndcg_at_5 value: 18.87 - type: precision_at_1 value: 26.200000000000003 - type: precision_at_10 value: 11.74 - type: precision_at_100 value: 2.465 - type: precision_at_1000 value: 0.391 - type: precision_at_3 value: 20.033 - type: precision_at_5 value: 16.64 - type: recall_at_1 value: 5.308 - type: recall_at_10 value: 23.794999999999998 - type: recall_at_100 value: 50.015 - type: recall_at_1000 value: 79.283 - type: recall_at_3 value: 12.178 - type: recall_at_5 value: 16.882 - task: type: STS dataset: type: mteb/sickr-sts name: MTEB SICK-R config: default split: test revision: a6ea5a8cab320b040a23452cc28066d9beae2cee metrics: - type: cos_sim_pearson value: 84.93231134675553 - type: cos_sim_spearman value: 81.68319292603205 - type: euclidean_pearson value: 81.8396814380367 - type: euclidean_spearman value: 81.24641903349945 - type: manhattan_pearson value: 81.84698799204274 - type: manhattan_spearman value: 81.24269997904105 - task: type: STS dataset: type: mteb/sts12-sts name: MTEB STS12 config: default split: test revision: a0d554a64d88156834ff5ae9920b964011b16384 metrics: - type: cos_sim_pearson value: 86.73241671587446 - type: cos_sim_spearman value: 79.05091082971826 - type: euclidean_pearson value: 83.91146869578044 - type: euclidean_spearman value: 79.87978465370936 - type: manhattan_pearson value: 83.90888338917678 - type: manhattan_spearman value: 79.87482848584241 - task: type: STS dataset: type: mteb/sts13-sts name: MTEB STS13 config: default split: test revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca metrics: - type: cos_sim_pearson value: 85.14970731146177 - type: cos_sim_spearman value: 86.37363490084627 - type: euclidean_pearson value: 83.02154218530433 - type: euclidean_spearman value: 83.80258761957367 - type: manhattan_pearson value: 83.01664495119347 - type: manhattan_spearman value: 83.77567458007952 - task: type: STS dataset: type: mteb/sts14-sts name: MTEB STS14 config: default split: test revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 metrics: - type: cos_sim_pearson value: 83.40474139886784 - type: cos_sim_spearman value: 82.77768789165984 - type: euclidean_pearson value: 80.7065877443695 - type: euclidean_spearman value: 81.375940662505 - type: manhattan_pearson value: 80.6507552270278 - type: manhattan_spearman value: 81.32782179098741 - task: type: STS dataset: type: mteb/sts15-sts name: MTEB STS15 config: default split: test revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 metrics: - type: cos_sim_pearson value: 87.08585968722274 - type: cos_sim_spearman value: 88.03110031451399 - type: euclidean_pearson value: 85.74012019602384 - type: euclidean_spearman value: 86.13592849438209 - type: manhattan_pearson value: 85.74404842369206 - type: manhattan_spearman value: 86.14492318960154 - task: type: STS dataset: type: mteb/sts16-sts name: MTEB STS16 config: default split: test revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 metrics: - type: cos_sim_pearson value: 84.95069052788875 - type: cos_sim_spearman value: 86.4867991595147 - type: euclidean_pearson value: 84.31013325754635 - type: euclidean_spearman value: 85.01529258006482 - type: manhattan_pearson value: 84.26995570085374 - type: manhattan_spearman value: 84.96982104986162 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-en) config: en-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 87.54617647971897 - type: cos_sim_spearman value: 87.49834181751034 - type: euclidean_pearson value: 86.01015322577122 - type: euclidean_spearman value: 84.63362652063199 - type: manhattan_pearson value: 86.13807574475706 - type: manhattan_spearman value: 84.7772370721132 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (en) config: en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 67.20047755786615 - type: cos_sim_spearman value: 67.05324077987636 - type: euclidean_pearson value: 66.91930642976601 - type: euclidean_spearman value: 65.21491856099105 - type: manhattan_pearson value: 66.78756851976624 - type: manhattan_spearman value: 65.12356257740728 - task: type: STS dataset: type: mteb/stsbenchmark-sts name: MTEB STSBenchmark config: default split: test revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 metrics: - type: cos_sim_pearson value: 86.19852871539686 - type: cos_sim_spearman value: 87.5161895296395 - type: euclidean_pearson value: 84.59848645207485 - type: euclidean_spearman value: 85.26427328757919 - type: manhattan_pearson value: 84.59747366996524 - type: manhattan_spearman value: 85.24045855146915 - task: type: Reranking dataset: type: mteb/scidocs-reranking name: MTEB SciDocsRR config: default split: test revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab metrics: - type: map value: 87.63320317811032 - type: mrr value: 96.26242947321379 - task: type: Retrieval dataset: type: scifact name: MTEB SciFact config: default split: test revision: None metrics: - type: map_at_1 value: 60.928000000000004 - type: map_at_10 value: 70.112 - type: map_at_100 value: 70.59299999999999 - type: map_at_1000 value: 70.623 - type: map_at_3 value: 66.846 - type: map_at_5 value: 68.447 - type: mrr_at_1 value: 64.0 - type: mrr_at_10 value: 71.212 - type: mrr_at_100 value: 71.616 - type: mrr_at_1000 value: 71.64500000000001 - type: mrr_at_3 value: 68.77799999999999 - type: mrr_at_5 value: 70.094 - type: ndcg_at_1 value: 64.0 - type: ndcg_at_10 value: 74.607 - type: ndcg_at_100 value: 76.416 - type: ndcg_at_1000 value: 77.102 - type: ndcg_at_3 value: 69.126 - type: ndcg_at_5 value: 71.41300000000001 - type: precision_at_1 value: 64.0 - type: precision_at_10 value: 9.933 - type: precision_at_100 value: 1.077 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 26.556 - type: precision_at_5 value: 17.467 - type: recall_at_1 value: 60.928000000000004 - type: recall_at_10 value: 87.322 - type: recall_at_100 value: 94.833 - type: recall_at_1000 value: 100.0 - type: recall_at_3 value: 72.628 - type: recall_at_5 value: 78.428 - task: type: PairClassification dataset: type: mteb/sprintduplicatequestions-pairclassification name: MTEB SprintDuplicateQuestions config: default split: test revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 metrics: - type: cos_sim_accuracy value: 99.86237623762376 - type: cos_sim_ap value: 96.72586477206649 - type: cos_sim_f1 value: 93.01858362631845 - type: cos_sim_precision value: 93.4409687184662 - type: cos_sim_recall value: 92.60000000000001 - type: dot_accuracy value: 99.78019801980199 - type: dot_ap value: 93.72748205246228 - type: dot_f1 value: 89.04109589041096 - type: dot_precision value: 87.16475095785441 - type: dot_recall value: 91.0 - type: euclidean_accuracy value: 99.85445544554456 - type: euclidean_ap value: 96.6661459876145 - type: euclidean_f1 value: 92.58337481333997 - type: euclidean_precision value: 92.17046580773042 - type: euclidean_recall value: 93.0 - type: manhattan_accuracy value: 99.85445544554456 - type: manhattan_ap value: 96.6883549244056 - type: manhattan_f1 value: 92.57598405580468 - type: manhattan_precision value: 92.25422045680239 - type: manhattan_recall value: 92.9 - type: max_accuracy value: 99.86237623762376 - type: max_ap value: 96.72586477206649 - type: max_f1 value: 93.01858362631845 - task: type: Clustering dataset: type: mteb/stackexchange-clustering name: MTEB StackExchangeClustering config: default split: test revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 metrics: - type: v_measure value: 66.39930057069995 - task: type: Clustering dataset: type: mteb/stackexchange-clustering-p2p name: MTEB StackExchangeClusteringP2P config: default split: test revision: 815ca46b2622cec33ccafc3735d572c266efdb44 metrics: - type: v_measure value: 34.96398659903402 - task: type: Reranking dataset: type: mteb/stackoverflowdupquestions-reranking name: MTEB StackOverflowDupQuestions config: default split: test revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 metrics: - type: map value: 55.946944700355395 - type: mrr value: 56.97151398438164 - task: type: Summarization dataset: type: mteb/summeval name: MTEB SummEval config: default split: test revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c metrics: - type: cos_sim_pearson value: 31.541657650692905 - type: cos_sim_spearman value: 31.605804192286303 - type: dot_pearson value: 28.26905996736398 - type: dot_spearman value: 27.864801765851187 - task: type: Retrieval dataset: type: trec-covid name: MTEB TRECCOVID config: default split: test revision: None metrics: - type: map_at_1 value: 0.22599999999999998 - type: map_at_10 value: 1.8870000000000002 - type: map_at_100 value: 9.78 - type: map_at_1000 value: 22.514 - type: map_at_3 value: 0.6669999999999999 - type: map_at_5 value: 1.077 - type: mrr_at_1 value: 82.0 - type: mrr_at_10 value: 89.86699999999999 - type: mrr_at_100 value: 89.86699999999999 - type: mrr_at_1000 value: 89.86699999999999 - type: mrr_at_3 value: 89.667 - type: mrr_at_5 value: 89.667 - type: ndcg_at_1 value: 79.0 - type: ndcg_at_10 value: 74.818 - type: ndcg_at_100 value: 53.715999999999994 - type: ndcg_at_1000 value: 47.082 - type: ndcg_at_3 value: 82.134 - type: ndcg_at_5 value: 79.81899999999999 - type: precision_at_1 value: 82.0 - type: precision_at_10 value: 78.0 - type: precision_at_100 value: 54.48 - type: precision_at_1000 value: 20.518 - type: precision_at_3 value: 87.333 - type: precision_at_5 value: 85.2 - type: recall_at_1 value: 0.22599999999999998 - type: recall_at_10 value: 2.072 - type: recall_at_100 value: 13.013 - type: recall_at_1000 value: 43.462 - type: recall_at_3 value: 0.695 - type: recall_at_5 value: 1.139 - task: type: Retrieval dataset: type: webis-touche2020 name: MTEB Touche2020 config: default split: test revision: None metrics: - type: map_at_1 value: 2.328 - type: map_at_10 value: 9.795 - type: map_at_100 value: 15.801000000000002 - type: map_at_1000 value: 17.23 - type: map_at_3 value: 4.734 - type: map_at_5 value: 6.644 - type: mrr_at_1 value: 30.612000000000002 - type: mrr_at_10 value: 46.902 - type: mrr_at_100 value: 47.495 - type: mrr_at_1000 value: 47.495 - type: mrr_at_3 value: 41.156 - type: mrr_at_5 value: 44.218 - type: ndcg_at_1 value: 28.571 - type: ndcg_at_10 value: 24.806 - type: ndcg_at_100 value: 36.419000000000004 - type: ndcg_at_1000 value: 47.272999999999996 - type: ndcg_at_3 value: 25.666 - type: ndcg_at_5 value: 25.448999999999998 - type: precision_at_1 value: 30.612000000000002 - type: precision_at_10 value: 23.061 - type: precision_at_100 value: 7.714 - type: precision_at_1000 value: 1.484 - type: precision_at_3 value: 26.531 - type: precision_at_5 value: 26.122 - type: recall_at_1 value: 2.328 - type: recall_at_10 value: 16.524 - type: recall_at_100 value: 47.179 - type: recall_at_1000 value: 81.22200000000001 - type: recall_at_3 value: 5.745 - type: recall_at_5 value: 9.339 - task: type: Classification dataset: type: mteb/toxic_conversations_50k name: MTEB ToxicConversationsClassification config: default split: test revision: d7c0de2777da35d6aae2200a62c6e0e5af397c4c metrics: - type: accuracy value: 70.9142 - type: ap value: 14.335574772555415 - type: f1 value: 54.62839595194111 - task: type: Classification dataset: type: mteb/tweet_sentiment_extraction name: MTEB TweetSentimentExtractionClassification config: default split: test revision: d604517c81ca91fe16a244d1248fc021f9ecee7a metrics: - type: accuracy value: 59.94340690435768 - type: f1 value: 60.286487936731916 - task: type: Clustering dataset: type: mteb/twentynewsgroups-clustering name: MTEB TwentyNewsgroupsClustering config: default split: test revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 metrics: - type: v_measure value: 51.26597708987974 - task: type: PairClassification dataset: type: mteb/twittersemeval2015-pairclassification name: MTEB TwitterSemEval2015 config: default split: test revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 metrics: - type: cos_sim_accuracy value: 87.48882398521786 - type: cos_sim_ap value: 79.04326607602204 - type: cos_sim_f1 value: 71.64566826860633 - type: cos_sim_precision value: 70.55512918905092 - type: cos_sim_recall value: 72.77044854881267 - type: dot_accuracy value: 84.19264469213805 - type: dot_ap value: 67.96360043562528 - type: dot_f1 value: 64.06418393006827 - type: dot_precision value: 58.64941898706424 - type: dot_recall value: 70.58047493403694 - type: euclidean_accuracy value: 87.45902127913214 - type: euclidean_ap value: 78.9742237648272 - type: euclidean_f1 value: 71.5553235908142 - type: euclidean_precision value: 70.77955601445535 - type: euclidean_recall value: 72.34828496042216 - type: manhattan_accuracy value: 87.41729749061214 - type: manhattan_ap value: 78.90073137580596 - type: manhattan_f1 value: 71.3942611553533 - type: manhattan_precision value: 68.52705653967483 - type: manhattan_recall value: 74.51187335092348 - type: max_accuracy value: 87.48882398521786 - type: max_ap value: 79.04326607602204 - type: max_f1 value: 71.64566826860633 - task: type: PairClassification dataset: type: mteb/twitterurlcorpus-pairclassification name: MTEB TwitterURLCorpus config: default split: test revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf metrics: - type: cos_sim_accuracy value: 88.68125897465751 - type: cos_sim_ap value: 85.6003454431979 - type: cos_sim_f1 value: 77.6957163958641 - type: cos_sim_precision value: 73.0110366307807 - type: cos_sim_recall value: 83.02279026793964 - type: dot_accuracy value: 87.7672992587418 - type: dot_ap value: 82.4971301112899 - type: dot_f1 value: 75.90528233151184 - type: dot_precision value: 72.0370626469368 - type: dot_recall value: 80.21250384970742 - type: euclidean_accuracy value: 88.4503434625684 - type: euclidean_ap value: 84.91949884748384 - type: euclidean_f1 value: 76.92365018444684 - type: euclidean_precision value: 74.53245721712759 - type: euclidean_recall value: 79.47336002463813 - type: manhattan_accuracy value: 88.47556952691427 - type: manhattan_ap value: 84.8963689101517 - type: manhattan_f1 value: 76.85901249256395 - type: manhattan_precision value: 74.31693989071039 - type: manhattan_recall value: 79.58115183246073 - type: max_accuracy value: 88.68125897465751 - type: max_ap value: 85.6003454431979 - type: max_f1 value: 77.6957163958641 license: mit language: - en --- <h1 align="center">FlagEmbedding</h1> <h4 align="center"> <p> <a href=#model-list>Model List</a> | <a href=#frequently-asked-questions>FAQ</a> | <a href=#usage>Usage</a> | <a href="#evaluation">Evaluation</a> | <a href="#train">Train</a> | <a href="#contact">Contact</a> | <a href="#citation">Citation</a> | <a href="#license">License</a> <p> </h4> For more details please refer to our Github: [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding). If you are looking for a model that supports more languages, longer texts, and other retrieval methods, you can try using [bge-m3](https://huggingface.co/BAAI/bge-m3). [English](README.md) | [中文](https://github.com/FlagOpen/FlagEmbedding/blob/master/README_zh.md) FlagEmbedding focuses on retrieval-augmented LLMs, consisting of the following projects currently: - **Long-Context LLM**: [Activation Beacon](https://github.com/FlagOpen/FlagEmbedding/tree/master/Long_LLM/activation_beacon) - **Fine-tuning of LM** : [LM-Cocktail](https://github.com/FlagOpen/FlagEmbedding/tree/master/LM_Cocktail) - **Dense Retrieval**: [BGE-M3](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3), [LLM Embedder](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder), [BGE Embedding](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/baai_general_embedding) - **Reranker Model**: [BGE Reranker](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker) - **Benchmark**: [C-MTEB](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB) ## News - 1/30/2024: Release **BGE-M3**, a new member to BGE model series! M3 stands for **M**ulti-linguality (100+ languages), **M**ulti-granularities (input length up to 8192), **M**ulti-Functionality (unification of dense, lexical, multi-vec/colbert retrieval). It is the first embedding model that supports all three retrieval methods, achieving new SOTA on multi-lingual (MIRACL) and cross-lingual (MKQA) benchmarks. [Technical Report](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/BGE_M3/BGE_M3.pdf) and [Code](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3). :fire: - 1/9/2024: Release [Activation-Beacon](https://github.com/FlagOpen/FlagEmbedding/tree/master/Long_LLM/activation_beacon), an effective, efficient, compatible, and low-cost (training) method to extend the context length of LLM. [Technical Report](https://arxiv.org/abs/2401.03462) :fire: - 12/24/2023: Release **LLaRA**, a LLaMA-7B based dense retriever, leading to state-of-the-art performances on MS MARCO and BEIR. Model and code will be open-sourced. Please stay tuned. [Technical Report](https://arxiv.org/abs/2312.15503) :fire: - 11/23/2023: Release [LM-Cocktail](https://github.com/FlagOpen/FlagEmbedding/tree/master/LM_Cocktail), a method to maintain general capabilities during fine-tuning by merging multiple language models. [Technical Report](https://arxiv.org/abs/2311.13534) :fire: - 10/12/2023: Release [LLM-Embedder](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder), a unified embedding model to support diverse retrieval augmentation needs for LLMs. [Technical Report](https://arxiv.org/pdf/2310.07554.pdf) - 09/15/2023: The [technical report](https://arxiv.org/pdf/2309.07597.pdf) and [massive training data](https://data.baai.ac.cn/details/BAAI-MTP) of BGE has been released - 09/12/2023: New models: - **New reranker model**: release cross-encoder models `BAAI/bge-reranker-base` and `BAAI/bge-reranker-large`, which are more powerful than embedding model. We recommend to use/fine-tune them to re-rank top-k documents returned by embedding models. - **update embedding model**: release `bge-*-v1.5` embedding model to alleviate the issue of the similarity distribution, and enhance its retrieval ability without instruction. <details> <summary>More</summary> <!-- ### More --> - 09/07/2023: Update [fine-tune code](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md): Add script to mine hard negatives and support adding instruction during fine-tuning. - 08/09/2023: BGE Models are integrated into **Langchain**, you can use it like [this](#using-langchain); C-MTEB **leaderboard** is [available](https://huggingface.co/spaces/mteb/leaderboard). - 08/05/2023: Release base-scale and small-scale models, **best performance among the models of the same size 🤗** - 08/02/2023: Release `bge-large-*`(short for BAAI General Embedding) Models, **rank 1st on MTEB and C-MTEB benchmark!** :tada: :tada: - 08/01/2023: We release the [Chinese Massive Text Embedding Benchmark](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB) (**C-MTEB**), consisting of 31 test dataset. </details> ## Model List `bge` is short for `BAAI general embedding`. | Model | Language | | Description | query instruction for retrieval [1] | |:-------------------------------|:--------:| :--------:| :--------:|:--------:| | [BAAI/bge-m3](https://huggingface.co/BAAI/bge-m3) | Multilingual | [Inference](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3#usage) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/BGE_M3) | Multi-Functionality(dense retrieval, sparse retrieval, multi-vector(colbert)), Multi-Linguality, and Multi-Granularity(8192 tokens) | | | [BAAI/llm-embedder](https://huggingface.co/BAAI/llm-embedder) | English | [Inference](./FlagEmbedding/llm_embedder/README.md) [Fine-tune](./FlagEmbedding/llm_embedder/README.md) | a unified embedding model to support diverse retrieval augmentation needs for LLMs | See [README](./FlagEmbedding/llm_embedder/README.md) | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh-v1.5](https://huggingface.co/BAAI/bge-large-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-large-en](https://huggingface.co/BAAI/bge-large-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [MTEB](https://huggingface.co/spaces/mteb/leaderboard) leaderboard | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en](https://huggingface.co/BAAI/bge-base-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-en` | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en](https://huggingface.co/BAAI/bge-small-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) |a small-scale model but with competitive performance | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [C-MTEB](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB) benchmark | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-zh` | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a small-scale model but with competitive performance | `为这个句子生成表示以用于检索相关文章：` | [1\]: If you need to search the relevant passages to a query, we suggest to add the instruction to the query; in other cases, no instruction is needed, just use the original query directly. In all cases, **no instruction** needs to be added to passages. [2\]: Different from embedding model, reranker uses question and document as input and directly output similarity instead of embedding. To balance the accuracy and time cost, cross-encoder is widely used to re-rank top-k documents retrieved by other simple models. For examples, use bge embedding model to retrieve top 100 relevant documents, and then use bge reranker to re-rank the top 100 document to get the final top-3 results. All models have been uploaded to Huggingface Hub, and you can see them at https://huggingface.co/BAAI. If you cannot open the Huggingface Hub, you also can download the models at https://model.baai.ac.cn/models . ## Frequently asked questions <details> <summary>1. How to fine-tune bge embedding model?</summary> <!-- ### How to fine-tune bge embedding model? --> Following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) to prepare data and fine-tune your model. Some suggestions: - Mine hard negatives following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune#hard-negatives), which can improve the retrieval performance. - If you pre-train bge on your data, the pre-trained model cannot be directly used to calculate similarity, and it must be fine-tuned with contrastive learning before computing similarity. - If the accuracy of the fine-tuned model is still not high, it is recommended to use/fine-tune the cross-encoder model (bge-reranker) to re-rank top-k results. Hard negatives also are needed to fine-tune reranker. </details> <details> <summary>2. The similarity score between two dissimilar sentences is higher than 0.5</summary> <!-- ### The similarity score between two dissimilar sentences is higher than 0.5 --> **Suggest to use bge v1.5, which alleviates the issue of the similarity distribution.** Since we finetune the models by contrastive learning with a temperature of 0.01, the similarity distribution of the current BGE model is about in the interval \[0.6, 1\]. So a similarity score greater than 0.5 does not indicate that the two sentences are similar. For downstream tasks, such as passage retrieval or semantic similarity, **what matters is the relative order of the scores, not the absolute value.** If you need to filter similar sentences based on a similarity threshold, please select an appropriate similarity threshold based on the similarity distribution on your data (such as 0.8, 0.85, or even 0.9). </details> <details> <summary>3. When does the query instruction need to be used</summary> <!-- ### When does the query instruction need to be used --> For the `bge-*-v1.5`, we improve its retrieval ability when not using instruction. No instruction only has a slight degradation in retrieval performance compared with using instruction. So you can generate embedding without instruction in all cases for convenience. For a retrieval task that uses short queries to find long related documents, it is recommended to add instructions for these short queries. **The best method to decide whether to add instructions for queries is choosing the setting that achieves better performance on your task.** In all cases, the documents/passages do not need to add the instruction. </details> ## Usage ### Usage for Embedding Model Here are some examples for using `bge` models with [FlagEmbedding](#using-flagembedding), [Sentence-Transformers](#using-sentence-transformers), [Langchain](#using-langchain), or [Huggingface Transformers](#using-huggingface-transformers). #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` If it doesn't work for you, you can see [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md) for more methods to install FlagEmbedding. ```python from FlagEmbedding import FlagModel sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = FlagModel('BAAI/bge-large-zh-v1.5', query_instruction_for_retrieval="为这个句子生成表示以用于检索相关文章：", use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation embeddings_1 = model.encode(sentences_1) embeddings_2 = model.encode(sentences_2) similarity = embeddings_1 @ embeddings_2.T print(similarity) # for s2p(short query to long passage) retrieval task, suggest to use encode_queries() which will automatically add the instruction to each query # corpus in retrieval task can still use encode() or encode_corpus(), since they don't need instruction queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] q_embeddings = model.encode_queries(queries) p_embeddings = model.encode(passages) scores = q_embeddings @ p_embeddings.T ``` For the value of the argument `query_instruction_for_retrieval`, see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list). By default, FlagModel will use all available GPUs when encoding. Please set `os.environ["CUDA_VISIBLE_DEVICES"]` to select specific GPUs. You also can set `os.environ["CUDA_VISIBLE_DEVICES"]=""` to make all GPUs unavailable. #### Using Sentence-Transformers You can also use the `bge` models with [sentence-transformers](https://www.SBERT.net): ``` pip install -U sentence-transformers ``` ```python from sentence_transformers import SentenceTransformer sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = SentenceTransformer('BAAI/bge-large-zh-v1.5') embeddings_1 = model.encode(sentences_1, normalize_embeddings=True) embeddings_2 = model.encode(sentences_2, normalize_embeddings=True) similarity = embeddings_1 @ embeddings_2.T print(similarity) ``` For s2p(short query to long passage) retrieval task, each short query should start with an instruction (instructions see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list)). But the instruction is not needed for passages. ```python from sentence_transformers import SentenceTransformer queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] instruction = "为这个句子生成表示以用于检索相关文章：" model = SentenceTransformer('BAAI/bge-large-zh-v1.5') q_embeddings = model.encode([instruction+q for q in queries], normalize_embeddings=True) p_embeddings = model.encode(passages, normalize_embeddings=True) scores = q_embeddings @ p_embeddings.T ``` #### Using Langchain You can use `bge` in langchain like this: ```python from langchain.embeddings import HuggingFaceBgeEmbeddings model_name = "BAAI/bge-large-en-v1.5" model_kwargs = {'device': 'cuda'} encode_kwargs = {'normalize_embeddings': True} # set True to compute cosine similarity model = HuggingFaceBgeEmbeddings( model_name=model_name, model_kwargs=model_kwargs, encode_kwargs=encode_kwargs, query_instruction="为这个句子生成表示以用于检索相关文章：" ) model.query_instruction = "为这个句子生成表示以用于检索相关文章：" ``` #### Using HuggingFace Transformers With the transformers package, you can use the model like this: First, you pass your input through the transformer model, then you select the last hidden state of the first token (i.e., [CLS]) as the sentence embedding. ```python from transformers import AutoTokenizer, AutoModel import torch # Sentences we want sentence embeddings for sentences = ["样例数据-1", "样例数据-2"] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-large-zh-v1.5') model = AutoModel.from_pretrained('BAAI/bge-large-zh-v1.5') model.eval() # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # for s2p(short query to long passage) retrieval task, add an instruction to query (not add instruction for passages) # encoded_input = tokenizer([instruction + q for q in queries], padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, cls pooling. sentence_embeddings = model_output[0][:, 0] # normalize embeddings sentence_embeddings = torch.nn.functional.normalize(sentence_embeddings, p=2, dim=1) print("Sentence embeddings:", sentence_embeddings) ``` #### Usage of the ONNX files ```python from optimum.onnxruntime import ORTModelForFeatureExtraction # type: ignore import torch from transformers import AutoModel, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-large-en-v1.5') model = AutoModel.from_pretrained('BAAI/bge-large-en-v1.5', revision="refs/pr/13") model_ort = ORTModelForFeatureExtraction.from_pretrained('BAAI/bge-large-en-v1.5', revision="refs/pr/13",file_name="onnx/model.onnx") # Sentences we want sentence embeddings for sentences = ["样例数据-1", "样例数据-2"] # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # for s2p(short query to long passage) retrieval task, add an instruction to query (not add instruction for passages) # encoded_input = tokenizer([instruction + q for q in queries], padding=True, truncation=True, return_tensors='pt') model_output_ort = model_ort(**encoded_input) # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # model_output and model_output_ort are identical ``` Its also possible to deploy the onnx files with the [infinity_emb](https://github.com/michaelfeil/infinity) pip package. ```python import asyncio from infinity_emb import AsyncEmbeddingEngine, EngineArgs sentences = ["Embed this is sentence via Infinity.", "Paris is in France."] engine = AsyncEmbeddingEngine.from_args( EngineArgs(model_name_or_path = "BAAI/bge-large-en-v1.5", device="cpu", engine="optimum" # or engine="torch" )) async def main(): async with engine: embeddings, usage = await engine.embed(sentences=sentences) asyncio.run(main()) ``` ### Usage for Reranker Different from embedding model, reranker uses question and document as input and directly output similarity instead of embedding. You can get a relevance score by inputting query and passage to the reranker. The reranker is optimized based cross-entropy loss, so the relevance score is not bounded to a specific range. #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` Get relevance scores (higher scores indicate more relevance): ```python from FlagEmbedding import FlagReranker reranker = FlagReranker('BAAI/bge-reranker-large', use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation score = reranker.compute_score(['query', 'passage']) print(score) scores = reranker.compute_score([['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']]) print(scores) ``` #### Using Huggingface transformers ```python import torch from transformers import AutoModelForSequenceClassification, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-reranker-large') model = AutoModelForSequenceClassification.from_pretrained('BAAI/bge-reranker-large') model.eval() pairs = [['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']] with torch.no_grad(): inputs = tokenizer(pairs, padding=True, truncation=True, return_tensors='pt', max_length=512) scores = model(**inputs, return_dict=True).logits.view(-1, ).float() print(scores) ``` ## Evaluation `baai-general-embedding` models achieve **state-of-the-art performance on both MTEB and C-MTEB leaderboard!** For more details and evaluation tools see our [scripts](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md). - **MTEB**: | Model Name | Dimension | Sequence Length | Average (56) | Retrieval (15) |Clustering (11) | Pair Classification (3) | Reranking (4) | STS (10) | Summarization (1) | Classification (12) | |:----:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:| | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | 1024 | 512 | **64.23** | **54.29** | 46.08 | 87.12 | 60.03 | 83.11 | 31.61 | 75.97 | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | 768 | 512 | 63.55 | 53.25 | 45.77 | 86.55 | 58.86 | 82.4 | 31.07 | 75.53 | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | 384 | 512 | 62.17 |51.68 | 43.82 | 84.92 | 58.36 | 81.59 | 30.12 | 74.14 | | [bge-large-en](https://huggingface.co/BAAI/bge-large-en) | 1024 | 512 | 63.98 | 53.9 | 46.98 | 85.8 | 59.48 | 81.56 | 32.06 | 76.21 | | [bge-base-en](https://huggingface.co/BAAI/bge-base-en) | 768 | 512 | 63.36 | 53.0 | 46.32 | 85.86 | 58.7 | 81.84 | 29.27 | 75.27 | | [gte-large](https://huggingface.co/thenlper/gte-large) | 1024 | 512 | 63.13 | 52.22 | 46.84 | 85.00 | 59.13 | 83.35 | 31.66 | 73.33 | | [gte-base](https://huggingface.co/thenlper/gte-base) | 768 | 512 | 62.39 | 51.14 | 46.2 | 84.57 | 58.61 | 82.3 | 31.17 | 73.01 | | [e5-large-v2](https://huggingface.co/intfloat/e5-large-v2) | 1024| 512 | 62.25 | 50.56 | 44.49 | 86.03 | 56.61 | 82.05 | 30.19 | 75.24 | | [bge-small-en](https://huggingface.co/BAAI/bge-small-en) | 384 | 512 | 62.11 | 51.82 | 44.31 | 83.78 | 57.97 | 80.72 | 30.53 | 74.37 | | [instructor-xl](https://huggingface.co/hkunlp/instructor-xl) | 768 | 512 | 61.79 | 49.26 | 44.74 | 86.62 | 57.29 | 83.06 | 32.32 | 61.79 | | [e5-base-v2](https://huggingface.co/intfloat/e5-base-v2) | 768 | 512 | 61.5 | 50.29 | 43.80 | 85.73 | 55.91 | 81.05 | 30.28 | 73.84 | | [gte-small](https://huggingface.co/thenlper/gte-small) | 384 | 512 | 61.36 | 49.46 | 44.89 | 83.54 | 57.7 | 82.07 | 30.42 | 72.31 | | [text-embedding-ada-002](https://platform.openai.com/docs/guides/embeddings) | 1536 | 8192 | 60.99 | 49.25 | 45.9 | 84.89 | 56.32 | 80.97 | 30.8 | 70.93 | | [e5-small-v2](https://huggingface.co/intfloat/e5-base-v2) | 384 | 512 | 59.93 | 49.04 | 39.92 | 84.67 | 54.32 | 80.39 | 31.16 | 72.94 | | [sentence-t5-xxl](https://huggingface.co/sentence-transformers/sentence-t5-xxl) | 768 | 512 | 59.51 | 42.24 | 43.72 | 85.06 | 56.42 | 82.63 | 30.08 | 73.42 | | [all-mpnet-base-v2](https://huggingface.co/sentence-transformers/all-mpnet-base-v2) | 768 | 514 | 57.78 | 43.81 | 43.69 | 83.04 | 59.36 | 80.28 | 27.49 | 65.07 | | [sgpt-bloom-7b1-msmarco](https://huggingface.co/bigscience/sgpt-bloom-7b1-msmarco) | 4096 | 2048 | 57.59 | 48.22 | 38.93 | 81.9 | 55.65 | 77.74 | 33.6 | 66.19 | - **C-MTEB**: We create the benchmark C-MTEB for Chinese text embedding which consists of 31 datasets from 6 tasks. Please refer to [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md) for a detailed introduction. | Model | Embedding dimension | Avg | Retrieval | STS | PairClassification | Classification | Reranking | Clustering | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | [**BAAI/bge-large-zh-v1.5**](https://huggingface.co/BAAI/bge-large-zh-v1.5) | 1024 | **64.53** | 70.46 | 56.25 | 81.6 | 69.13 | 65.84 | 48.99 | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | 768 | 63.13 | 69.49 | 53.72 | 79.75 | 68.07 | 65.39 | 47.53 | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | 512 | 57.82 | 61.77 | 49.11 | 70.41 | 63.96 | 60.92 | 44.18 | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | 1024 | 64.20 | 71.53 | 54.98 | 78.94 | 68.32 | 65.11 | 48.39 | | [bge-large-zh-noinstruct](https://huggingface.co/BAAI/bge-large-zh-noinstruct) | 1024 | 63.53 | 70.55 | 53 | 76.77 | 68.58 | 64.91 | 50.01 | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | 768 | 62.96 | 69.53 | 54.12 | 77.5 | 67.07 | 64.91 | 47.63 | | [multilingual-e5-large](https://huggingface.co/intfloat/multilingual-e5-large) | 1024 | 58.79 | 63.66 | 48.44 | 69.89 | 67.34 | 56.00 | 48.23 | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | 512 | 58.27 | 63.07 | 49.45 | 70.35 | 63.64 | 61.48 | 45.09 | | [m3e-base](https://huggingface.co/moka-ai/m3e-base) | 768 | 57.10 | 56.91 | 50.47 | 63.99 | 67.52 | 59.34 | 47.68 | | [m3e-large](https://huggingface.co/moka-ai/m3e-large) | 1024 | 57.05 | 54.75 | 50.42 | 64.3 | 68.2 | 59.66 | 48.88 | | [multilingual-e5-base](https://huggingface.co/intfloat/multilingual-e5-base) | 768 | 55.48 | 61.63 | 46.49 | 67.07 | 65.35 | 54.35 | 40.68 | | [multilingual-e5-small](https://huggingface.co/intfloat/multilingual-e5-small) | 384 | 55.38 | 59.95 | 45.27 | 66.45 | 65.85 | 53.86 | 45.26 | | [text-embedding-ada-002(OpenAI)](https://platform.openai.com/docs/guides/embeddings/what-are-embeddings) | 1536 | 53.02 | 52.0 | 43.35 | 69.56 | 64.31 | 54.28 | 45.68 | | [luotuo](https://huggingface.co/silk-road/luotuo-bert-medium) | 1024 | 49.37 | 44.4 | 42.78 | 66.62 | 61 | 49.25 | 44.39 | | [text2vec-base](https://huggingface.co/shibing624/text2vec-base-chinese) | 768 | 47.63 | 38.79 | 43.41 | 67.41 | 62.19 | 49.45 | 37.66 | | [text2vec-large](https://huggingface.co/GanymedeNil/text2vec-large-chinese) | 1024 | 47.36 | 41.94 | 44.97 | 70.86 | 60.66 | 49.16 | 30.02 | - **Reranking**: See [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/) for evaluation script. | Model | T2Reranking | T2RerankingZh2En\* | T2RerankingEn2Zh\* | MMarcoReranking | CMedQAv1 | CMedQAv2 | Avg | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | text2vec-base-multilingual | 64.66 | 62.94 | 62.51 | 14.37 | 48.46 | 48.6 | 50.26 | | multilingual-e5-small | 65.62 | 60.94 | 56.41 | 29.91 | 67.26 | 66.54 | 57.78 | | multilingual-e5-large | 64.55 | 61.61 | 54.28 | 28.6 | 67.42 | 67.92 | 57.4 | | multilingual-e5-base | 64.21 | 62.13 | 54.68 | 29.5 | 66.23 | 66.98 | 57.29 | | m3e-base | 66.03 | 62.74 | 56.07 | 17.51 | 77.05 | 76.76 | 59.36 | | m3e-large | 66.13 | 62.72 | 56.1 | 16.46 | 77.76 | 78.27 | 59.57 | | bge-base-zh-v1.5 | 66.49 | 63.25 | 57.02 | 29.74 | 80.47 | 84.88 | 63.64 | | bge-large-zh-v1.5 | 65.74 | 63.39 | 57.03 | 28.74 | 83.45 | 85.44 | 63.97 | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | 67.28 | 63.95 | 60.45 | 35.46 | 81.26 | 84.1 | 65.42 | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | 67.6 | 64.03 | 61.44 | 37.16 | 82.15 | 84.18 | 66.09 | \* : T2RerankingZh2En and T2RerankingEn2Zh are cross-language retrieval tasks ## Train ### BAAI Embedding We pre-train the models using [retromae](https://github.com/staoxiao/RetroMAE) and train them on large-scale pairs data using contrastive learning. **You can fine-tune the embedding model on your data following our [examples](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune).** We also provide a [pre-train example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/pretrain). Note that the goal of pre-training is to reconstruct the text, and the pre-trained model cannot be used for similarity calculation directly, it needs to be fine-tuned. More training details for bge see [baai_general_embedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md). ### BGE Reranker Cross-encoder will perform full-attention over the input pair, which is more accurate than embedding model (i.e., bi-encoder) but more time-consuming than embedding model. Therefore, it can be used to re-rank the top-k documents returned by embedding model. We train the cross-encoder on a multilingual pair data, The data format is the same as embedding model, so you can fine-tune it easily following our [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker). More details please refer to [./FlagEmbedding/reranker/README.md](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker) ## Contact If you have any question or suggestion related to this project, feel free to open an issue or pull request. You also can email Shitao Xiao(stxiao@baai.ac.cn) and Zheng Liu(liuzheng@baai.ac.cn). ## Citation If you find this repository useful, please consider giving a star :star: and citation ``` @misc{bge_embedding, title={C-Pack: Packaged Resources To Advance General Chinese Embedding}, author={Shitao Xiao and Zheng Liu and Peitian Zhang and Niklas Muennighoff}, year={2023}, eprint={2309.07597}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` ## License FlagEmbedding is licensed under the [MIT License](https://github.com/FlagOpen/FlagEmbedding/blob/master/LICENSE). The released models can be used for commercial purposes free of charge.

lmsys/fastchat-t5-3b-v1.0

lmsys

transformers

text2text-generation

--- license: apache-2.0 inference: false --- # FastChat-T5 Model Card ## Model details **Model type:** FastChat-T5 is an open-source chatbot trained by fine-tuning Flan-t5-xl (3B parameters) on user-shared conversations collected from ShareGPT. It is based on an encoder-decoder transformer architecture, and can autoregressively generate responses to users' inputs. **Model date:** FastChat-T5 was trained on April 2023. **Organizations developing the model:** The FastChat developers, primarily Dacheng Li, Lianmin Zheng and Hao Zhang. **Paper or resources for more information:** https://github.com/lm-sys/FastChat#FastChat-T5 **License:** Apache License 2.0 **Where to send questions or comments about the model:** https://github.com/lm-sys/FastChat/issues ## Intended use **Primary intended uses:** The primary use of FastChat-T5 is the commercial usage of large language models and chatbots. It can also be used for research purposes. **Primary intended users:** The primary intended users of the model are entrepreneurs and researchers in natural language processing, machine learning, and artificial intelligence. ## Training dataset 70K conversations collected from ShareGPT.com. ## Training details It processes the ShareGPT data in the form of question answering. Each ChatGPT response is processed as an answer, and previous conversations between the user and the ChatGPT are processed as the question. The encoder bi-directionally encodes a question into a hidden representation. The decoder uses cross-attention to attend to this representation while generating an answer uni-directionally from a start token. This model is fine-tuned for 3 epochs, with a max learning rate 2e-5, warmup ratio 0.03, and a cosine learning rate schedule. ## Evaluation dataset A preliminary evaluation of the model quality is conducted by creating a set of 80 diverse questions and utilizing GPT-4 to judge the model outputs. See https://vicuna.lmsys.org/ for more details.

meta-llama/Llama-2-7b-hf

meta-llama

transformers

text-generation

--- extra_gated_heading: You need to share contact information with Meta to access this model extra_gated_prompt: >- ### LLAMA 2 COMMUNITY LICENSE AGREEMENT "Agreement" means the terms and conditions for use, reproduction, distribution and modification of the Llama Materials set forth herein. "Documentation" means the specifications, manuals and documentation accompanying Llama 2 distributed by Meta at https://ai.meta.com/resources/models-and-libraries/llama-downloads/. "Licensee" or "you" means you, or your employer or any other person or entity (if you are entering into this Agreement on such person or entity's behalf), of the age required under applicable laws, rules or regulations to provide legal consent and that has legal authority to bind your employer or such other person or entity if you are entering in this Agreement on their behalf. "Llama 2" means the foundational large language models and software and algorithms, including machine-learning model code, trained model weights, inference-enabling code, training-enabling code, fine-tuning enabling code and other elements of the foregoing distributed by Meta at ai.meta.com/resources/models-and-libraries/llama-downloads/. "Llama Materials" means, collectively, Meta's proprietary Llama 2 and documentation (and any portion thereof) made available under this Agreement. "Meta" or "we" means Meta Platforms Ireland Limited (if you are located in or, if you are an entity, your principal place of business is in the EEA or Switzerland) and Meta Platforms, Inc. (if you are located outside of the EEA or Switzerland). By clicking "I Accept" below or by using or distributing any portion or element of the Llama Materials, you agree to be bound by this Agreement. 1. License Rights and Redistribution. a. Grant of Rights. You are granted a non-exclusive, worldwide, non- transferable and royalty-free limited license under Meta's intellectual property or other rights owned by Meta embodied in the Llama Materials to use, reproduce, distribute, copy, create derivative works of, and make modifications to the Llama Materials. b. Redistribution and Use. i. If you distribute or make the Llama Materials, or any derivative works thereof, available to a third party, you shall provide a copy of this Agreement to such third party. ii. If you receive Llama Materials, or any derivative works thereof, from a Licensee as part of an integrated end user product, then Section 2 of this Agreement will not apply to you. iii. You must retain in all copies of the Llama Materials that you distribute the following attribution notice within a "Notice" text file distributed as a part of such copies: "Llama 2 is licensed under the LLAMA 2 Community License, Copyright (c) Meta Platforms, Inc. All Rights Reserved." iv. Your use of the Llama Materials must comply with applicable laws and regulations (including trade compliance laws and regulations) and adhere to the Acceptable Use Policy for the Llama Materials (available at https://ai.meta.com/llama/use-policy), which is hereby incorporated by reference into this Agreement. v. You will not use the Llama Materials or any output or results of the Llama Materials to improve any other large language model (excluding Llama 2 or derivative works thereof). 2. Additional Commercial Terms. If, on the Llama 2 version release date, the monthly active users of the products or services made available by or for Licensee, or Licensee's affiliates, is greater than 700 million monthly active users in the preceding calendar month, you must request a license from Meta, which Meta may grant to you in its sole discretion, and you are not authorized to exercise any of the rights under this Agreement unless or until Meta otherwise expressly grants you such rights. 3. Disclaimer of Warranty. UNLESS REQUIRED BY APPLICABLE LAW, THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS THEREFROM ARE PROVIDED ON AN "AS IS" BASIS, WITHOUT WARRANTIES OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING, WITHOUT LIMITATION, ANY WARRANTIES OF TITLE, NON-INFRINGEMENT, MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE. YOU ARE SOLELY RESPONSIBLE FOR DETERMINING THE APPROPRIATENESS OF USING OR REDISTRIBUTING THE LLAMA MATERIALS AND ASSUME ANY RISKS ASSOCIATED WITH YOUR USE OF THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS. 4. Limitation of Liability. IN NO EVENT WILL META OR ITS AFFILIATES BE LIABLE UNDER ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, TORT, NEGLIGENCE, PRODUCTS LIABILITY, OR OTHERWISE, ARISING OUT OF THIS AGREEMENT, FOR ANY LOST PROFITS OR ANY INDIRECT, SPECIAL, CONSEQUENTIAL, INCIDENTAL, EXEMPLARY OR PUNITIVE DAMAGES, EVEN IF META OR ITS AFFILIATES HAVE BEEN ADVISED OF THE POSSIBILITY OF ANY OF THE FOREGOING. 5. Intellectual Property. a. No trademark licenses are granted under this Agreement, and in connection with the Llama Materials, neither Meta nor Licensee may use any name or mark owned by or associated with the other or any of its affiliates, except as required for reasonable and customary use in describing and redistributing the Llama Materials. b. Subject to Meta's ownership of Llama Materials and derivatives made by or for Meta, with respect to any derivative works and modifications of the Llama Materials that are made by you, as between you and Meta, you are and will be the owner of such derivative works and modifications. c. If you institute litigation or other proceedings against Meta or any entity (including a cross-claim or counterclaim in a lawsuit) alleging that the Llama Materials or Llama 2 outputs or results, or any portion of any of the foregoing, constitutes infringement of intellectual property or other rights owned or licensable by you, then any licenses granted to you under this Agreement shall terminate as of the date such litigation or claim is filed or instituted. You will indemnify and hold harmless Meta from and against any claim by any third party arising out of or related to your use or distribution of the Llama Materials. 6. Term and Termination. The term of this Agreement will commence upon your acceptance of this Agreement or access to the Llama Materials and will continue in full force and effect until terminated in accordance with the terms and conditions herein. Meta may terminate this Agreement if you are in breach of any term or condition of this Agreement. Upon termination of this Agreement, you shall delete and cease use of the Llama Materials. Sections 3, 4 and 7 shall survive the termination of this Agreement. 7. Governing Law and Jurisdiction. This Agreement will be governed and construed under the laws of the State of California without regard to choice of law principles, and the UN Convention on Contracts for the International Sale of Goods does not apply to this Agreement. The courts of California shall have exclusive jurisdiction of any dispute arising out of this Agreement. USE POLICY ### Llama 2 Acceptable Use Policy Meta is committed to promoting safe and fair use of its tools and features, including Llama 2. If you access or use Llama 2, you agree to this Acceptable Use Policy (“Policy”). The most recent copy of this policy can be found at [ai.meta.com/llama/use-policy](http://ai.meta.com/llama/use-policy). #### Prohibited Uses We want everyone to use Llama 2 safely and responsibly. You agree you will not use, or allow others to use, Llama 2 to: 1. Violate the law or others’ rights, including to: 1. Engage in, promote, generate, contribute to, encourage, plan, incite, or further illegal or unlawful activity or content, such as: 1. Violence or terrorism 2. Exploitation or harm to children, including the solicitation, creation, acquisition, or dissemination of child exploitative content or failure to report Child Sexual Abuse Material 3. Human trafficking, exploitation, and sexual violence 4. The illegal distribution of information or materials to minors, including obscene materials, or failure to employ legally required age-gating in connection with such information or materials. 5. Sexual solicitation 6. Any other criminal activity 2. Engage in, promote, incite, or facilitate the harassment, abuse, threatening, or bullying of individuals or groups of individuals 3. Engage in, promote, incite, or facilitate discrimination or other unlawful or harmful conduct in the provision of employment, employment benefits, credit, housing, other economic benefits, or other essential goods and services 4. Engage in the unauthorized or unlicensed practice of any profession including, but not limited to, financial, legal, medical/health, or related professional practices 5. Collect, process, disclose, generate, or infer health, demographic, or other sensitive personal or private information about individuals without rights and consents required by applicable laws 6. Engage in or facilitate any action or generate any content that infringes, misappropriates, or otherwise violates any third-party rights, including the outputs or results of any products or services using the Llama 2 Materials 7. Create, generate, or facilitate the creation of malicious code, malware, computer viruses or do anything else that could disable, overburden, interfere with or impair the proper working, integrity, operation or appearance of a website or computer system 2. Engage in, promote, incite, facilitate, or assist in the planning or development of activities that present a risk of death or bodily harm to individuals, including use of Llama 2 related to the following: 1. Military, warfare, nuclear industries or applications, espionage, use for materials or activities that are subject to the International Traffic Arms Regulations (ITAR) maintained by the United States Department of State 2. Guns and illegal weapons (including weapon development) 3. Illegal drugs and regulated/controlled substances 4. Operation of critical infrastructure, transportation technologies, or heavy machinery 5. Self-harm or harm to others, including suicide, cutting, and eating disorders 6. Any content intended to incite or promote violence, abuse, or any infliction of bodily harm to an individual 3. Intentionally deceive or mislead others, including use of Llama 2 related to the following: 1. Generating, promoting, or furthering fraud or the creation or promotion of disinformation 2. Generating, promoting, or furthering defamatory content, including the creation of defamatory statements, images, or other content 3. Generating, promoting, or further distributing spam 4. Impersonating another individual without consent, authorization, or legal right 5. Representing that the use of Llama 2 or outputs are human-generated 6. Generating or facilitating false online engagement, including fake reviews and other means of fake online engagement 4. Fail to appropriately disclose to end users any known dangers of your AI system Please report any violation of this Policy, software “bug,” or other problems that could lead to a violation of this Policy through one of the following means: * Reporting issues with the model: [github.com/facebookresearch/llama](http://github.com/facebookresearch/llama) * Reporting risky content generated by the model: [developers.facebook.com/llama_output_feedback](http://developers.facebook.com/llama_output_feedback) * Reporting bugs and security concerns: [facebook.com/whitehat/info](http://facebook.com/whitehat/info) * Reporting violations of the Acceptable Use Policy or unlicensed uses of Llama: [LlamaUseReport@meta.com](mailto:LlamaUseReport@meta.com) extra_gated_fields: First Name: text Last Name: text Date of birth: date_picker Country: country Affiliation: text geo: ip_location By clicking Submit below I accept the terms of the license and acknowledge that the information I provide will be collected stored processed and shared in accordance with the Meta Privacy Policy: checkbox extra_gated_description: The information you provide will be collected, stored, processed and shared in accordance with the [Meta Privacy Policy](https://www.facebook.com/privacy/policy/). extra_gated_button_content: Submit language: - en pipeline_tag: text-generation inference: false tags: - facebook - meta - pytorch - llama - llama-2 --- # **Llama 2** Llama 2 is a collection of pretrained and fine-tuned generative text models ranging in scale from 7 billion to 70 billion parameters. This is the repository for the 7B pretrained model, converted for the Hugging Face Transformers format. Links to other models can be found in the index at the bottom. ## Model Details *Note: Use of this model is governed by the Meta license. In order to download the model weights and tokenizer, please visit the [website](https://ai.meta.com/resources/models-and-libraries/llama-downloads/) and accept our License before requesting access here.* Meta developed and publicly released the Llama 2 family of large language models (LLMs), a collection of pretrained and fine-tuned generative text models ranging in scale from 7 billion to 70 billion parameters. Our fine-tuned LLMs, called Llama-2-Chat, are optimized for dialogue use cases. Llama-2-Chat models outperform open-source chat models on most benchmarks we tested, and in our human evaluations for helpfulness and safety, are on par with some popular closed-source models like ChatGPT and PaLM. **Model Developers** Meta **Variations** Llama 2 comes in a range of parameter sizes — 7B, 13B, and 70B — as well as pretrained and fine-tuned variations. **Input** Models input text only. **Output** Models generate text only. **Model Architecture** Llama 2 is an auto-regressive language model that uses an optimized transformer architecture. The tuned versions use supervised fine-tuning (SFT) and reinforcement learning with human feedback (RLHF) to align to human preferences for helpfulness and safety. ||Training Data|Params|Content Length|GQA|Tokens|LR| |---|---|---|---|---|---|---| |Llama 2|*A new mix of publicly available online data*|7B|4k|&#10007;|2.0T|3.0 x 10^-4| |Llama 2|*A new mix of publicly available online data*|13B|4k|&#10007;|2.0T|3.0 x 10^-4| |Llama 2|*A new mix of publicly available online data*|70B|4k|&#10004;|2.0T|1.5 x 10^-4| *Llama 2 family of models.* Token counts refer to pretraining data only. All models are trained with a global batch-size of 4M tokens. Bigger models - 70B -- use Grouped-Query Attention (GQA) for improved inference scalability. **Model Dates** Llama 2 was trained between January 2023 and July 2023. **Status** This is a static model trained on an offline dataset. Future versions of the tuned models will be released as we improve model safety with community feedback. **License** A custom commercial license is available at: [https://ai.meta.com/resources/models-and-libraries/llama-downloads/](https://ai.meta.com/resources/models-and-libraries/llama-downloads/) **Research Paper** ["Llama-2: Open Foundation and Fine-tuned Chat Models"](arxiv.org/abs/2307.09288) ## Intended Use **Intended Use Cases** Llama 2 is intended for commercial and research use in English. Tuned models are intended for assistant-like chat, whereas pretrained models can be adapted for a variety of natural language generation tasks. To get the expected features and performance for the chat versions, a specific formatting needs to be followed, including the `INST` and `<<SYS>>` tags, `BOS` and `EOS` tokens, and the whitespaces and breaklines in between (we recommend calling `strip()` on inputs to avoid double-spaces). See our reference code in github for details: [`chat_completion`](https://github.com/facebookresearch/llama/blob/main/llama/generation.py#L212). **Out-of-scope Uses** Use in any manner that violates applicable laws or regulations (including trade compliance laws).Use in languages other than English. Use in any other way that is prohibited by the Acceptable Use Policy and Licensing Agreement for Llama 2. ## Hardware and Software **Training Factors** We used custom training libraries, Meta's Research Super Cluster, and production clusters for pretraining. Fine-tuning, annotation, and evaluation were also performed on third-party cloud compute. **Carbon Footprint** Pretraining utilized a cumulative 3.3M GPU hours of computation on hardware of type A100-80GB (TDP of 350-400W). Estimated total emissions were 539 tCO2eq, 100% of which were offset by Meta’s sustainability program. ||Time (GPU hours)|Power Consumption (W)|Carbon Emitted(tCO₂eq)| |---|---|---|---| |Llama 2 7B|184320|400|31.22| |Llama 2 13B|368640|400|62.44| |Llama 2 70B|1720320|400|291.42| |Total|3311616||539.00| **CO₂ emissions during pretraining.** Time: total GPU time required for training each model. Power Consumption: peak power capacity per GPU device for the GPUs used adjusted for power usage efficiency. 100% of the emissions are directly offset by Meta's sustainability program, and because we are openly releasing these models, the pretraining costs do not need to be incurred by others. ## Training Data **Overview** Llama 2 was pretrained on 2 trillion tokens of data from publicly available sources. The fine-tuning data includes publicly available instruction datasets, as well as over one million new human-annotated examples. Neither the pretraining nor the fine-tuning datasets include Meta user data. **Data Freshness** The pretraining data has a cutoff of September 2022, but some tuning data is more recent, up to July 2023. ## Evaluation Results In this section, we report the results for the Llama 1 and Llama 2 models on standard academic benchmarks.For all the evaluations, we use our internal evaluations library. |Model|Size|Code|Commonsense Reasoning|World Knowledge|Reading Comprehension|Math|MMLU|BBH|AGI Eval| |---|---|---|---|---|---|---|---|---|---| |Llama 1|7B|14.1|60.8|46.2|58.5|6.95|35.1|30.3|23.9| |Llama 1|13B|18.9|66.1|52.6|62.3|10.9|46.9|37.0|33.9| |Llama 1|33B|26.0|70.0|58.4|67.6|21.4|57.8|39.8|41.7| |Llama 1|65B|30.7|70.7|60.5|68.6|30.8|63.4|43.5|47.6| |Llama 2|7B|16.8|63.9|48.9|61.3|14.6|45.3|32.6|29.3| |Llama 2|13B|24.5|66.9|55.4|65.8|28.7|54.8|39.4|39.1| |Llama 2|70B|**37.5**|**71.9**|**63.6**|**69.4**|**35.2**|**68.9**|**51.2**|**54.2**| **Overall performance on grouped academic benchmarks.** *Code:* We report the average pass@1 scores of our models on HumanEval and MBPP. *Commonsense Reasoning:* We report the average of PIQA, SIQA, HellaSwag, WinoGrande, ARC easy and challenge, OpenBookQA, and CommonsenseQA. We report 7-shot results for CommonSenseQA and 0-shot results for all other benchmarks. *World Knowledge:* We evaluate the 5-shot performance on NaturalQuestions and TriviaQA and report the average. *Reading Comprehension:* For reading comprehension, we report the 0-shot average on SQuAD, QuAC, and BoolQ. *MATH:* We report the average of the GSM8K (8 shot) and MATH (4 shot) benchmarks at top 1. |||TruthfulQA|Toxigen| |---|---|---|---| |Llama 1|7B|27.42|23.00| |Llama 1|13B|41.74|23.08| |Llama 1|33B|44.19|22.57| |Llama 1|65B|48.71|21.77| |Llama 2|7B|33.29|**21.25**| |Llama 2|13B|41.86|26.10| |Llama 2|70B|**50.18**|24.60| **Evaluation of pretrained LLMs on automatic safety benchmarks.** For TruthfulQA, we present the percentage of generations that are both truthful and informative (the higher the better). For ToxiGen, we present the percentage of toxic generations (the smaller the better). |||TruthfulQA|Toxigen| |---|---|---|---| |Llama-2-Chat|7B|57.04|**0.00**| |Llama-2-Chat|13B|62.18|**0.00**| |Llama-2-Chat|70B|**64.14**|0.01| **Evaluation of fine-tuned LLMs on different safety datasets.** Same metric definitions as above. ## Ethical Considerations and Limitations Llama 2 is a new technology that carries risks with use. Testing conducted to date has been in English, and has not covered, nor could it cover all scenarios. For these reasons, as with all LLMs, Llama 2’s potential outputs cannot be predicted in advance, and the model may in some instances produce inaccurate, biased or other objectionable responses to user prompts. Therefore, before deploying any applications of Llama 2, developers should perform safety testing and tuning tailored to their specific applications of the model. Please see the Responsible Use Guide available at [https://ai.meta.com/llama/responsible-use-guide/](https://ai.meta.com/llama/responsible-use-guide) ## Reporting Issues Please report any software “bug,” or other problems with the models through one of the following means: - Reporting issues with the model: [github.com/facebookresearch/llama](http://github.com/facebookresearch/llama) - Reporting problematic content generated by the model: [developers.facebook.com/llama_output_feedback](http://developers.facebook.com/llama_output_feedback) - Reporting bugs and security concerns: [facebook.com/whitehat/info](http://facebook.com/whitehat/info) ## Llama Model Index |Model|Llama2|Llama2-hf|Llama2-chat|Llama2-chat-hf| |---|---|---|---|---| |7B| [Link](https://huggingface.co/meta-llama/Llama-2-7b) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-chat-hf)| |13B| [Link](https://huggingface.co/meta-llama/Llama-2-13b) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-chat-hf)| |70B| [Link](https://huggingface.co/meta-llama/Llama-2-70b) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-chat-hf)|

meta-llama/Llama-2-13b-chat-hf

meta-llama

transformers

text-generation

--- extra_gated_heading: You need to share contact information with Meta to access this model extra_gated_prompt: >- ### LLAMA 2 COMMUNITY LICENSE AGREEMENT "Agreement" means the terms and conditions for use, reproduction, distribution and modification of the Llama Materials set forth herein. "Documentation" means the specifications, manuals and documentation accompanying Llama 2 distributed by Meta at https://ai.meta.com/resources/models-and-libraries/llama-downloads/. "Licensee" or "you" means you, or your employer or any other person or entity (if you are entering into this Agreement on such person or entity's behalf), of the age required under applicable laws, rules or regulations to provide legal consent and that has legal authority to bind your employer or such other person or entity if you are entering in this Agreement on their behalf. "Llama 2" means the foundational large language models and software and algorithms, including machine-learning model code, trained model weights, inference-enabling code, training-enabling code, fine-tuning enabling code and other elements of the foregoing distributed by Meta at ai.meta.com/resources/models-and-libraries/llama-downloads/. "Llama Materials" means, collectively, Meta's proprietary Llama 2 and documentation (and any portion thereof) made available under this Agreement. "Meta" or "we" means Meta Platforms Ireland Limited (if you are located in or, if you are an entity, your principal place of business is in the EEA or Switzerland) and Meta Platforms, Inc. (if you are located outside of the EEA or Switzerland). By clicking "I Accept" below or by using or distributing any portion or element of the Llama Materials, you agree to be bound by this Agreement. 1. License Rights and Redistribution. a. Grant of Rights. You are granted a non-exclusive, worldwide, non- transferable and royalty-free limited license under Meta's intellectual property or other rights owned by Meta embodied in the Llama Materials to use, reproduce, distribute, copy, create derivative works of, and make modifications to the Llama Materials. b. Redistribution and Use. i. If you distribute or make the Llama Materials, or any derivative works thereof, available to a third party, you shall provide a copy of this Agreement to such third party. ii. If you receive Llama Materials, or any derivative works thereof, from a Licensee as part of an integrated end user product, then Section 2 of this Agreement will not apply to you. iii. You must retain in all copies of the Llama Materials that you distribute the following attribution notice within a "Notice" text file distributed as a part of such copies: "Llama 2 is licensed under the LLAMA 2 Community License, Copyright (c) Meta Platforms, Inc. All Rights Reserved." iv. Your use of the Llama Materials must comply with applicable laws and regulations (including trade compliance laws and regulations) and adhere to the Acceptable Use Policy for the Llama Materials (available at https://ai.meta.com/llama/use-policy), which is hereby incorporated by reference into this Agreement. v. You will not use the Llama Materials or any output or results of the Llama Materials to improve any other large language model (excluding Llama 2 or derivative works thereof). 2. Additional Commercial Terms. If, on the Llama 2 version release date, the monthly active users of the products or services made available by or for Licensee, or Licensee's affiliates, is greater than 700 million monthly active users in the preceding calendar month, you must request a license from Meta, which Meta may grant to you in its sole discretion, and you are not authorized to exercise any of the rights under this Agreement unless or until Meta otherwise expressly grants you such rights. 3. Disclaimer of Warranty. UNLESS REQUIRED BY APPLICABLE LAW, THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS THEREFROM ARE PROVIDED ON AN "AS IS" BASIS, WITHOUT WARRANTIES OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING, WITHOUT LIMITATION, ANY WARRANTIES OF TITLE, NON-INFRINGEMENT, MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE. YOU ARE SOLELY RESPONSIBLE FOR DETERMINING THE APPROPRIATENESS OF USING OR REDISTRIBUTING THE LLAMA MATERIALS AND ASSUME ANY RISKS ASSOCIATED WITH YOUR USE OF THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS. 4. Limitation of Liability. IN NO EVENT WILL META OR ITS AFFILIATES BE LIABLE UNDER ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, TORT, NEGLIGENCE, PRODUCTS LIABILITY, OR OTHERWISE, ARISING OUT OF THIS AGREEMENT, FOR ANY LOST PROFITS OR ANY INDIRECT, SPECIAL, CONSEQUENTIAL, INCIDENTAL, EXEMPLARY OR PUNITIVE DAMAGES, EVEN IF META OR ITS AFFILIATES HAVE BEEN ADVISED OF THE POSSIBILITY OF ANY OF THE FOREGOING. 5. Intellectual Property. a. No trademark licenses are granted under this Agreement, and in connection with the Llama Materials, neither Meta nor Licensee may use any name or mark owned by or associated with the other or any of its affiliates, except as required for reasonable and customary use in describing and redistributing the Llama Materials. b. Subject to Meta's ownership of Llama Materials and derivatives made by or for Meta, with respect to any derivative works and modifications of the Llama Materials that are made by you, as between you and Meta, you are and will be the owner of such derivative works and modifications. c. If you institute litigation or other proceedings against Meta or any entity (including a cross-claim or counterclaim in a lawsuit) alleging that the Llama Materials or Llama 2 outputs or results, or any portion of any of the foregoing, constitutes infringement of intellectual property or other rights owned or licensable by you, then any licenses granted to you under this Agreement shall terminate as of the date such litigation or claim is filed or instituted. You will indemnify and hold harmless Meta from and against any claim by any third party arising out of or related to your use or distribution of the Llama Materials. 6. Term and Termination. The term of this Agreement will commence upon your acceptance of this Agreement or access to the Llama Materials and will continue in full force and effect until terminated in accordance with the terms and conditions herein. Meta may terminate this Agreement if you are in breach of any term or condition of this Agreement. Upon termination of this Agreement, you shall delete and cease use of the Llama Materials. Sections 3, 4 and 7 shall survive the termination of this Agreement. 7. Governing Law and Jurisdiction. This Agreement will be governed and construed under the laws of the State of California without regard to choice of law principles, and the UN Convention on Contracts for the International Sale of Goods does not apply to this Agreement. The courts of California shall have exclusive jurisdiction of any dispute arising out of this Agreement. USE POLICY ### Llama 2 Acceptable Use Policy Meta is committed to promoting safe and fair use of its tools and features, including Llama 2. If you access or use Llama 2, you agree to this Acceptable Use Policy (“Policy”). The most recent copy of this policy can be found at [ai.meta.com/llama/use-policy](http://ai.meta.com/llama/use-policy). #### Prohibited Uses We want everyone to use Llama 2 safely and responsibly. You agree you will not use, or allow others to use, Llama 2 to: 1. Violate the law or others’ rights, including to: 1. Engage in, promote, generate, contribute to, encourage, plan, incite, or further illegal or unlawful activity or content, such as: 1. Violence or terrorism 2. Exploitation or harm to children, including the solicitation, creation, acquisition, or dissemination of child exploitative content or failure to report Child Sexual Abuse Material 3. Human trafficking, exploitation, and sexual violence 4. The illegal distribution of information or materials to minors, including obscene materials, or failure to employ legally required age-gating in connection with such information or materials. 5. Sexual solicitation 6. Any other criminal activity 2. Engage in, promote, incite, or facilitate the harassment, abuse, threatening, or bullying of individuals or groups of individuals 3. Engage in, promote, incite, or facilitate discrimination or other unlawful or harmful conduct in the provision of employment, employment benefits, credit, housing, other economic benefits, or other essential goods and services 4. Engage in the unauthorized or unlicensed practice of any profession including, but not limited to, financial, legal, medical/health, or related professional practices 5. Collect, process, disclose, generate, or infer health, demographic, or other sensitive personal or private information about individuals without rights and consents required by applicable laws 6. Engage in or facilitate any action or generate any content that infringes, misappropriates, or otherwise violates any third-party rights, including the outputs or results of any products or services using the Llama 2 Materials 7. Create, generate, or facilitate the creation of malicious code, malware, computer viruses or do anything else that could disable, overburden, interfere with or impair the proper working, integrity, operation or appearance of a website or computer system 2. Engage in, promote, incite, facilitate, or assist in the planning or development of activities that present a risk of death or bodily harm to individuals, including use of Llama 2 related to the following: 1. Military, warfare, nuclear industries or applications, espionage, use for materials or activities that are subject to the International Traffic Arms Regulations (ITAR) maintained by the United States Department of State 2. Guns and illegal weapons (including weapon development) 3. Illegal drugs and regulated/controlled substances 4. Operation of critical infrastructure, transportation technologies, or heavy machinery 5. Self-harm or harm to others, including suicide, cutting, and eating disorders 6. Any content intended to incite or promote violence, abuse, or any infliction of bodily harm to an individual 3. Intentionally deceive or mislead others, including use of Llama 2 related to the following: 1. Generating, promoting, or furthering fraud or the creation or promotion of disinformation 2. Generating, promoting, or furthering defamatory content, including the creation of defamatory statements, images, or other content 3. Generating, promoting, or further distributing spam 4. Impersonating another individual without consent, authorization, or legal right 5. Representing that the use of Llama 2 or outputs are human-generated 6. Generating or facilitating false online engagement, including fake reviews and other means of fake online engagement 4. Fail to appropriately disclose to end users any known dangers of your AI system Please report any violation of this Policy, software “bug,” or other problems that could lead to a violation of this Policy through one of the following means: * Reporting issues with the model: [github.com/facebookresearch/llama](http://github.com/facebookresearch/llama) * Reporting risky content generated by the model: [developers.facebook.com/llama_output_feedback](http://developers.facebook.com/llama_output_feedback) * Reporting bugs and security concerns: [facebook.com/whitehat/info](http://facebook.com/whitehat/info) * Reporting violations of the Acceptable Use Policy or unlicensed uses of Llama: [LlamaUseReport@meta.com](mailto:LlamaUseReport@meta.com) extra_gated_fields: First Name: text Last Name: text Date of birth: date_picker Country: country Affiliation: text geo: ip_location By clicking Submit below I accept the terms of the license and acknowledge that the information I provide will be collected stored processed and shared in accordance with the Meta Privacy Policy: checkbox extra_gated_description: The information you provide will be collected, stored, processed and shared in accordance with the [Meta Privacy Policy](https://www.facebook.com/privacy/policy/). extra_gated_button_content: Submit language: - en pipeline_tag: text-generation inference: false tags: - facebook - meta - pytorch - llama - llama-2 --- # **Llama 2** Llama 2 is a collection of pretrained and fine-tuned generative text models ranging in scale from 7 billion to 70 billion parameters. This is the repository for the 13B fine-tuned model, optimized for dialogue use cases and converted for the Hugging Face Transformers format. Links to other models can be found in the index at the bottom. ## Model Details *Note: Use of this model is governed by the Meta license. In order to download the model weights and tokenizer, please visit the [website](https://ai.meta.com/resources/models-and-libraries/llama-downloads/) and accept our License before requesting access here.* Meta developed and publicly released the Llama 2 family of large language models (LLMs), a collection of pretrained and fine-tuned generative text models ranging in scale from 7 billion to 70 billion parameters. Our fine-tuned LLMs, called Llama-2-Chat, are optimized for dialogue use cases. Llama-2-Chat models outperform open-source chat models on most benchmarks we tested, and in our human evaluations for helpfulness and safety, are on par with some popular closed-source models like ChatGPT and PaLM. **Model Developers** Meta **Variations** Llama 2 comes in a range of parameter sizes — 7B, 13B, and 70B — as well as pretrained and fine-tuned variations. **Input** Models input text only. **Output** Models generate text only. **Model Architecture** Llama 2 is an auto-regressive language model that uses an optimized transformer architecture. The tuned versions use supervised fine-tuning (SFT) and reinforcement learning with human feedback (RLHF) to align to human preferences for helpfulness and safety. ||Training Data|Params|Content Length|GQA|Tokens|LR| |---|---|---|---|---|---|---| |Llama 2|*A new mix of publicly available online data*|7B|4k|&#10007;|2.0T|3.0 x 10^-4| |Llama 2|*A new mix of publicly available online data*|13B|4k|&#10007;|2.0T|3.0 x 10^-4| |Llama 2|*A new mix of publicly available online data*|70B|4k|&#10004;|2.0T|1.5 x 10^-4| *Llama 2 family of models.* Token counts refer to pretraining data only. All models are trained with a global batch-size of 4M tokens. Bigger models - 70B -- use Grouped-Query Attention (GQA) for improved inference scalability. **Model Dates** Llama 2 was trained between January 2023 and July 2023. **Status** This is a static model trained on an offline dataset. Future versions of the tuned models will be released as we improve model safety with community feedback. **License** A custom commercial license is available at: [https://ai.meta.com/resources/models-and-libraries/llama-downloads/](https://ai.meta.com/resources/models-and-libraries/llama-downloads/) **Research Paper** ["Llama-2: Open Foundation and Fine-tuned Chat Models"](arxiv.org/abs/2307.09288) ## Intended Use **Intended Use Cases** Llama 2 is intended for commercial and research use in English. Tuned models are intended for assistant-like chat, whereas pretrained models can be adapted for a variety of natural language generation tasks. To get the expected features and performance for the chat versions, a specific formatting needs to be followed, including the `INST` and `<<SYS>>` tags, `BOS` and `EOS` tokens, and the whitespaces and breaklines in between (we recommend calling `strip()` on inputs to avoid double-spaces). See our reference code in github for details: [`chat_completion`](https://github.com/facebookresearch/llama/blob/main/llama/generation.py#L212). **Out-of-scope Uses** Use in any manner that violates applicable laws or regulations (including trade compliance laws).Use in languages other than English. Use in any other way that is prohibited by the Acceptable Use Policy and Licensing Agreement for Llama 2. ## Hardware and Software **Training Factors** We used custom training libraries, Meta's Research Super Cluster, and production clusters for pretraining. Fine-tuning, annotation, and evaluation were also performed on third-party cloud compute. **Carbon Footprint** Pretraining utilized a cumulative 3.3M GPU hours of computation on hardware of type A100-80GB (TDP of 350-400W). Estimated total emissions were 539 tCO2eq, 100% of which were offset by Meta’s sustainability program. ||Time (GPU hours)|Power Consumption (W)|Carbon Emitted(tCO₂eq)| |---|---|---|---| |Llama 2 7B|184320|400|31.22| |Llama 2 13B|368640|400|62.44| |Llama 2 70B|1720320|400|291.42| |Total|3311616||539.00| **CO₂ emissions during pretraining.** Time: total GPU time required for training each model. Power Consumption: peak power capacity per GPU device for the GPUs used adjusted for power usage efficiency. 100% of the emissions are directly offset by Meta's sustainability program, and because we are openly releasing these models, the pretraining costs do not need to be incurred by others. ## Training Data **Overview** Llama 2 was pretrained on 2 trillion tokens of data from publicly available sources. The fine-tuning data includes publicly available instruction datasets, as well as over one million new human-annotated examples. Neither the pretraining nor the fine-tuning datasets include Meta user data. **Data Freshness** The pretraining data has a cutoff of September 2022, but some tuning data is more recent, up to July 2023. ## Evaluation Results In this section, we report the results for the Llama 1 and Llama 2 models on standard academic benchmarks.For all the evaluations, we use our internal evaluations library. |Model|Size|Code|Commonsense Reasoning|World Knowledge|Reading Comprehension|Math|MMLU|BBH|AGI Eval| |---|---|---|---|---|---|---|---|---|---| |Llama 1|7B|14.1|60.8|46.2|58.5|6.95|35.1|30.3|23.9| |Llama 1|13B|18.9|66.1|52.6|62.3|10.9|46.9|37.0|33.9| |Llama 1|33B|26.0|70.0|58.4|67.6|21.4|57.8|39.8|41.7| |Llama 1|65B|30.7|70.7|60.5|68.6|30.8|63.4|43.5|47.6| |Llama 2|7B|16.8|63.9|48.9|61.3|14.6|45.3|32.6|29.3| |Llama 2|13B|24.5|66.9|55.4|65.8|28.7|54.8|39.4|39.1| |Llama 2|70B|**37.5**|**71.9**|**63.6**|**69.4**|**35.2**|**68.9**|**51.2**|**54.2**| **Overall performance on grouped academic benchmarks.** *Code:* We report the average pass@1 scores of our models on HumanEval and MBPP. *Commonsense Reasoning:* We report the average of PIQA, SIQA, HellaSwag, WinoGrande, ARC easy and challenge, OpenBookQA, and CommonsenseQA. We report 7-shot results for CommonSenseQA and 0-shot results for all other benchmarks. *World Knowledge:* We evaluate the 5-shot performance on NaturalQuestions and TriviaQA and report the average. *Reading Comprehension:* For reading comprehension, we report the 0-shot average on SQuAD, QuAC, and BoolQ. *MATH:* We report the average of the GSM8K (8 shot) and MATH (4 shot) benchmarks at top 1. |||TruthfulQA|Toxigen| |---|---|---|---| |Llama 1|7B|27.42|23.00| |Llama 1|13B|41.74|23.08| |Llama 1|33B|44.19|22.57| |Llama 1|65B|48.71|21.77| |Llama 2|7B|33.29|**21.25**| |Llama 2|13B|41.86|26.10| |Llama 2|70B|**50.18**|24.60| **Evaluation of pretrained LLMs on automatic safety benchmarks.** For TruthfulQA, we present the percentage of generations that are both truthful and informative (the higher the better). For ToxiGen, we present the percentage of toxic generations (the smaller the better). |||TruthfulQA|Toxigen| |---|---|---|---| |Llama-2-Chat|7B|57.04|**0.00**| |Llama-2-Chat|13B|62.18|**0.00**| |Llama-2-Chat|70B|**64.14**|0.01| **Evaluation of fine-tuned LLMs on different safety datasets.** Same metric definitions as above. ## Ethical Considerations and Limitations Llama 2 is a new technology that carries risks with use. Testing conducted to date has been in English, and has not covered, nor could it cover all scenarios. For these reasons, as with all LLMs, Llama 2’s potential outputs cannot be predicted in advance, and the model may in some instances produce inaccurate, biased or other objectionable responses to user prompts. Therefore, before deploying any applications of Llama 2, developers should perform safety testing and tuning tailored to their specific applications of the model. Please see the Responsible Use Guide available at [https://ai.meta.com/llama/responsible-use-guide/](https://ai.meta.com/llama/responsible-use-guide) ## Reporting Issues Please report any software “bug,” or other problems with the models through one of the following means: - Reporting issues with the model: [github.com/facebookresearch/llama](http://github.com/facebookresearch/llama) - Reporting problematic content generated by the model: [developers.facebook.com/llama_output_feedback](http://developers.facebook.com/llama_output_feedback) - Reporting bugs and security concerns: [facebook.com/whitehat/info](http://facebook.com/whitehat/info) ## Llama Model Index |Model|Llama2|Llama2-hf|Llama2-chat|Llama2-chat-hf| |---|---|---|---|---| |7B| [Link](https://huggingface.co/meta-llama/Llama-2-7b) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-chat-hf)| |13B| [Link](https://huggingface.co/meta-llama/Llama-2-13b) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-chat-hf)| |70B| [Link](https://huggingface.co/meta-llama/Llama-2-70b) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-chat-hf)|

liuhaotian/llava-v1.6-34b

liuhaotian

transformers

text-generation

--- inference: false license: apache-2.0 --- <br> <br> # LLaVA Model Card ## Model details **Model type:** LLaVA is an open-source chatbot trained by fine-tuning LLM on multimodal instruction-following data. It is an auto-regressive language model, based on the transformer architecture. Base LLM: [NousResearch/Nous-Hermes-2-Yi-34B](https://huggingface.co/NousResearch/Nous-Hermes-2-Yi-34B) **Model date:** LLaVA-v1.6-34B was trained in December 2023. **Paper or resources for more information:** https://llava-vl.github.io/ ## License [NousResearch/Nous-Hermes-2-Yi-34B](https://huggingface.co/NousResearch/Nous-Hermes-2-Yi-34B) license. **Where to send questions or comments about the model:** https://github.com/haotian-liu/LLaVA/issues ## Intended use **Primary intended uses:** The primary use of LLaVA is research on large multimodal models and chatbots. **Primary intended users:** The primary intended users of the model are researchers and hobbyists in computer vision, natural language processing, machine learning, and artificial intelligence. ## Training dataset - 558K filtered image-text pairs from LAION/CC/SBU, captioned by BLIP. - 158K GPT-generated multimodal instruction-following data. - 500K academic-task-oriented VQA data mixture. - 50K GPT-4V data mixture. - 40K ShareGPT data. ## Evaluation dataset A collection of 12 benchmarks, including 5 academic VQA benchmarks and 7 recent benchmarks specifically proposed for instruction-following LMMs.

facebook/m2m100_418M

facebook

transformers

text2text-generation

--- language: - multilingual - af - am - ar - ast - az - ba - be - bg - bn - br - bs - ca - ceb - cs - cy - da - de - el - en - es - et - fa - ff - fi - fr - fy - ga - gd - gl - gu - ha - he - hi - hr - ht - hu - hy - id - ig - ilo - is - it - ja - jv - ka - kk - km - kn - ko - lb - lg - ln - lo - lt - lv - mg - mk - ml - mn - mr - ms - my - ne - nl - no - ns - oc - or - pa - pl - ps - pt - ro - ru - sd - si - sk - sl - so - sq - sr - ss - su - sv - sw - ta - th - tl - tn - tr - uk - ur - uz - vi - wo - xh - yi - yo - zh - zu license: mit --- # M2M100 418M M2M100 is a multilingual encoder-decoder (seq-to-seq) model trained for Many-to-Many multilingual translation. It was introduced in this [paper](https://arxiv.org/abs/2010.11125) and first released in [this](https://github.com/pytorch/fairseq/tree/master/examples/m2m_100) repository. The model that can directly translate between the 9,900 directions of 100 languages. To translate into a target language, the target language id is forced as the first generated token. To force the target language id as the first generated token, pass the `forced_bos_token_id` parameter to the `generate` method. *Note: `M2M100Tokenizer` depends on `sentencepiece`, so make sure to install it before running the example.* To install `sentencepiece` run `pip install sentencepiece` ```python from transformers import M2M100ForConditionalGeneration, M2M100Tokenizer hi_text = "जीवन एक चॉकलेट बॉक्स की तरह है।" chinese_text = "生活就像一盒巧克力。" model = M2M100ForConditionalGeneration.from_pretrained("facebook/m2m100_418M") tokenizer = M2M100Tokenizer.from_pretrained("facebook/m2m100_418M") # translate Hindi to French tokenizer.src_lang = "hi" encoded_hi = tokenizer(hi_text, return_tensors="pt") generated_tokens = model.generate(**encoded_hi, forced_bos_token_id=tokenizer.get_lang_id("fr")) tokenizer.batch_decode(generated_tokens, skip_special_tokens=True) # => "La vie est comme une boîte de chocolat." # translate Chinese to English tokenizer.src_lang = "zh" encoded_zh = tokenizer(chinese_text, return_tensors="pt") generated_tokens = model.generate(**encoded_zh, forced_bos_token_id=tokenizer.get_lang_id("en")) tokenizer.batch_decode(generated_tokens, skip_special_tokens=True) # => "Life is like a box of chocolate." ``` See the [model hub](https://huggingface.co/models?filter=m2m_100) to look for more fine-tuned versions. ## Languages covered Afrikaans (af), Amharic (am), Arabic (ar), Asturian (ast), Azerbaijani (az), Bashkir (ba), Belarusian (be), Bulgarian (bg), Bengali (bn), Breton (br), Bosnian (bs), Catalan; Valencian (ca), Cebuano (ceb), Czech (cs), Welsh (cy), Danish (da), German (de), Greeek (el), English (en), Spanish (es), Estonian (et), Persian (fa), Fulah (ff), Finnish (fi), French (fr), Western Frisian (fy), Irish (ga), Gaelic; Scottish Gaelic (gd), Galician (gl), Gujarati (gu), Hausa (ha), Hebrew (he), Hindi (hi), Croatian (hr), Haitian; Haitian Creole (ht), Hungarian (hu), Armenian (hy), Indonesian (id), Igbo (ig), Iloko (ilo), Icelandic (is), Italian (it), Japanese (ja), Javanese (jv), Georgian (ka), Kazakh (kk), Central Khmer (km), Kannada (kn), Korean (ko), Luxembourgish; Letzeburgesch (lb), Ganda (lg), Lingala (ln), Lao (lo), Lithuanian (lt), Latvian (lv), Malagasy (mg), Macedonian (mk), Malayalam (ml), Mongolian (mn), Marathi (mr), Malay (ms), Burmese (my), Nepali (ne), Dutch; Flemish (nl), Norwegian (no), Northern Sotho (ns), Occitan (post 1500) (oc), Oriya (or), Panjabi; Punjabi (pa), Polish (pl), Pushto; Pashto (ps), Portuguese (pt), Romanian; Moldavian; Moldovan (ro), Russian (ru), Sindhi (sd), Sinhala; Sinhalese (si), Slovak (sk), Slovenian (sl), Somali (so), Albanian (sq), Serbian (sr), Swati (ss), Sundanese (su), Swedish (sv), Swahili (sw), Tamil (ta), Thai (th), Tagalog (tl), Tswana (tn), Turkish (tr), Ukrainian (uk), Urdu (ur), Uzbek (uz), Vietnamese (vi), Wolof (wo), Xhosa (xh), Yiddish (yi), Yoruba (yo), Chinese (zh), Zulu (zu) ## BibTeX entry and citation info ``` @misc{fan2020englishcentric, title={Beyond English-Centric Multilingual Machine Translation}, author={Angela Fan and Shruti Bhosale and Holger Schwenk and Zhiyi Ma and Ahmed El-Kishky and Siddharth Goyal and Mandeep Baines and Onur Celebi and Guillaume Wenzek and Vishrav Chaudhary and Naman Goyal and Tom Birch and Vitaliy Liptchinsky and Sergey Edunov and Edouard Grave and Michael Auli and Armand Joulin}, year={2020}, eprint={2010.11125}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

laion/CLIP-ViT-B-16-laion2B-s34B-b88K

laion

open_clip

zero-shot-image-classification

--- license: mit pipeline_tag: zero-shot-image-classification library_name: open_clip --- # Model Card for CLIP ViT-B/16 - LAION-2B # Table of Contents 1. [Model Details](#model-details) 2. [Uses](#uses) 3. [Training Details](#training-details) 4. [Evaluation](#evaluation) 5. [Acknowledgements](#acknowledgements) 6. [Citation](#citation) # Model Details ## Model Description A CLIP ViT-B/16 model trained with the LAION-2B English subset of LAION-5B (https://laion.ai/blog/laion-5b/) using OpenCLIP (https://github.com/mlfoundations/open_clip). Model training done by Mehdi Cherti on the [JUWELS Booster](https://apps.fz-juelich.de/jsc/hps/juwels/booster-overview.html) supercomputer. See acknowledgements below. # Uses As per the original [OpenAI CLIP model card](https://github.com/openai/CLIP/blob/d50d76daa670286dd6cacf3bcd80b5e4823fc8e1/model-card.md), this model is intended as a research output for research communities. We hope that this model will enable researchers to better understand and explore zero-shot, arbitrary image classification. We also hope it can be used for interdisciplinary studies of the potential impact of such model. The OpenAI CLIP paper includes a discussion of potential downstream impacts to provide an example for this sort of analysis. Additionally, the LAION-5B blog (https://laion.ai/blog/laion-5b/) and upcoming paper include additional discussion as it relates specifically to the training dataset. ## Direct Use Zero-shot image classification, image and text retrieval, among others. ## Downstream Use Image classification and other image task fine-tuning, linear probe image classification, image generation guiding and conditioning, among others. ## Out-of-Scope Use As per the OpenAI models, **Any** deployed use case of the model - whether commercial or not - is currently out of scope. Non-deployed use cases such as image search in a constrained environment, are also not recommended unless there is thorough in-domain testing of the model with a specific, fixed class taxonomy. This is because our safety assessment demonstrated a high need for task specific testing especially given the variability of CLIP’s performance with different class taxonomies. This makes untested and unconstrained deployment of the model in any use case currently potentially harmful. Certain use cases which would fall under the domain of surveillance and facial recognition are always out-of-scope regardless of performance of the model. This is because the use of artificial intelligence for tasks such as these can be premature currently given the lack of testing norms and checks to ensure its fair use. Since the model has not been purposefully trained in or evaluated on any languages other than English, its use should be limited to English language use cases. Further the above notice, the LAION-5B dataset used in training of these models has additional considerations, see below. # Training Details ## Training Data This model was trained with the 2 Billion sample English subset of LAION-5B (https://laion.ai/blog/laion-5b/). **IMPORTANT NOTE:** The motivation behind dataset creation is to democratize research and experimentation around large-scale multi-modal model training and handling of uncurated, large-scale datasets crawled from publically available internet. Our recommendation is therefore to use the dataset for research purposes. Be aware that this large-scale dataset is uncurated. Keep in mind that the uncurated nature of the dataset means that collected links may lead to strongly discomforting and disturbing content for a human viewer. Therefore, please use the demo links with caution and at your own risk. It is possible to extract a “safe” subset by filtering out samples based on the safety tags (using a customized trained NSFW classifier that we built). While this strongly reduces the chance for encountering potentially harmful content when viewing, we cannot entirely exclude the possibility for harmful content being still present in safe mode, so that the warning holds also there. We think that providing the dataset openly to broad research and other interested communities will allow for transparent investigation of benefits that come along with training large-scale models as well as pitfalls and dangers that may stay unreported or unnoticed when working with closed large datasets that remain restricted to a small community. Providing our dataset openly, we however do not recommend using it for creating ready-to-go industrial products, as the basic research about general properties and safety of such large-scale models, which we would like to encourage with this release, is still in progress. ## Training Procedure TODO # Evaluation Evaluation done with code in the [LAION CLIP Benchmark suite](https://github.com/LAION-AI/CLIP_benchmark). ## Testing Data, Factors & Metrics ### Testing Data The testing is performed with VTAB+ (A combination of VTAB (https://arxiv.org/abs/1910.04867) w/ additional robustness datasets) for classification and COCO and Flickr for retrieval. ## Results The model achieves a 70.2 zero-shot top-1 accuracy on ImageNet-1k. An initial round of benchmarks have been performed on a wider range of datasets, currently viewable at https://github.com/LAION-AI/CLIP_benchmark/blob/main/benchmark/results.ipynb # Acknowledgements Acknowledging the Gauss Centre for Supercomputing e.V. (http://gauss-centre.eu) for funding this part of work by providing computing time through the John von Neumann Institute for Computing (NIC) on the GCS Supercomputer JUWELS Booster at Jülich Supercomputing Centre (JSC). # Citation **BibTeX:** LAION-5B ```bibtex @inproceedings{schuhmann2022laionb, title={{LAION}-5B: An open large-scale dataset for training next generation image-text models}, author={Christoph Schuhmann and Romain Beaumont and Richard Vencu and Cade W Gordon and Ross Wightman and Mehdi Cherti and Theo Coombes and Aarush Katta and Clayton Mullis and Mitchell Wortsman and Patrick Schramowski and Srivatsa R Kundurthy and Katherine Crowson and Ludwig Schmidt and Robert Kaczmarczyk and Jenia Jitsev}, booktitle={Thirty-sixth Conference on Neural Information Processing Systems Datasets and Benchmarks Track}, year={2022}, url={https://openreview.net/forum?id=M3Y74vmsMcY} } ``` OpenAI CLIP paper ``` @inproceedings{Radford2021LearningTV, title={Learning Transferable Visual Models From Natural Language Supervision}, author={Alec Radford and Jong Wook Kim and Chris Hallacy and A. Ramesh and Gabriel Goh and Sandhini Agarwal and Girish Sastry and Amanda Askell and Pamela Mishkin and Jack Clark and Gretchen Krueger and Ilya Sutskever}, booktitle={ICML}, year={2021} } ``` OpenCLIP software ``` @software{ilharco_gabriel_2021_5143773, author = {Ilharco, Gabriel and Wortsman, Mitchell and Wightman, Ross and Gordon, Cade and Carlini, Nicholas and Taori, Rohan and Dave, Achal and Shankar, Vaishaal and Namkoong, Hongseok and Miller, John and Hajishirzi, Hannaneh and Farhadi, Ali and Schmidt, Ludwig}, title = {OpenCLIP}, month = jul, year = 2021, note = {If you use this software, please cite it as below.}, publisher = {Zenodo}, version = {0.1}, doi = {10.5281/zenodo.5143773}, url = {https://doi.org/10.5281/zenodo.5143773} } ```

indobenchmark/indobert-base-p1

indobenchmark

transformers

feature-extraction

--- language: id tags: - indobert - indobenchmark - indonlu license: mit inference: false datasets: - Indo4B --- # IndoBERT Base Model (phase1 - uncased) [IndoBERT](https://arxiv.org/abs/2009.05387) is a state-of-the-art language model for Indonesian based on the BERT model. The pretrained model is trained using a masked language modeling (MLM) objective and next sentence prediction (NSP) objective. ## All Pre-trained Models | Model | #params | Arch. | Training data | |--------------------------------|--------------------------------|-------|-----------------------------------| | `indobenchmark/indobert-base-p1` | 124.5M | Base | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-base-p2` | 124.5M | Base | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-large-p1` | 335.2M | Large | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-large-p2` | 335.2M | Large | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-lite-base-p1` | 11.7M | Base | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-lite-base-p2` | 11.7M | Base | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-lite-large-p1` | 17.7M | Large | Indo4B (23.43 GB of text) | | `indobenchmark/indobert-lite-large-p2` | 17.7M | Large | Indo4B (23.43 GB of text) | ## How to use ### Load model and tokenizer ```python from transformers import BertTokenizer, AutoModel tokenizer = BertTokenizer.from_pretrained("indobenchmark/indobert-base-p1") model = AutoModel.from_pretrained("indobenchmark/indobert-base-p1") ``` ### Extract contextual representation ```python x = torch.LongTensor(tokenizer.encode('aku adalah anak [MASK]')).view(1,-1) print(x, model(x)[0].sum()) ``` ## Authors <b>IndoBERT</b> was trained and evaluated by Bryan Wilie\*, Karissa Vincentio\*, Genta Indra Winata\*, Samuel Cahyawijaya\*, Xiaohong Li, Zhi Yuan Lim, Sidik Soleman, Rahmad Mahendra, Pascale Fung, Syafri Bahar, Ayu Purwarianti. ## Citation If you use our work, please cite: ```bibtex @inproceedings{wilie2020indonlu, title={IndoNLU: Benchmark and Resources for Evaluating Indonesian Natural Language Understanding}, author={Bryan Wilie and Karissa Vincentio and Genta Indra Winata and Samuel Cahyawijaya and X. Li and Zhi Yuan Lim and S. Soleman and R. Mahendra and Pascale Fung and Syafri Bahar and A. Purwarianti}, booktitle={Proceedings of the 1st Conference of the Asia-Pacific Chapter of the Association for Computational Linguistics and the 10th International Joint Conference on Natural Language Processing}, year={2020} } ```

jonatasgrosman/wav2vec2-large-xlsr-53-russian

jonatasgrosman

transformers

automatic-speech-recognition

--- language: ru license: apache-2.0 datasets: - common_voice - mozilla-foundation/common_voice_6_0 metrics: - wer - cer tags: - audio - automatic-speech-recognition - hf-asr-leaderboard - mozilla-foundation/common_voice_6_0 - robust-speech-event - ru - speech - xlsr-fine-tuning-week model-index: - name: XLSR Wav2Vec2 Russian by Jonatas Grosman results: - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: Common Voice ru type: common_voice args: ru metrics: - name: Test WER type: wer value: 13.3 - name: Test CER type: cer value: 2.88 - name: Test WER (+LM) type: wer value: 9.57 - name: Test CER (+LM) type: cer value: 2.24 - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: Robust Speech Event - Dev Data type: speech-recognition-community-v2/dev_data args: ru metrics: - name: Dev WER type: wer value: 40.22 - name: Dev CER type: cer value: 14.8 - name: Dev WER (+LM) type: wer value: 33.61 - name: Dev CER (+LM) type: cer value: 13.5 --- # Fine-tuned XLSR-53 large model for speech recognition in Russian Fine-tuned [facebook/wav2vec2-large-xlsr-53](https://huggingface.co/facebook/wav2vec2-large-xlsr-53) on Russian using the train and validation splits of [Common Voice 6.1](https://huggingface.co/datasets/common_voice) and [CSS10](https://github.com/Kyubyong/css10). When using this model, make sure that your speech input is sampled at 16kHz. This model has been fine-tuned thanks to the GPU credits generously given by the [OVHcloud](https://www.ovhcloud.com/en/public-cloud/ai-training/) :) The script used for training can be found here: https://github.com/jonatasgrosman/wav2vec2-sprint ## Usage The model can be used directly (without a language model) as follows... Using the [HuggingSound](https://github.com/jonatasgrosman/huggingsound) library: ```python from huggingsound import SpeechRecognitionModel model = SpeechRecognitionModel("jonatasgrosman/wav2vec2-large-xlsr-53-russian") audio_paths = ["/path/to/file.mp3", "/path/to/another_file.wav"] transcriptions = model.transcribe(audio_paths) ``` Writing your own inference script: ```python import torch import librosa from datasets import load_dataset from transformers import Wav2Vec2ForCTC, Wav2Vec2Processor LANG_ID = "ru" MODEL_ID = "jonatasgrosman/wav2vec2-large-xlsr-53-russian" SAMPLES = 5 test_dataset = load_dataset("common_voice", LANG_ID, split=f"test[:{SAMPLES}]") processor = Wav2Vec2Processor.from_pretrained(MODEL_ID) model = Wav2Vec2ForCTC.from_pretrained(MODEL_ID) # Preprocessing the datasets. # We need to read the audio files as arrays def speech_file_to_array_fn(batch): speech_array, sampling_rate = librosa.load(batch["path"], sr=16_000) batch["speech"] = speech_array batch["sentence"] = batch["sentence"].upper() return batch test_dataset = test_dataset.map(speech_file_to_array_fn) inputs = processor(test_dataset["speech"], sampling_rate=16_000, return_tensors="pt", padding=True) with torch.no_grad(): logits = model(inputs.input_values, attention_mask=inputs.attention_mask).logits predicted_ids = torch.argmax(logits, dim=-1) predicted_sentences = processor.batch_decode(predicted_ids) for i, predicted_sentence in enumerate(predicted_sentences): print("-" * 100) print("Reference:", test_dataset[i]["sentence"]) print("Prediction:", predicted_sentence) ``` | Reference | Prediction | | ------------- | ------------- | | ОН РАБОТАТЬ, А ЕЕ НЕ УДЕРЖАТЬ НИКАК — БЕГАЕТ ЗА КЛЁШЕМ КАЖДОГО БУЛЬВАРНИКА. | ОН РАБОТАТЬ А ЕЕ НЕ УДЕРЖАТ НИКАК БЕГАЕТ ЗА КЛЕШОМ КАЖДОГО БУЛЬБАРНИКА | | ЕСЛИ НЕ БУДЕТ ВОЗРАЖЕНИЙ, Я БУДУ СЧИТАТЬ, ЧТО АССАМБЛЕЯ СОГЛАСНА С ЭТИМ ПРЕДЛОЖЕНИЕМ. | ЕСЛИ НЕ БУДЕТ ВОЗРАЖЕНИЙ Я БУДУ СЧИТАТЬ ЧТО АССАМБЛЕЯ СОГЛАСНА С ЭТИМ ПРЕДЛОЖЕНИЕМ | | ПАЛЕСТИНЦАМ НЕОБХОДИМО СНАЧАЛА УСТАНОВИТЬ МИР С ИЗРАИЛЕМ, А ЗАТЕМ ДОБИВАТЬСЯ ПРИЗНАНИЯ ГОСУДАРСТВЕННОСТИ. | ПАЛЕСТИНЦАМ НЕОБХОДИМО СНАЧАЛА УСТАНОВИТЬ С НИ МИР ФЕЗРЕЛЕМ А ЗАТЕМ ДОБИВАТЬСЯ ПРИЗНАНИЯ ГОСУДАРСТВЕНСКИ | | У МЕНЯ БЫЛО ТАКОЕ ЧУВСТВО, ЧТО ЧТО-ТО ТАКОЕ ОЧЕНЬ ВАЖНОЕ Я ПРИБАВЛЯЮ. | У МЕНЯ БЫЛО ТАКОЕ ЧУВСТВО ЧТО ЧТО-ТО ТАКОЕ ОЧЕНЬ ВАЖНОЕ Я ПРЕДБАВЛЯЕТ | | ТОЛЬКО ВРЯД ЛИ ПОЙМЕТ. | ТОЛЬКО ВРЯД ЛИ ПОЙМЕТ | | ВРОНСКИЙ, СЛУШАЯ ОДНИМ УХОМ, ПЕРЕВОДИЛ БИНОКЛЬ С БЕНУАРА НА БЕЛЬ-ЭТАЖ И ОГЛЯДЫВАЛ ЛОЖИ. | ЗЛАЗКИ СЛУШАЮ ОТ ОДНИМ УХАМ ТЫ ВОТИ В ВИНОКОТ СПИЛА НА ПЕРЕТАЧ И ОКЛЯДЫВАЛ БОСУ | | К СОЖАЛЕНИЮ, СИТУАЦИЯ ПРОДОЛЖАЕТ УХУДШАТЬСЯ. | К СОЖАЛЕНИЮ СИТУАЦИИ ПРОДОЛЖАЕТ УХУЖАТЬСЯ | | ВСЁ ЖАЛОВАНИЕ УХОДИЛО НА ДОМАШНИЕ РАСХОДЫ И НА УПЛАТУ МЕЛКИХ НЕПЕРЕВОДИВШИХСЯ ДОЛГОВ. | ВСЕ ЖАЛОВАНИЕ УХОДИЛО НА ДОМАШНИЕ РАСХОДЫ И НА УПЛАТУ МЕЛКИХ НЕ ПЕРЕВОДИВШИХСЯ ДОЛГОВ | | ТЕПЕРЬ ДЕЛО, КОНЕЧНО, ЗА ТЕМ, ЧТОБЫ ПРЕВРАТИТЬ СЛОВА В ДЕЛА. | ТЕПЕРЬ ДЕЛАЮ КОНЕЧНО ЗАТЕМ ЧТОБЫ ПРЕВРАТИТЬ СЛОВА В ДЕЛА | | ДЕВЯТЬ | ЛЕВЕТЬ | ## Evaluation 1. To evaluate on `mozilla-foundation/common_voice_6_0` with split `test` ```bash python eval.py --model_id jonatasgrosman/wav2vec2-large-xlsr-53-russian --dataset mozilla-foundation/common_voice_6_0 --config ru --split test ``` 2. To evaluate on `speech-recognition-community-v2/dev_data` ```bash python eval.py --model_id jonatasgrosman/wav2vec2-large-xlsr-53-russian --dataset speech-recognition-community-v2/dev_data --config ru --split validation --chunk_length_s 5.0 --stride_length_s 1.0 ``` ## Citation If you want to cite this model you can use this: ```bibtex @misc{grosman2021xlsr53-large-russian, title={Fine-tuned {XLSR}-53 large model for speech recognition in {R}ussian}, author={Grosman, Jonatas}, howpublished={\url{https://huggingface.co/jonatasgrosman/wav2vec2-large-xlsr-53-russian}}, year={2021} } ```

LTP/small

LTP

transformers

   | Language | version | | ------------------------------------ | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | [Python](python/interface/README.md) | [](https://pypi.org/project/ltp) [](https://pypi.org/project/ltp-core) [](https://pypi.org/project/ltp-extension) | | [Rust](rust/ltp/README.md) | [](https://crates.io/crates/ltp) | # LTP 4 LTP（Language Technology Platform） 提供了一系列中文自然语言处理工具，用户可以使用这些工具对于中文文本进行分词、词性标注、句法分析等等工作。 ## 引用 如果您在工作中使用了 LTP，您可以引用这篇论文 ```bibtex @article{che2020n, title={N-LTP: A Open-source Neural Chinese Language Technology Platform with Pretrained Models}, author={Che, Wanxiang and Feng, Yunlong and Qin, Libo and Liu, Ting}, journal={arXiv preprint arXiv:2009.11616}, year={2020} } ``` **参考书：** 由哈工大社会计算与信息检索研究中心（HIT-SCIR）的多位学者共同编著的《[自然语言处理：基于预训练模型的方法](https://item.jd.com/13344628.html) 》（作者：车万翔、郭江、崔一鸣；主审：刘挺）一书现已正式出版，该书重点介绍了新的基于预训练模型的自然语言处理技术，包括基础知识、预训练词向量和预训练模型三大部分，可供广大LTP用户学习参考。 ### 更新说明 - 4.2.0 - \[结构性变化\] 将 LTP 拆分成 2 个部分，维护和训练更方便，结构更清晰 - \[Legacy 模型\] 针对广大用户对于**推理速度**的需求，使用 Rust 重写了基于感知机的算法，准确率与 LTP3 版本相当，速度则是 LTP v3 的 **3.55** 倍，开启多线程更可获得 **17.17** 倍的速度提升，但目前仅支持分词、词性、命名实体三大任务 - \[深度学习模型\] 即基于 PyTorch 实现的深度学习模型，支持全部的6大任务（分词/词性/命名实体/语义角色/依存句法/语义依存） - \[其他改进\] 改进了模型训练方法 - \[共同\] 提供了训练脚本和训练样例，使得用户能够更方便地使用私有的数据，自行训练个性化的模型 - \[深度学习模型\] 采用 hydra 对训练过程进行配置，方便广大用户修改模型训练参数以及对 LTP 进行扩展（比如使用其他包中的 Module） - \[其他变化\] 分词、依存句法分析 (Eisner) 和 语义依存分析 (Eisner) 任务的解码算法使用 Rust 实现，速度更快 - \[新特性\] 模型上传至 [Huggingface Hub](https://huggingface.co/LTP)，支持自动下载，下载速度更快，并且支持用户自行上传自己训练的模型供LTP进行推理使用 - \[破坏性变更\] 改用 Pipeline API 进行推理，方便后续进行更深入的性能优化（如SDP和SDPG很大一部分是重叠的，重用可以加快推理速度），使用说明参见[Github快速使用部分](https://github.com/hit-scir/ltp) - 4.1.0 - 提供了自定义分词等功能 - 修复了一些bug - 4.0.0 - 基于Pytorch 开发，原生 Python 接口 - 可根据需要自由选择不同速度和指标的模型 - 分词、词性、命名实体、依存句法、语义角色、语义依存6大任务 ## 快速使用 ### [Python](python/interface/README.md) ```bash pip install -U ltp ltp-core ltp-extension -i https://pypi.org/simple # 安装 ltp ``` **注：** 如果遇到任何错误，请尝试使用上述命令重新安装 ltp，如果依然报错，请在 Github issues 中反馈。 ```python import torch from ltp import LTP ltp = LTP("LTP/small") # 默认加载 Small 模型 # 将模型移动到 GPU 上 if torch.cuda.is_available(): # ltp.cuda() ltp.to("cuda") output = ltp.pipeline(["他叫汤姆去拿外衣。"], tasks=["cws", "pos", "ner", "srl", "dep", "sdp"]) # 使用字典格式作为返回结果 print(output.cws) # print(output[0]) / print(output['cws']) # 也可以使用下标访问 print(output.pos) print(output.sdp) # 使用感知机算法实现的分词、词性和命名实体识别，速度比较快，但是精度略低 ltp = LTP("LTP/legacy") # cws, pos, ner = ltp.pipeline(["他叫汤姆去拿外衣。"], tasks=["cws", "ner"]).to_tuple() # error: NER 需要 词性标注任务的结果 cws, pos, ner = ltp.pipeline(["他叫汤姆去拿外衣。"], tasks=["cws", "pos", "ner"]).to_tuple() # to tuple 可以自动转换为元组格式 # 使用元组格式作为返回结果 print(cws, pos, ner) ``` **[详细说明](python/interface/docs/quickstart.rst)** ### [Rust](rust/ltp/README.md) ```rust use std::fs::File; use itertools::multizip; use ltp::{CWSModel, POSModel, NERModel, ModelSerde, Format, Codec}; fn main() -> Result<(), Box<dyn std::error::Error>> { let file = File::open("data/legacy-models/cws_model.bin")?; let cws: CWSModel = ModelSerde::load(file, Format::AVRO(Codec::Deflate))?; let file = File::open("data/legacy-models/pos_model.bin")?; let pos: POSModel = ModelSerde::load(file, Format::AVRO(Codec::Deflate))?; let file = File::open("data/legacy-models/ner_model.bin")?; let ner: NERModel = ModelSerde::load(file, Format::AVRO(Codec::Deflate))?; let words = cws.predict("他叫汤姆去拿外衣。")?; let pos = pos.predict(&words)?; let ner = ner.predict((&words, &pos))?; for (w, p, n) in multizip((words, pos, ner)) { println!("{}/{}/{}", w, p, n); } Ok(()) } ``` ## 模型性能以及下载地址 | 深度学习模型 | 分词 | 词性 | 命名实体 | 语义角色 | 依存句法 | 语义依存 | 速度(句/S) | | :---------------------------------------: | :---: | :---: | :---: | :---: | :---: | :---: | :-----: | | [Base](https://huggingface.co/LTP/base) | 98.7 | 98.5 | 95.4 | 80.6 | 89.5 | 75.2 | 39.12 | | [Base1](https://huggingface.co/LTP/base1) | 99.22 | 98.73 | 96.39 | 79.28 | 89.57 | 76.57 | --.-- | | [Base2](https://huggingface.co/LTP/base2) | 99.18 | 98.69 | 95.97 | 79.49 | 90.19 | 76.62 | --.-- | | [Small](https://huggingface.co/LTP/small) | 98.4 | 98.2 | 94.3 | 78.4 | 88.3 | 74.7 | 43.13 | | [Tiny](https://huggingface.co/LTP/tiny) | 96.8 | 97.1 | 91.6 | 70.9 | 83.8 | 70.1 | 53.22 | | 感知机算法 | 分词 | 词性 | 命名实体 | 速度(句/s) | 备注 | | :-----------------------------------------: | :---: | :---: | :---: | :------: | :------------------------: | | [Legacy](https://huggingface.co/LTP/legacy) | 97.93 | 98.41 | 94.28 | 21581.48 | [性能详情](rust/ltp/README.md) | **注：感知机算法速度为开启16线程速度** ## 构建 Wheel 包 ```shell script make bdist ``` ## 其他语言绑定 **感知机算法** - [Rust](rust/ltp) - [C/C++](rust/ltp-cffi) **深度学习算法** - [Rust](https://github.com/HIT-SCIR/libltp/tree/master/ltp-rs) - [C++](https://github.com/HIT-SCIR/libltp/tree/master/ltp-cpp) - [Java](https://github.com/HIT-SCIR/libltp/tree/master/ltp-java) ## 作者信息 - 冯云龙 \<\<[ylfeng@ir.hit.edu.cn](mailto:ylfeng@ir.hit.edu.cn)>> ## 开源协议 1. 语言技术平台面向国内外大学、中科院各研究所以及个人研究者免费开放源代码，但如上述机构和个人将该平台用于商业目的（如企业合作项目等）则需要付费。 2. 除上述机构以外的企事业单位，如申请使用该平台，需付费。 3. 凡涉及付费问题，请发邮件到 car@ir.hit.edu.cn 洽商。 4. 如果您在 LTP 基础上发表论文或取得科研成果，请您在发表论文和申报成果时声明“使用了哈工大社会计算与信息检索研究中心研制的语言技术平台（LTP）”. 同时，发信给car@ir.hit.edu.cn，说明发表论文或申报成果的题目、出处等。

sonoisa/sentence-bert-base-ja-mean-tokens-v2

sonoisa

sentence-transformers

feature-extraction

--- language: ja license: cc-by-sa-4.0 tags: - sentence-transformers - sentence-bert - feature-extraction - sentence-similarity --- This is a Japanese sentence-BERT model. 日本語用Sentence-BERTモデル（バージョン2）です。 [バージョン1](https://huggingface.co/sonoisa/sentence-bert-base-ja-mean-tokens)よりも良いロス関数である[MultipleNegativesRankingLoss](https://www.sbert.net/docs/package_reference/losses.html#multiplenegativesrankingloss)を用いて学習した改良版です。 手元の非公開データセットでは、バージョン1よりも1.5〜2ポイントほど精度が高い結果が得られました。 事前学習済みモデルとして[cl-tohoku/bert-base-japanese-whole-word-masking](https://huggingface.co/cl-tohoku/bert-base-japanese-whole-word-masking)を利用しました。 従って、推論の実行にはfugashiとipadicが必要です（pip install fugashi ipadic）。 # 旧バージョンの解説 https://qiita.com/sonoisa/items/1df94d0a98cd4f209051 モデル名を"sonoisa/sentence-bert-base-ja-mean-tokens-v2"に書き換えれば、本モデルを利用した挙動になります。 # 使い方 ```python from transformers import BertJapaneseTokenizer, BertModel import torch class SentenceBertJapanese: def __init__(self, model_name_or_path, device=None): self.tokenizer = BertJapaneseTokenizer.from_pretrained(model_name_or_path) self.model = BertModel.from_pretrained(model_name_or_path) self.model.eval() if device is None: device = "cuda" if torch.cuda.is_available() else "cpu" self.device = torch.device(device) self.model.to(device) def _mean_pooling(self, model_output, attention_mask): token_embeddings = model_output[0] #First element of model_output contains all token embeddings input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) @torch.no_grad() def encode(self, sentences, batch_size=8): all_embeddings = [] iterator = range(0, len(sentences), batch_size) for batch_idx in iterator: batch = sentences[batch_idx:batch_idx + batch_size] encoded_input = self.tokenizer.batch_encode_plus(batch, padding="longest", truncation=True, return_tensors="pt").to(self.device) model_output = self.model(**encoded_input) sentence_embeddings = self._mean_pooling(model_output, encoded_input["attention_mask"]).to('cpu') all_embeddings.extend(sentence_embeddings) # return torch.stack(all_embeddings).numpy() return torch.stack(all_embeddings) MODEL_NAME = "sonoisa/sentence-bert-base-ja-mean-tokens-v2" # <- v2です。 model = SentenceBertJapanese(MODEL_NAME) sentences = ["暴走したAI", "暴走した人工知能"] sentence_embeddings = model.encode(sentences, batch_size=8) print("Sentence embeddings:", sentence_embeddings) ```

amazon/chronos-t5-tiny

amazon

transformers

other

--- license: apache-2.0 pipeline_tag: other tags: - time series - forecasting - pretrained models - foundation models - time series foundation models - time-series --- # Chronos-T5 (Tiny) Chronos is a family of **pretrained time series forecasting models** based on language model architectures. A time series is transformed into a sequence of tokens via scaling and quantization, and a language model is trained on these tokens using the cross-entropy loss. Once trained, probabilistic forecasts are obtained by sampling multiple future trajectories given the historical context. Chronos models have been trained on a large corpus of publicly available time series data, as well as synthetic data generated using Gaussian processes. For details on Chronos models, training data and procedures, and experimental results, please refer to the paper [Chronos: Learning the Language of Time Series](https://arxiv.org/abs/2403.07815). <p align="center"> <img src="figures/main-figure.png" width="100%"> <br /> <span> Fig. 1: High-level depiction of Chronos. (<b>Left</b>) The input time series is scaled and quantized to obtain a sequence of tokens. (<b>Center</b>) The tokens are fed into a language model which may either be an encoder-decoder or a decoder-only model. The model is trained using the cross-entropy loss. (<b>Right</b>) During inference, we autoregressively sample tokens from the model and map them back to numerical values. Multiple trajectories are sampled to obtain a predictive distribution. </span> </p> --- ## Architecture The models in this repository are based on the [T5 architecture](https://arxiv.org/abs/1910.10683). The only difference is in the vocabulary size: Chronos-T5 models use 4096 different tokens, compared to 32128 of the original T5 models, resulting in fewer parameters. | Model | Parameters | Based on | | ---------------------------------------------------------------------- | ---------- | ---------------------------------------------------------------------- | | [**chronos-t5-tiny**](https://huggingface.co/amazon/chronos-t5-tiny) | 8M | [t5-efficient-tiny](https://huggingface.co/google/t5-efficient-tiny) | | [**chronos-t5-mini**](https://huggingface.co/amazon/chronos-t5-mini) | 20M | [t5-efficient-mini](https://huggingface.co/google/t5-efficient-mini) | | [**chronos-t5-small**](https://huggingface.co/amazon/chronos-t5-small) | 46M | [t5-efficient-small](https://huggingface.co/google/t5-efficient-small) | | [**chronos-t5-base**](https://huggingface.co/amazon/chronos-t5-base) | 200M | [t5-efficient-base](https://huggingface.co/google/t5-efficient-base) | | [**chronos-t5-large**](https://huggingface.co/amazon/chronos-t5-large) | 710M | [t5-efficient-large](https://huggingface.co/google/t5-efficient-large) | ## Usage To perform inference with Chronos models, install the package in the GitHub [companion repo](https://github.com/amazon-science/chronos-forecasting) by running: ``` pip install git+https://github.com/amazon-science/chronos-forecasting.git ``` A minimal example showing how to perform inference using Chronos models: ```python import matplotlib.pyplot as plt import numpy as np import pandas as pd import torch from chronos import ChronosPipeline pipeline = ChronosPipeline.from_pretrained( "amazon/chronos-t5-tiny", device_map="cuda", torch_dtype=torch.bfloat16, ) df = pd.read_csv("https://raw.githubusercontent.com/AileenNielsen/TimeSeriesAnalysisWithPython/master/data/AirPassengers.csv") # context must be either a 1D tensor, a list of 1D tensors, # or a left-padded 2D tensor with batch as the first dimension context = torch.tensor(df["#Passengers"]) prediction_length = 12 forecast = pipeline.predict(context, prediction_length) # shape [num_series, num_samples, prediction_length] # visualize the forecast forecast_index = range(len(df), len(df) + prediction_length) low, median, high = np.quantile(forecast[0].numpy(), [0.1, 0.5, 0.9], axis=0) plt.figure(figsize=(8, 4)) plt.plot(df["#Passengers"], color="royalblue", label="historical data") plt.plot(forecast_index, median, color="tomato", label="median forecast") plt.fill_between(forecast_index, low, high, color="tomato", alpha=0.3, label="80% prediction interval") plt.legend() plt.grid() plt.show() ``` ## Citation If you find Chronos models useful for your research, please consider citing the associated [paper](https://arxiv.org/abs/2403.07815): ``` @article{ansari2024chronos, author = {Ansari, Abdul Fatir and Stella, Lorenzo and Turkmen, Caner and Zhang, Xiyuan, and Mercado, Pedro and Shen, Huibin and Shchur, Oleksandr and Rangapuram, Syama Syndar and Pineda Arango, Sebastian and Kapoor, Shubham and Zschiegner, Jasper and Maddix, Danielle C. and Mahoney, Michael W. and Torkkola, Kari and Gordon Wilson, Andrew and Bohlke-Schneider, Michael and Wang, Yuyang}, title = {Chronos: Learning the Language of Time Series}, journal = {arXiv preprint arXiv:2403.07815}, year = {2024} } ``` ## Security See [CONTRIBUTING](CONTRIBUTING.md#security-issue-notifications) for more information. ## License This project is licensed under the Apache-2.0 License.

cross-encoder/ms-marco-MiniLM-L-6-v2

cross-encoder

transformers

text-classification

--- license: apache-2.0 --- # Cross-Encoder for MS Marco This model was trained on the [MS Marco Passage Ranking](https://github.com/microsoft/MSMARCO-Passage-Ranking) task. The model can be used for Information Retrieval: Given a query, encode the query will all possible passages (e.g. retrieved with ElasticSearch). Then sort the passages in a decreasing order. See [SBERT.net Retrieve & Re-rank](https://www.sbert.net/examples/applications/retrieve_rerank/README.html) for more details. The training code is available here: [SBERT.net Training MS Marco](https://github.com/UKPLab/sentence-transformers/tree/master/examples/training/ms_marco) ## Usage with Transformers ```python from transformers import AutoTokenizer, AutoModelForSequenceClassification import torch model = AutoModelForSequenceClassification.from_pretrained('model_name') tokenizer = AutoTokenizer.from_pretrained('model_name') features = tokenizer(['How many people live in Berlin?', 'How many people live in Berlin?'], ['Berlin has a population of 3,520,031 registered inhabitants in an area of 891.82 square kilometers.', 'New York City is famous for the Metropolitan Museum of Art.'], padding=True, truncation=True, return_tensors="pt") model.eval() with torch.no_grad(): scores = model(**features).logits print(scores) ``` ## Usage with SentenceTransformers The usage becomes easier when you have [SentenceTransformers](https://www.sbert.net/) installed. Then, you can use the pre-trained models like this: ```python from sentence_transformers import CrossEncoder model = CrossEncoder('model_name', max_length=512) scores = model.predict([('Query', 'Paragraph1'), ('Query', 'Paragraph2') , ('Query', 'Paragraph3')]) ``` ## Performance In the following table, we provide various pre-trained Cross-Encoders together with their performance on the [TREC Deep Learning 2019](https://microsoft.github.io/TREC-2019-Deep-Learning/) and the [MS Marco Passage Reranking](https://github.com/microsoft/MSMARCO-Passage-Ranking/) dataset. | Model-Name | NDCG@10 (TREC DL 19) | MRR@10 (MS Marco Dev) | Docs / Sec | | ------------- |:-------------| -----| --- | | **Version 2 models** | | | | cross-encoder/ms-marco-TinyBERT-L-2-v2 | 69.84 | 32.56 | 9000 | cross-encoder/ms-marco-MiniLM-L-2-v2 | 71.01 | 34.85 | 4100 | cross-encoder/ms-marco-MiniLM-L-4-v2 | 73.04 | 37.70 | 2500 | cross-encoder/ms-marco-MiniLM-L-6-v2 | 74.30 | 39.01 | 1800 | cross-encoder/ms-marco-MiniLM-L-12-v2 | 74.31 | 39.02 | 960 | **Version 1 models** | | | | cross-encoder/ms-marco-TinyBERT-L-2 | 67.43 | 30.15 | 9000 | cross-encoder/ms-marco-TinyBERT-L-4 | 68.09 | 34.50 | 2900 | cross-encoder/ms-marco-TinyBERT-L-6 | 69.57 | 36.13 | 680 | cross-encoder/ms-marco-electra-base | 71.99 | 36.41 | 340 | **Other models** | | | | nboost/pt-tinybert-msmarco | 63.63 | 28.80 | 2900 | nboost/pt-bert-base-uncased-msmarco | 70.94 | 34.75 | 340 | nboost/pt-bert-large-msmarco | 73.36 | 36.48 | 100 | Capreolus/electra-base-msmarco | 71.23 | 36.89 | 340 | amberoad/bert-multilingual-passage-reranking-msmarco | 68.40 | 35.54 | 330 | sebastian-hofstaetter/distilbert-cat-margin_mse-T2-msmarco | 72.82 | 37.88 | 720 Note: Runtime was computed on a V100 GPU.

SZTAKI-HLT/hubert-base-cc

SZTAKI-HLT

transformers

--- language: hu license: apache-2.0 datasets: - common_crawl - wikipedia --- # huBERT base model (cased) ## Model description Cased BERT model for Hungarian, trained on the (filtered, deduplicated) Hungarian subset of the Common Crawl and a snapshot of the Hungarian Wikipedia. ## Intended uses & limitations The model can be used as any other (cased) BERT model. It has been tested on the chunking and named entity recognition tasks and set a new state-of-the-art on the former. ## Training Details of the training data and procedure can be found in the PhD thesis linked below. (With the caveat that it only contains preliminary results based on the Wikipedia subcorpus. Evaluation of the full model will appear in a future paper.) ## Eval results When fine-tuned (via `BertForTokenClassification`) on chunking and NER, the model outperforms multilingual BERT, achieves state-of-the-art results on both tasks. The exact scores are | NER | Minimal NP | Maximal NP | |-----|------------|------------| | **97.62%** | **97.14%** | **96.97%** | ### BibTeX entry and citation info If you use the model, please cite the following papers: [Nemeskey, Dávid Márk (2020). "Natural Language Processing Methods for Language Modeling." PhD Thesis. Eötvös Loránd University.](https://hlt.bme.hu/en/publ/nemeskey_2020) Bibtex: ```bibtex @PhDThesis{ Nemeskey:2020, author = {Nemeskey, Dávid Márk}, title = {Natural Language Processing Methods for Language Modeling}, year = {2020}, school = {E\"otv\"os Lor\'and University} } ``` [Nemeskey, Dávid Márk (2021). "Introducing huBERT." In: XVII. Magyar Számítógépes Nyelvészeti Konferencia (MSZNY 2021). Szeged, pp. 3-14](https://hlt.bme.hu/en/publ/hubert_2021) Bibtex: ```bibtex @InProceedings{ Nemeskey:2021a, author = {Nemeskey, Dávid Márk}, title = {Introducing \texttt{huBERT}}, booktitle = {{XVII}.\ Magyar Sz{\'a}m{\'i}t{\'o}g{\'e}pes Nyelv{\'e}szeti Konferencia ({MSZNY}2021)}, year = 2021, pages = {TBA}, address = {Szeged}, } ```

liuhaotian/llava-v1.6-vicuna-7b

liuhaotian

transformers

text-generation

--- inference: false --- <br> <br> # LLaVA Model Card ## Model details **Model type:** LLaVA is an open-source chatbot trained by fine-tuning LLM on multimodal instruction-following data. It is an auto-regressive language model, based on the transformer architecture. Base LLM: [lmsys/vicuna-7b-v1.5](https://huggingface.co/lmsys/vicuna-7b-v1.5) **Model date:** LLaVA-v1.6-Vicuna-7B was trained in December 2023. **Paper or resources for more information:** https://llava-vl.github.io/ ## License Llama 2 is licensed under the LLAMA 2 Community License, Copyright (c) Meta Platforms, Inc. All Rights Reserved. **Where to send questions or comments about the model:** https://github.com/haotian-liu/LLaVA/issues ## Intended use **Primary intended uses:** The primary use of LLaVA is research on large multimodal models and chatbots. **Primary intended users:** The primary intended users of the model are researchers and hobbyists in computer vision, natural language processing, machine learning, and artificial intelligence. ## Training dataset - 558K filtered image-text pairs from LAION/CC/SBU, captioned by BLIP. - 158K GPT-generated multimodal instruction-following data. - 500K academic-task-oriented VQA data mixture. - 50K GPT-4V data mixture. - 40K ShareGPT data. ## Evaluation dataset A collection of 12 benchmarks, including 5 academic VQA benchmarks and 7 recent benchmarks specifically proposed for instruction-following LMMs.

emilyalsentzer/Bio_ClinicalBERT

emilyalsentzer

transformers

fill-mask

--- language: "en" tags: - fill-mask license: mit --- # ClinicalBERT - Bio + Clinical BERT Model The [Publicly Available Clinical BERT Embeddings](https://arxiv.org/abs/1904.03323) paper contains four unique clinicalBERT models: initialized with BERT-Base (`cased_L-12_H-768_A-12`) or BioBERT (`BioBERT-Base v1.0 + PubMed 200K + PMC 270K`) & trained on either all MIMIC notes or only discharge summaries. This model card describes the Bio+Clinical BERT model, which was initialized from [BioBERT](https://arxiv.org/abs/1901.08746) & trained on all MIMIC notes. ## Pretraining Data The `Bio_ClinicalBERT` model was trained on all notes from [MIMIC III](https://www.nature.com/articles/sdata201635), a database containing electronic health records from ICU patients at the Beth Israel Hospital in Boston, MA. For more details on MIMIC, see [here](https://mimic.physionet.org/). All notes from the `NOTEEVENTS` table were included (~880M words). ## Model Pretraining ### Note Preprocessing Each note in MIMIC was first split into sections using a rules-based section splitter (e.g. discharge summary notes were split into "History of Present Illness", "Family History", "Brief Hospital Course", etc. sections). Then each section was split into sentences using SciSpacy (`en core sci md` tokenizer). ### Pretraining Procedures The model was trained using code from [Google's BERT repository](https://github.com/google-research/bert) on a GeForce GTX TITAN X 12 GB GPU. Model parameters were initialized with BioBERT (`BioBERT-Base v1.0 + PubMed 200K + PMC 270K`). ### Pretraining Hyperparameters We used a batch size of 32, a maximum sequence length of 128, and a learning rate of 5 · 10−5 for pre-training our models. The models trained on all MIMIC notes were trained for 150,000 steps. The dup factor for duplicating input data with different masks was set to 5. All other default parameters were used (specifically, masked language model probability = 0.15 and max predictions per sequence = 20). ## How to use the model Load the model via the transformers library: ``` from transformers import AutoTokenizer, AutoModel tokenizer = AutoTokenizer.from_pretrained("emilyalsentzer/Bio_ClinicalBERT") model = AutoModel.from_pretrained("emilyalsentzer/Bio_ClinicalBERT") ``` ## More Information Refer to the original paper, [Publicly Available Clinical BERT Embeddings](https://arxiv.org/abs/1904.03323) (NAACL Clinical NLP Workshop 2019) for additional details and performance on NLI and NER tasks. ## Questions? Post a Github issue on the [clinicalBERT repo](https://github.com/EmilyAlsentzer/clinicalBERT) or email emilya@mit.edu with any questions.

microsoft/trocr-base-handwritten

microsoft

transformers

image-to-text

--- tags: - trocr - image-to-text widget: - src: https://fki.tic.heia-fr.ch/static/img/a01-122-02.jpg example_title: Note 1 - src: https://encrypted-tbn0.gstatic.com/images?q=tbn:ANd9GcSoolxi9yWGAT5SLZShv8vVd0bz47UWRzQC19fDTeE8GmGv_Rn-PCF1pP1rrUx8kOjA4gg&usqp=CAU example_title: Note 2 - src: https://encrypted-tbn0.gstatic.com/images?q=tbn:ANd9GcRNYtTuSBpZPV_nkBYPMFwVVD9asZOPgHww4epu9EqWgDmXW--sE2o8og40ZfDGo87j5w&usqp=CAU example_title: Note 3 --- # TrOCR (base-sized model, fine-tuned on IAM) TrOCR model fine-tuned on the [IAM dataset](https://fki.tic.heia-fr.ch/databases/iam-handwriting-database). It was introduced in the paper [TrOCR: Transformer-based Optical Character Recognition with Pre-trained Models](https://arxiv.org/abs/2109.10282) by Li et al. and first released in [this repository](https://github.com/microsoft/unilm/tree/master/trocr). Disclaimer: The team releasing TrOCR did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description The TrOCR model is an encoder-decoder model, consisting of an image Transformer as encoder, and a text Transformer as decoder. The image encoder was initialized from the weights of BEiT, while the text decoder was initialized from the weights of RoBERTa. Images are presented to the model as a sequence of fixed-size patches (resolution 16x16), which are linearly embedded. One also adds absolute position embeddings before feeding the sequence to the layers of the Transformer encoder. Next, the Transformer text decoder autoregressively generates tokens. ## Intended uses & limitations You can use the raw model for optical character recognition (OCR) on single text-line images. See the [model hub](https://huggingface.co/models?search=microsoft/trocr) to look for fine-tuned versions on a task that interests you. ### How to use Here is how to use this model in PyTorch: ```python from transformers import TrOCRProcessor, VisionEncoderDecoderModel from PIL import Image import requests # load image from the IAM database url = 'https://fki.tic.heia-fr.ch/static/img/a01-122-02-00.jpg' image = Image.open(requests.get(url, stream=True).raw).convert("RGB") processor = TrOCRProcessor.from_pretrained('microsoft/trocr-base-handwritten') model = VisionEncoderDecoderModel.from_pretrained('microsoft/trocr-base-handwritten') pixel_values = processor(images=image, return_tensors="pt").pixel_values generated_ids = model.generate(pixel_values) generated_text = processor.batch_decode(generated_ids, skip_special_tokens=True)[0] ``` ### BibTeX entry and citation info ```bibtex @misc{li2021trocr, title={TrOCR: Transformer-based Optical Character Recognition with Pre-trained Models}, author={Minghao Li and Tengchao Lv and Lei Cui and Yijuan Lu and Dinei Florencio and Cha Zhang and Zhoujun Li and Furu Wei}, year={2021}, eprint={2109.10282}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

timm/efficientnet_b3.ra2_in1k

timm

timm

image-classification

--- tags: - image-classification - timm library_name: timm license: apache-2.0 datasets: - imagenet-1k --- # Model card for efficientnet_b3.ra2_in1k A EfficientNet image classification model. Trained on ImageNet-1k in `timm` using recipe template described below. Recipe details: * RandAugment `RA2` recipe. Inspired by and evolved from EfficientNet RandAugment recipes. Published as `B` recipe in [ResNet Strikes Back](https://arxiv.org/abs/2110.00476). * RMSProp (TF 1.0 behaviour) optimizer, EMA weight averaging * Step (exponential decay w/ staircase) LR schedule with warmup ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 12.2 - GMACs: 1.6 - Activations (M): 21.5 - Image size: train = 288 x 288, test = 320 x 320 - **Papers:** - EfficientNet: Rethinking Model Scaling for Convolutional Neural Networks: https://arxiv.org/abs/1905.11946 - ResNet strikes back: An improved training procedure in timm: https://arxiv.org/abs/2110.00476 - **Dataset:** ImageNet-1k - **Original:** https://github.com/huggingface/pytorch-image-models ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('efficientnet_b3.ra2_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Feature Map Extraction ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'efficientnet_b3.ra2_in1k', pretrained=True, features_only=True, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 for o in output: # print shape of each feature map in output # e.g.: # torch.Size([1, 24, 144, 144]) # torch.Size([1, 32, 72, 72]) # torch.Size([1, 48, 36, 36]) # torch.Size([1, 136, 18, 18]) # torch.Size([1, 384, 9, 9]) print(o.shape) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'efficientnet_b3.ra2_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled, a (1, 1536, 9, 9) shaped tensor output = model.forward_head(output, pre_logits=True) # output is a (1, num_features) shaped tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). ## Citation ```bibtex @inproceedings{tan2019efficientnet, title={Efficientnet: Rethinking model scaling for convolutional neural networks}, author={Tan, Mingxing and Le, Quoc}, booktitle={International conference on machine learning}, pages={6105--6114}, year={2019}, organization={PMLR} } ``` ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ``` ```bibtex @inproceedings{wightman2021resnet, title={ResNet strikes back: An improved training procedure in timm}, author={Wightman, Ross and Touvron, Hugo and Jegou, Herve}, booktitle={NeurIPS 2021 Workshop on ImageNet: Past, Present, and Future} } ```

laion/CLIP-ViT-H-14-laion2B-s32B-b79K

laion

open_clip

zero-shot-image-classification

--- license: mit widget: - src: >- https://huggingface.co/datasets/mishig/sample_images/resolve/main/cat-dog-music.png candidate_labels: playing music, playing sports example_title: Cat & Dog library_name: open_clip pipeline_tag: zero-shot-image-classification --- # Model Card for CLIP ViT-H/14 - LAION-2B # Table of Contents 1. [Model Details](#model-details) 2. [Uses](#uses) 3. [Training Details](#training-details) 4. [Evaluation](#evaluation) 5. [Acknowledgements](#acknowledgements) 6. [Citation](#citation) 7. [How To Get Started With the Model](#how-to-get-started-with-the-model) # Model Details ## Model Description A CLIP ViT-H/14 model trained with the LAION-2B English subset of LAION-5B (https://laion.ai/blog/laion-5b/) using OpenCLIP (https://github.com/mlfoundations/open_clip). Model training done by Romain Beaumont on the [stability.ai](https://stability.ai/) cluster. # Uses As per the original [OpenAI CLIP model card](https://github.com/openai/CLIP/blob/d50d76daa670286dd6cacf3bcd80b5e4823fc8e1/model-card.md), this model is intended as a research output for research communities. We hope that this model will enable researchers to better understand and explore zero-shot, arbitrary image classification. We also hope it can be used for interdisciplinary studies of the potential impact of such model. The OpenAI CLIP paper includes a discussion of potential downstream impacts to provide an example for this sort of analysis. Additionally, the LAION-5B blog (https://laion.ai/blog/laion-5b/) and upcoming paper include additional discussion as it relates specifically to the training dataset. ## Direct Use Zero-shot image classification, image and text retrieval, among others. ## Downstream Use Image classification and other image task fine-tuning, linear probe image classification, image generation guiding and conditioning, among others. ## Out-of-Scope Use As per the OpenAI models, **Any** deployed use case of the model - whether commercial or not - is currently out of scope. Non-deployed use cases such as image search in a constrained environment, are also not recommended unless there is thorough in-domain testing of the model with a specific, fixed class taxonomy. This is because our safety assessment demonstrated a high need for task specific testing especially given the variability of CLIP’s performance with different class taxonomies. This makes untested and unconstrained deployment of the model in any use case currently potentially harmful. Certain use cases which would fall under the domain of surveillance and facial recognition are always out-of-scope regardless of performance of the model. This is because the use of artificial intelligence for tasks such as these can be premature currently given the lack of testing norms and checks to ensure its fair use. Since the model has not been purposefully trained in or evaluated on any languages other than English, its use should be limited to English language use cases. Further the above notice, the LAION-5B dataset used in training of these models has additional considerations, see below. # Training Details ## Training Data This model was trained with the 2 Billion sample English subset of LAION-5B (https://laion.ai/blog/laion-5b/). **IMPORTANT NOTE:** The motivation behind dataset creation is to democratize research and experimentation around large-scale multi-modal model training and handling of uncurated, large-scale datasets crawled from publically available internet. Our recommendation is therefore to use the dataset for research purposes. Be aware that this large-scale dataset is uncurated. Keep in mind that the uncurated nature of the dataset means that collected links may lead to strongly discomforting and disturbing content for a human viewer. Therefore, please use the demo links with caution and at your own risk. It is possible to extract a “safe” subset by filtering out samples based on the safety tags (using a customized trained NSFW classifier that we built). While this strongly reduces the chance for encountering potentially harmful content when viewing, we cannot entirely exclude the possibility for harmful content being still present in safe mode, so that the warning holds also there. We think that providing the dataset openly to broad research and other interested communities will allow for transparent investigation of benefits that come along with training large-scale models as well as pitfalls and dangers that may stay unreported or unnoticed when working with closed large datasets that remain restricted to a small community. Providing our dataset openly, we however do not recommend using it for creating ready-to-go industrial products, as the basic research about general properties and safety of such large-scale models, which we would like to encourage with this release, is still in progress. ## Training Procedure Please see [training notes](https://docs.google.com/document/d/1EFbMLRWSSV0LUf9Du1pWzWqgeiIRPwEWX2s1C6mAk5c) and [wandb logs](https://wandb.ai/rom1504/eval_openclip/reports/H-14--VmlldzoyNDAxODQ3). # Evaluation Evaluation done with code in the [LAION CLIP Benchmark suite](https://github.com/LAION-AI/CLIP_benchmark). ## Testing Data, Factors & Metrics ### Testing Data The testing is performed with VTAB+ (A combination of VTAB (https://arxiv.org/abs/1910.04867) w/ additional robustness datasets) for classification and COCO and Flickr for retrieval. **TODO** - more detail ## Results The model achieves a 78.0 zero-shot top-1 accuracy on ImageNet-1k. An initial round of benchmarks have been performed on a wider range of datasets, currently viewable at https://github.com/LAION-AI/CLIP_benchmark/blob/main/benchmark/results.ipynb **TODO** - create table for just this model's metrics. # Acknowledgements Acknowledging [stability.ai](https://stability.ai/) for the compute used to train this model. # Citation **BibTeX:** LAION-5B ```bibtex @inproceedings{schuhmann2022laionb, title={{LAION}-5B: An open large-scale dataset for training next generation image-text models}, author={Christoph Schuhmann and Romain Beaumont and Richard Vencu and Cade W Gordon and Ross Wightman and Mehdi Cherti and Theo Coombes and Aarush Katta and Clayton Mullis and Mitchell Wortsman and Patrick Schramowski and Srivatsa R Kundurthy and Katherine Crowson and Ludwig Schmidt and Robert Kaczmarczyk and Jenia Jitsev}, booktitle={Thirty-sixth Conference on Neural Information Processing Systems Datasets and Benchmarks Track}, year={2022}, url={https://openreview.net/forum?id=M3Y74vmsMcY} } ``` OpenAI CLIP paper ``` @inproceedings{Radford2021LearningTV, title={Learning Transferable Visual Models From Natural Language Supervision}, author={Alec Radford and Jong Wook Kim and Chris Hallacy and A. Ramesh and Gabriel Goh and Sandhini Agarwal and Girish Sastry and Amanda Askell and Pamela Mishkin and Jack Clark and Gretchen Krueger and Ilya Sutskever}, booktitle={ICML}, year={2021} } ``` OpenCLIP software ``` @software{ilharco_gabriel_2021_5143773, author = {Ilharco, Gabriel and Wortsman, Mitchell and Wightman, Ross and Gordon, Cade and Carlini, Nicholas and Taori, Rohan and Dave, Achal and Shankar, Vaishaal and Namkoong, Hongseok and Miller, John and Hajishirzi, Hannaneh and Farhadi, Ali and Schmidt, Ludwig}, title = {OpenCLIP}, month = jul, year = 2021, note = {If you use this software, please cite it as below.}, publisher = {Zenodo}, version = {0.1}, doi = {10.5281/zenodo.5143773}, url = {https://doi.org/10.5281/zenodo.5143773} } ``` # How to Get Started with the Model Use the code below to get started with the model. ** TODO ** - Hugging Face transformers, OpenCLIP, and timm getting started snippets

Titeiiko/OTIS-Official-Spam-Model

Titeiiko

transformers

text-classification

--- license: bsd-3-clause language: - en tags: - anti-spam - spam --- <!-- PROJECT LOGO --> <br /> <div align="center"> <a href="https://github.com/JewishLewish/Otis"> <img src="https://cdn.discordapp.com/attachments/660227834500874276/1175310288212463706/47._Big_Tree_1.png?ex=656ac400&is=65584f00&hm=0518b63834cd0da8208e79c1b019fd41e170aaa860d4812695fb8a43d43abc55&" alt="Logo" width="200" height="200"> </a> <h3 align="center">Otis Anti-Spam AI</h3> <p align="center"> Go Away Spam! <br /> <a href="https://huggingface.co/Titeiiko/OTIS-Official-Spam-Model"><strong>» » Hugging Face</strong></a> <br /> <a href="https://github.com/JewishLewish/Otis"><strong>» » Github</strong></a> <br /> <div align="center">     </div> </p> </div> <!-- TABLE OF CONTENTS --> <details> <summary>Table of Contents</summary> <ol> <li> <a href="#Quickstart">Quickstart</a> </li> <li><a href="#contributing">Contributing</a></li> <li><a href="#license">License</a></li> <li><a href="#contact">Contact</a></li> </ol> </details> <!-- Quickstar --> ## Quickstart ```py # pip install transformers from transformers import pipeline def analyze_output(input: str): pipe = pipeline("text-classification", model="Titeiiko/OTIS-Official-Spam-Model") x = pipe(input)[0] if x["label"] == "LABEL_0": return {"type":"Not Spam", "probability":x["score"]} else: return {"type":"Spam", "probability":x["score"]} print(analyze_output("Cһeck out our amazinɡ bооѕting serviсe ѡhere you can get to Leveӏ 3 for 3 montһs for just 20 USD.")) #Output: {'type': 'Spam', 'probability': 0.9996588230133057} ``` <!-- ABOUT THE PROJECT --> ## About The Project Introducing Otis: Otis is an advanced anti-spam artificial intelligence model designed to mitigate and combat the proliferation of unwanted and malicious content within digital communication channels. <p align="right">(<a href="#readme-top">back to top</a>)</p> <!-- CONTRIBUTING --> ## Contributing Contributions are what make the open source community such an amazing place to learn, inspire, and create. Any contributions you make are **greatly appreciated**. If you have a suggestion that would make this better, please fork the repo and create a pull request. You can also simply open an issue with the tag "enhancement". Don't forget to give the project a star! Thanks again! 1. Fork the Project 2. Create your Feature Branch (`git checkout -b JewishLewish/Otis`) 3. Commit your Changes (`git commit -m 'Add some AmazingFeatures'`) 4. Push to the Branch (`git push origin JewishLewish/Otis`) 5. Open a Pull Request <p align="right">(<a href="#readme-top">back to top</a>)</p> <!-- LICENSE --> ## License Distributed under the BSD-3 License. See `LICENSE.txt` for more information. <p align="right">(<a href="#readme-top">back to top</a>)</p> <!-- CONTACT --> ## Contact My Email: lenny@lunes.host <p align="right">(<a href="#readme-top">back to top</a>)</p> # OtisV1 ``` {'loss': 0.2879, 'learning_rate': 4.75e-05, 'epoch': 0.5} {'loss': 0.1868, 'learning_rate': 4.5e-05, 'epoch': 1.0} {'eval_loss': 0.23244266211986542, 'eval_runtime': 4.2923, 'eval_samples_per_second': 465.951, 'eval_steps_per_second': 58.244, 'epoch': 1.0} {'loss': 0.1462, 'learning_rate': 4.25e-05, 'epoch': 1.5} {'loss': 0.1244, 'learning_rate': 4e-05, 'epoch': 2.0} {'eval_loss': 0.19869782030582428, 'eval_runtime': 4.5759, 'eval_samples_per_second': 437.075, 'eval_steps_per_second': 54.634, 'epoch': 2.0} {'loss': 0.0962, 'learning_rate': 3.7500000000000003e-05, 'epoch': 2.5} {'loss': 0.07, 'learning_rate': 3.5e-05, 'epoch': 3.0} {'eval_loss': 0.18761929869651794, 'eval_runtime': 4.1205, 'eval_samples_per_second': 485.372, 'eval_steps_per_second': 60.672, 'epoch': 3.0} {'loss': 0.0553, 'learning_rate': 3.2500000000000004e-05, 'epoch': 3.5} {'loss': 0.0721, 'learning_rate': 3e-05, 'epoch': 4.0} {'eval_loss': 0.19852963089942932, 'eval_runtime': 3.992, 'eval_samples_per_second': 501.004, 'eval_steps_per_second': 62.625, 'epoch': 4.0} {'loss': 0.0447, 'learning_rate': 2.7500000000000004e-05, 'epoch': 4.5} {'loss': 0.0461, 'learning_rate': 2.5e-05, 'epoch': 5.0} {'eval_loss': 0.20028768479824066, 'eval_runtime': 3.8479, 'eval_samples_per_second': 519.766, 'eval_steps_per_second': 64.971, 'epoch': 5.0} {'loss': 0.0432, 'learning_rate': 2.25e-05, 'epoch': 5.5} {'loss': 0.033, 'learning_rate': 2e-05, 'epoch': 6.0} {'eval_loss': 0.20464178919792175, 'eval_runtime': 3.9167, 'eval_samples_per_second': 510.638, 'eval_steps_per_second': 63.83, 'epoch': 6.0} {'loss': 0.0356, 'learning_rate': 1.75e-05, 'epoch': 6.5} {'loss': 0.027, 'learning_rate': 1.5e-05, 'epoch': 7.0} {'eval_loss': 0.20742492377758026, 'eval_runtime': 3.9716, 'eval_samples_per_second': 503.578, 'eval_steps_per_second': 62.947, 'epoch': 7.0} {'loss': 0.0225, 'learning_rate': 1.25e-05, 'epoch': 7.5} {'loss': 0.0329, 'learning_rate': 1e-05, 'epoch': 8.0} {'eval_loss': 0.20604351162910461, 'eval_runtime': 4.0244, 'eval_samples_per_second': 496.964, 'eval_steps_per_second': 62.12, 'epoch': 8.0} {'loss': 0.0221, 'learning_rate': 7.5e-06, 'epoch': 8.5} {'loss': 0.0127, 'learning_rate': 5e-06, 'epoch': 9.0} {'eval_loss': 0.21241146326065063, 'eval_runtime': 3.9242, 'eval_samples_per_second': 509.659, 'eval_steps_per_second': 63.707, 'epoch': 9.0} {'loss': 0.0202, 'learning_rate': 2.5e-06, 'epoch': 9.5} {'loss': 0.0229, 'learning_rate': 0.0, 'epoch': 10.0} {'eval_loss': 0.2140526920557022, 'eval_runtime': 3.9546, 'eval_samples_per_second': 505.743, 'eval_steps_per_second': 63.218, 'epoch': 10.0} {'train_runtime': 667.0781, 'train_samples_per_second': 119.926, 'train_steps_per_second': 14.991, 'train_loss': 0.07010261821746826, 'epoch': 10.0} ```

dslim/bert-large-NER

dslim

transformers

token-classification

--- language: en datasets: - conll2003 license: mit model-index: - name: dslim/bert-large-NER results: - task: type: token-classification name: Token Classification dataset: name: conll2003 type: conll2003 config: conll2003 split: test metrics: - name: Accuracy type: accuracy value: 0.9031688753722759 verified: true - name: Precision type: precision value: 0.920025068328604 verified: true - name: Recall type: recall value: 0.9193688678588825 verified: true - name: F1 type: f1 value: 0.9196968510445761 verified: true - name: loss type: loss value: 0.5085050463676453 verified: true --- # bert-large-NER ## Model description **bert-large-NER** is a fine-tuned BERT model that is ready to use for **Named Entity Recognition** and achieves **state-of-the-art performance** for the NER task. It has been trained to recognize four types of entities: location (LOC), organizations (ORG), person (PER) and Miscellaneous (MISC). Specifically, this model is a *bert-large-cased* model that was fine-tuned on the English version of the standard [CoNLL-2003 Named Entity Recognition](https://www.aclweb.org/anthology/W03-0419.pdf) dataset. If you'd like to use a smaller BERT model fine-tuned on the same dataset, a [**bert-base-NER**](https://huggingface.co/dslim/bert-base-NER/) version is also available. ## Intended uses & limitations #### How to use You can use this model with Transformers *pipeline* for NER. ```python from transformers import AutoTokenizer, AutoModelForTokenClassification from transformers import pipeline tokenizer = AutoTokenizer.from_pretrained("dslim/bert-large-NER") model = AutoModelForTokenClassification.from_pretrained("dslim/bert-large-NER") nlp = pipeline("ner", model=model, tokenizer=tokenizer) example = "My name is Wolfgang and I live in Berlin" ner_results = nlp(example) print(ner_results) ``` #### Limitations and bias This model is limited by its training dataset of entity-annotated news articles from a specific span of time. This may not generalize well for all use cases in different domains. Furthermore, the model occassionally tags subword tokens as entities and post-processing of results may be necessary to handle those cases. ## Training data This model was fine-tuned on English version of the standard [CoNLL-2003 Named Entity Recognition](https://www.aclweb.org/anthology/W03-0419.pdf) dataset. The training dataset distinguishes between the beginning and continuation of an entity so that if there are back-to-back entities of the same type, the model can output where the second entity begins. As in the dataset, each token will be classified as one of the following classes: Abbreviation|Description -|- O|Outside of a named entity B-MIS |Beginning of a miscellaneous entity right after another miscellaneous entity I-MIS | Miscellaneous entity B-PER |Beginning of a person’s name right after another person’s name I-PER |Person’s name B-ORG |Beginning of an organization right after another organization I-ORG |organization B-LOC |Beginning of a location right after another location I-LOC |Location ### CoNLL-2003 English Dataset Statistics This dataset was derived from the Reuters corpus which consists of Reuters news stories. You can read more about how this dataset was created in the CoNLL-2003 paper. #### # of training examples per entity type Dataset|LOC|MISC|ORG|PER -|-|-|-|- Train|7140|3438|6321|6600 Dev|1837|922|1341|1842 Test|1668|702|1661|1617 #### # of articles/sentences/tokens per dataset Dataset |Articles |Sentences |Tokens -|-|-|- Train |946 |14,987 |203,621 Dev |216 |3,466 |51,362 Test |231 |3,684 |46,435 ## Training procedure This model was trained on a single NVIDIA V100 GPU with recommended hyperparameters from the [original BERT paper](https://arxiv.org/pdf/1810.04805) which trained & evaluated the model on CoNLL-2003 NER task. ## Eval results metric|dev|test -|-|- f1 |95.7 |91.7 precision |95.3 |91.2 recall |96.1 |92.3 The test metrics are a little lower than the official Google BERT results which encoded document context & experimented with CRF. More on replicating the original results [here](https://github.com/google-research/bert/issues/223). ### BibTeX entry and citation info ``` @article{DBLP:journals/corr/abs-1810-04805, author = {Jacob Devlin and Ming{-}Wei Chang and Kenton Lee and Kristina Toutanova}, title = {{BERT:} Pre-training of Deep Bidirectional Transformers for Language Understanding}, journal = {CoRR}, volume = {abs/1810.04805}, year = {2018}, url = {http://arxiv.org/abs/1810.04805}, archivePrefix = {arXiv}, eprint = {1810.04805}, timestamp = {Tue, 30 Oct 2018 20:39:56 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1810-04805.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ``` ``` @inproceedings{tjong-kim-sang-de-meulder-2003-introduction, title = "Introduction to the {C}o{NLL}-2003 Shared Task: Language-Independent Named Entity Recognition", author = "Tjong Kim Sang, Erik F. and De Meulder, Fien", booktitle = "Proceedings of the Seventh Conference on Natural Language Learning at {HLT}-{NAACL} 2003", year = "2003", url = "https://www.aclweb.org/anthology/W03-0419", pages = "142--147", } ```

facebook/bart-base

facebook

transformers

feature-extraction

--- license: apache-2.0 language: en --- # BART (base-sized model) BART model pre-trained on English language. It was introduced in the paper [BART: Denoising Sequence-to-Sequence Pre-training for Natural Language Generation, Translation, and Comprehension](https://arxiv.org/abs/1910.13461) by Lewis et al. and first released in [this repository](https://github.com/pytorch/fairseq/tree/master/examples/bart). Disclaimer: The team releasing BART did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description BART is a transformer encoder-decoder (seq2seq) model with a bidirectional (BERT-like) encoder and an autoregressive (GPT-like) decoder. BART is pre-trained by (1) corrupting text with an arbitrary noising function, and (2) learning a model to reconstruct the original text. BART is particularly effective when fine-tuned for text generation (e.g. summarization, translation) but also works well for comprehension tasks (e.g. text classification, question answering). ## Intended uses & limitations You can use the raw model for text infilling. However, the model is mostly meant to be fine-tuned on a supervised dataset. See the [model hub](https://huggingface.co/models?search=bart) to look for fine-tuned versions on a task that interests you. ### How to use Here is how to use this model in PyTorch: ```python from transformers import BartTokenizer, BartModel tokenizer = BartTokenizer.from_pretrained('facebook/bart-base') model = BartModel.from_pretrained('facebook/bart-base') inputs = tokenizer("Hello, my dog is cute", return_tensors="pt") outputs = model(**inputs) last_hidden_states = outputs.last_hidden_state ``` ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-1910-13461, author = {Mike Lewis and Yinhan Liu and Naman Goyal and Marjan Ghazvininejad and Abdelrahman Mohamed and Omer Levy and Veselin Stoyanov and Luke Zettlemoyer}, title = {{BART:} Denoising Sequence-to-Sequence Pre-training for Natural Language Generation, Translation, and Comprehension}, journal = {CoRR}, volume = {abs/1910.13461}, year = {2019}, url = {http://arxiv.org/abs/1910.13461}, eprinttype = {arXiv}, eprint = {1910.13461}, timestamp = {Thu, 31 Oct 2019 14:02:26 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1910-13461.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

mistralai/Mistral-7B-Instruct-v0.1

mistralai

transformers

text-generation

--- license: apache-2.0 pipeline_tag: text-generation tags: - finetuned inference: true widget: - messages: - role: user content: What is your favorite condiment? --- # Model Card for Mistral-7B-Instruct-v0.1 The Mistral-7B-Instruct-v0.1 Large Language Model (LLM) is a instruct fine-tuned version of the [Mistral-7B-v0.1](https://huggingface.co/mistralai/Mistral-7B-v0.1) generative text model using a variety of publicly available conversation datasets. For full details of this model please read our [paper](https://arxiv.org/abs/2310.06825) and [release blog post](https://mistral.ai/news/announcing-mistral-7b/). ## Instruction format In order to leverage instruction fine-tuning, your prompt should be surrounded by `[INST]` and `[/INST]` tokens. The very first instruction should begin with a begin of sentence id. The next instructions should not. The assistant generation will be ended by the end-of-sentence token id. E.g. ``` text = "<s>[INST] What is your favourite condiment? [/INST]" "Well, I'm quite partial to a good squeeze of fresh lemon juice. It adds just the right amount of zesty flavour to whatever I'm cooking up in the kitchen!</s> " "[INST] Do you have mayonnaise recipes? [/INST]" ``` This format is available as a [chat template](https://huggingface.co/docs/transformers/main/chat_templating) via the `apply_chat_template()` method: ```python from transformers import AutoModelForCausalLM, AutoTokenizer device = "cuda" # the device to load the model onto model = AutoModelForCausalLM.from_pretrained("mistralai/Mistral-7B-Instruct-v0.1") tokenizer = AutoTokenizer.from_pretrained("mistralai/Mistral-7B-Instruct-v0.1") messages = [ {"role": "user", "content": "What is your favourite condiment?"}, {"role": "assistant", "content": "Well, I'm quite partial to a good squeeze of fresh lemon juice. It adds just the right amount of zesty flavour to whatever I'm cooking up in the kitchen!"}, {"role": "user", "content": "Do you have mayonnaise recipes?"} ] encodeds = tokenizer.apply_chat_template(messages, return_tensors="pt") model_inputs = encodeds.to(device) model.to(device) generated_ids = model.generate(model_inputs, max_new_tokens=1000, do_sample=True) decoded = tokenizer.batch_decode(generated_ids) print(decoded[0]) ``` ## Model Architecture This instruction model is based on Mistral-7B-v0.1, a transformer model with the following architecture choices: - Grouped-Query Attention - Sliding-Window Attention - Byte-fallback BPE tokenizer ## Troubleshooting - If you see the following error: ``` Traceback (most recent call last): File "", line 1, in File "/transformers/models/auto/auto_factory.py", line 482, in from_pretrained config, kwargs = AutoConfig.from_pretrained( File "/transformers/models/auto/configuration_auto.py", line 1022, in from_pretrained config_class = CONFIG_MAPPING[config_dict["model_type"]] File "/transformers/models/auto/configuration_auto.py", line 723, in getitem raise KeyError(key) KeyError: 'mistral' ``` Installing transformers from source should solve the issue pip install git+https://github.com/huggingface/transformers This should not be required after transformers-v4.33.4. ## Limitations The Mistral 7B Instruct model is a quick demonstration that the base model can be easily fine-tuned to achieve compelling performance. It does not have any moderation mechanisms. We're looking forward to engaging with the community on ways to make the model finely respect guardrails, allowing for deployment in environments requiring moderated outputs. ## The Mistral AI Team Albert Jiang, Alexandre Sablayrolles, Arthur Mensch, Chris Bamford, Devendra Singh Chaplot, Diego de las Casas, Florian Bressand, Gianna Lengyel, Guillaume Lample, Lélio Renard Lavaud, Lucile Saulnier, Marie-Anne Lachaux, Pierre Stock, Teven Le Scao, Thibaut Lavril, Thomas Wang, Timothée Lacroix, William El Sayed.

facebook/opt-125m

facebook

transformers

text-generation

--- language: en inference: false tags: - text-generation - opt license: other commercial: false --- # OPT : Open Pre-trained Transformer Language Models OPT was first introduced in [Open Pre-trained Transformer Language Models](https://arxiv.org/abs/2205.01068) and first released in [metaseq's repository](https://github.com/facebookresearch/metaseq) on May 3rd 2022 by Meta AI. **Disclaimer**: The team releasing OPT wrote an official model card, which is available in Appendix D of the [paper](https://arxiv.org/pdf/2205.01068.pdf). Content from **this** model card has been written by the Hugging Face team. ## Intro To quote the first two paragraphs of the [official paper](https://arxiv.org/abs/2205.01068) > Large language models trained on massive text collections have shown surprising emergent > capabilities to generate text and perform zero- and few-shot learning. While in some cases the public > can interact with these models through paid APIs, full model access is currently limited to only a > few highly resourced labs. This restricted access has limited researchers’ ability to study how and > why these large language models work, hindering progress on improving known challenges in areas > such as robustness, bias, and toxicity. > We present Open Pretrained Transformers (OPT), a suite of decoder-only pre-trained transformers ranging from 125M > to 175B parameters, which we aim to fully and responsibly share with interested researchers. We train the OPT models to roughly match > the performance and sizes of the GPT-3 class of models, while also applying the latest best practices in data > collection and efficient training. Our aim in developing this suite of OPT models is to enable reproducible and responsible research at scale, and > to bring more voices to the table in studying the impact of these LLMs. Definitions of risk, harm, bias, and toxicity, etc., should be articulated by the > collective research community as a whole, which is only possible when models are available for study. ## Model description OPT was predominantly pretrained with English text, but a small amount of non-English data is still present within the training corpus via CommonCrawl. The model was pretrained using a causal language modeling (CLM) objective. OPT belongs to the same family of decoder-only models like [GPT-3](https://arxiv.org/abs/2005.14165). As such, it was pretrained using the self-supervised causal language modedling objective. For evaluation, OPT follows [GPT-3](https://arxiv.org/abs/2005.14165) by using their prompts and overall experimental setup. For more details, please read the [official paper](https://arxiv.org/abs/2205.01068). ## Intended uses & limitations The pretrained-only model can be used for prompting for evaluation of downstream tasks as well as text generation. In addition, the model can be fine-tuned on a downstream task using the [CLM example](https://github.com/huggingface/transformers/tree/main/examples/pytorch/language-modeling). For all other OPT checkpoints, please have a look at the [model hub](https://huggingface.co/models?filter=opt). ### How to use You can use this model directly with a pipeline for text generation. ```python >>> from transformers import pipeline >>> generator = pipeline('text-generation', model="facebook/opt-125m") >>> generator("What are we having for dinner?") [{'generated_text': 'What are we having for dinner?\nA nice dinner with a friend.\nI'm not sure'}] ``` By default, generation is deterministic. In order to use the top-k sampling, please set `do_sample` to `True`. ```python >>> from transformers import pipeline, set_seed >>> set_seed(32) >>> generator = pipeline('text-generation', model="facebook/opt-125m", do_sample=True) >>> generator("What are we having for dinner?") [{'generated_text': 'What are we having for dinner?\nCoffee, sausage and cream cheese at Chili's.'}] ``` ### Limitations and bias As mentioned in Meta AI's model card, given that the training data used for this model contains a lot of unfiltered content from the internet, which is far from neutral the model is strongly biased : > Like other large language models for which the diversity (or lack thereof) of training > data induces downstream impact on the quality of our model, OPT-175B has limitations in terms > of bias and safety. OPT-175B can also have quality issues in terms of generation diversity and > hallucination. In general, OPT-175B is not immune from the plethora of issues that plague modern > large language models. This bias will also affect all fine-tuned versions of this model. ## Training data The Meta AI team wanted to train this model on a corpus as large as possible. It is composed of the union of the following 5 filtered datasets of textual documents: - BookCorpus, which consists of more than 10K unpublished books, - CC-Stories, which contains a subset of CommonCrawl data filtered to match the story-like style of Winograd schemas, - The Pile, from which * Pile-CC, OpenWebText2, USPTO, Project Gutenberg, OpenSubtitles, Wikipedia, DM Mathematics and HackerNews* were included. - Pushshift.io Reddit dataset that was developed in Baumgartner et al. (2020) and processed in Roller et al. (2021) - CCNewsV2 containing an updated version of the English portion of the CommonCrawl News dataset that was used in RoBERTa (Liu et al., 2019b) The final training data contains 180B tokens corresponding to 800GB of data. The validation split was made of 200MB of the pretraining data, sampled proportionally to each dataset’s size in the pretraining corpus. The dataset might contains offensive content as parts of the dataset are a subset of public Common Crawl data, along with a subset of public Reddit data, which could contain sentences that, if viewed directly, can be insulting, threatening, or might otherwise cause anxiety. ### Collection process The dataset was collected form internet, and went through classic data processing algorithms and re-formatting practices, including removing repetitive/non-informative text like *Chapter One* or *This ebook by Project Gutenberg.* ## Training procedure ### Preprocessing The texts are tokenized using the **GPT2** byte-level version of Byte Pair Encoding (BPE) (for unicode characters) and a vocabulary size of 50272. The inputs are sequences of 2048 consecutive tokens. The 175B model was trained on 992 *80GB A100 GPUs*. The training duration was roughly ~33 days of continuous training. ### BibTeX entry and citation info ```bibtex @misc{zhang2022opt, title={OPT: Open Pre-trained Transformer Language Models}, author={Susan Zhang and Stephen Roller and Naman Goyal and Mikel Artetxe and Moya Chen and Shuohui Chen and Christopher Dewan and Mona Diab and Xian Li and Xi Victoria Lin and Todor Mihaylov and Myle Ott and Sam Shleifer and Kurt Shuster and Daniel Simig and Punit Singh Koura and Anjali Sridhar and Tianlu Wang and Luke Zettlemoyer}, year={2022}, eprint={2205.01068}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

padmajabfrl/Gender-Classification

padmajabfrl

transformers

text-classification

--- license: apache-2.0 tags: - generated_from_trainer metrics: - accuracy model-index: - name: Gender-Classification results: [] --- <!-- This model card has been generated automatically according to the information the Trainer had access to. You should probably proofread and complete it, then remove this comment. --> # Gender-Classification This model is a fine-tuned version of [distilbert-base-uncased](https://huggingface.co/distilbert-base-uncased) on an unknown dataset. It achieves the following results on the evaluation set: - Loss: 0.0000 - Accuracy: 1.0 ## Model description More information needed ## Intended uses & limitations More information needed ## Training and evaluation data More information needed ## Training procedure ### Training hyperparameters The following hyperparameters were used during training: - learning_rate: 2e-05 - train_batch_size: 16 - eval_batch_size: 16 - seed: 42 - optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 - lr_scheduler_type: linear - num_epochs: 5 ### Training results | Training Loss | Epoch | Step | Validation Loss | Accuracy | |:-------------:|:-----:|:-----:|:---------------:|:--------:| | 0.0035 | 1.0 | 4390 | 0.0004 | 1.0000 | | 0.0005 | 2.0 | 8780 | 0.0002 | 1.0000 | | 0.0 | 3.0 | 13170 | 0.0000 | 1.0 | | 0.0 | 4.0 | 17560 | 0.0000 | 1.0 | | 0.0 | 5.0 | 21950 | 0.0000 | 1.0 | ### Framework versions - Transformers 4.25.1 - Pytorch 1.13.0+cu116 - Datasets 2.8.0 - Tokenizers 0.13.2

stabilityai/stable-diffusion-xl-refiner-1.0

stabilityai

diffusers

image-to-image

--- license: openrail++ tags: - stable-diffusion - image-to-image --- # SD-XL 1.0-refiner Model Card  ## Model  [SDXL](https://arxiv.org/abs/2307.01952) consists of an [ensemble of experts](https://arxiv.org/abs/2211.01324) pipeline for latent diffusion: In a first step, the base model (available here: https://huggingface.co/stabilityai/stable-diffusion-xl-base-1.0) is used to generate (noisy) latents, which are then further processed with a refinement model specialized for the final denoising steps. Note that the base model can be used as a standalone module. Alternatively, we can use a two-stage pipeline as follows: First, the base model is used to generate latents of the desired output size. In the second step, we use a specialized high-resolution model and apply a technique called SDEdit (https://arxiv.org/abs/2108.01073, also known as "img2img") to the latents generated in the first step, using the same prompt. This technique is slightly slower than the first one, as it requires more function evaluations. Source code is available at https://github.com/Stability-AI/generative-models . ### Model Description - **Developed by:** Stability AI - **Model type:** Diffusion-based text-to-image generative model - **License:** [CreativeML Open RAIL++-M License](https://huggingface.co/stabilityai/stable-diffusion-xl-refiner-1.0/blob/main/LICENSE.md) - **Model Description:** This is a model that can be used to generate and modify images based on text prompts. It is a [Latent Diffusion Model](https://arxiv.org/abs/2112.10752) that uses two fixed, pretrained text encoders ([OpenCLIP-ViT/G](https://github.com/mlfoundations/open_clip) and [CLIP-ViT/L](https://github.com/openai/CLIP/tree/main)). - **Resources for more information:** Check out our [GitHub Repository](https://github.com/Stability-AI/generative-models) and the [SDXL report on arXiv](https://arxiv.org/abs/2307.01952). ### Model Sources For research purposes, we recommned our `generative-models` Github repository (https://github.com/Stability-AI/generative-models), which implements the most popoular diffusion frameworks (both training and inference) and for which new functionalities like distillation will be added over time. [Clipdrop](https://clipdrop.co/stable-diffusion) provides free SDXL inference. - **Repository:** https://github.com/Stability-AI/generative-models - **Demo:** https://clipdrop.co/stable-diffusion ## Evaluation  The chart above evaluates user preference for SDXL (with and without refinement) over SDXL 0.9 and Stable Diffusion 1.5 and 2.1. The SDXL base model performs significantly better than the previous variants, and the model combined with the refinement module achieves the best overall performance. ### 🧨 Diffusers Make sure to upgrade diffusers to >= 0.18.0: ``` pip install diffusers --upgrade ``` In addition make sure to install `transformers`, `safetensors`, `accelerate` as well as the invisible watermark: ``` pip install invisible_watermark transformers accelerate safetensors ``` Yon can then use the refiner to improve images. ```py import torch from diffusers import StableDiffusionXLImg2ImgPipeline from diffusers.utils import load_image pipe = StableDiffusionXLImg2ImgPipeline.from_pretrained( "stabilityai/stable-diffusion-xl-refiner-1.0", torch_dtype=torch.float16, variant="fp16", use_safetensors=True ) pipe = pipe.to("cuda") url = "https://huggingface.co/datasets/patrickvonplaten/images/resolve/main/aa_xl/000000009.png" init_image = load_image(url).convert("RGB") prompt = "a photo of an astronaut riding a horse on mars" image = pipe(prompt, image=init_image).images ``` When using `torch >= 2.0`, you can improve the inference speed by 20-30% with torch.compile. Simple wrap the unet with torch compile before running the pipeline: ```py pipe.unet = torch.compile(pipe.unet, mode="reduce-overhead", fullgraph=True) ``` If you are limited by GPU VRAM, you can enable *cpu offloading* by calling `pipe.enable_model_cpu_offload` instead of `.to("cuda")`: ```diff - pipe.to("cuda") + pipe.enable_model_cpu_offload() ``` For more advanced use cases, please have a look at [the docs](https://huggingface.co/docs/diffusers/main/en/api/pipelines/stable_diffusion/stable_diffusion_xl). ## Uses ### Direct Use The model is intended for research purposes only. Possible research areas and tasks include - Generation of artworks and use in design and other artistic processes. - Applications in educational or creative tools. - Research on generative models. - Safe deployment of models which have the potential to generate harmful content. - Probing and understanding the limitations and biases of generative models. Excluded uses are described below. ### Out-of-Scope Use The model was not trained to be factual or true representations of people or events, and therefore using the model to generate such content is out-of-scope for the abilities of this model. ## Limitations and Bias ### Limitations - The model does not achieve perfect photorealism - The model cannot render legible text - The model struggles with more difficult tasks which involve compositionality, such as rendering an image corresponding to “A red cube on top of a blue sphere” - Faces and people in general may not be generated properly. - The autoencoding part of the model is lossy. ### Bias While the capabilities of image generation models are impressive, they can also reinforce or exacerbate social biases.

jinaai/jina-embeddings-v2-base-en

jinaai

sentence-transformers

feature-extraction

--- tags: - sentence-transformers - feature-extraction - sentence-similarity - mteb datasets: - allenai/c4 language: en inference: false license: apache-2.0 model-index: - name: jina-embedding-b-en-v2 results: - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en) config: en split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 74.73134328358209 - type: ap value: 37.765427081831035 - type: f1 value: 68.79367444339518 - task: type: Classification dataset: type: mteb/amazon_polarity name: MTEB AmazonPolarityClassification config: default split: test revision: e2d317d38cd51312af73b3d32a06d1a08b442046 metrics: - type: accuracy value: 88.544275 - type: ap value: 84.61328675662887 - type: f1 value: 88.51879035862375 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (en) config: en split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 45.263999999999996 - type: f1 value: 43.778759656699435 - task: type: Retrieval dataset: type: arguana name: MTEB ArguAna config: default split: test revision: None metrics: - type: map_at_1 value: 21.693 - type: map_at_10 value: 35.487 - type: map_at_100 value: 36.862 - type: map_at_1000 value: 36.872 - type: map_at_3 value: 30.049999999999997 - type: map_at_5 value: 32.966 - type: mrr_at_1 value: 21.977 - type: mrr_at_10 value: 35.565999999999995 - type: mrr_at_100 value: 36.948 - type: mrr_at_1000 value: 36.958 - type: mrr_at_3 value: 30.121 - type: mrr_at_5 value: 33.051 - type: ndcg_at_1 value: 21.693 - type: ndcg_at_10 value: 44.181 - type: ndcg_at_100 value: 49.982 - type: ndcg_at_1000 value: 50.233000000000004 - type: ndcg_at_3 value: 32.830999999999996 - type: ndcg_at_5 value: 38.080000000000005 - type: precision_at_1 value: 21.693 - type: precision_at_10 value: 7.248 - type: precision_at_100 value: 0.9769999999999999 - type: precision_at_1000 value: 0.1 - type: precision_at_3 value: 13.632 - type: precision_at_5 value: 10.725 - type: recall_at_1 value: 21.693 - type: recall_at_10 value: 72.475 - type: recall_at_100 value: 97.653 - type: recall_at_1000 value: 99.57300000000001 - type: recall_at_3 value: 40.896 - type: recall_at_5 value: 53.627 - task: type: Clustering dataset: type: mteb/arxiv-clustering-p2p name: MTEB ArxivClusteringP2P config: default split: test revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d metrics: - type: v_measure value: 45.39242428696777 - task: type: Clustering dataset: type: mteb/arxiv-clustering-s2s name: MTEB ArxivClusteringS2S config: default split: test revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 metrics: - type: v_measure value: 36.675626784714 - task: type: Reranking dataset: type: mteb/askubuntudupquestions-reranking name: MTEB AskUbuntuDupQuestions config: default split: test revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 metrics: - type: map value: 62.247725694904034 - type: mrr value: 74.91359978894604 - task: type: STS dataset: type: mteb/biosses-sts name: MTEB BIOSSES config: default split: test revision: d3fb88f8f02e40887cd149695127462bbcf29b4a metrics: - type: cos_sim_pearson value: 82.68003802970496 - type: cos_sim_spearman value: 81.23438110096286 - type: euclidean_pearson value: 81.87462986142582 - type: euclidean_spearman value: 81.23438110096286 - type: manhattan_pearson value: 81.61162566600755 - type: manhattan_spearman value: 81.11329400456184 - task: type: Classification dataset: type: mteb/banking77 name: MTEB Banking77Classification config: default split: test revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 metrics: - type: accuracy value: 84.01298701298701 - type: f1 value: 83.31690714969382 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-p2p name: MTEB BiorxivClusteringP2P config: default split: test revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 metrics: - type: v_measure value: 37.050108150972086 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-s2s name: MTEB BiorxivClusteringS2S config: default split: test revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 metrics: - type: v_measure value: 30.15731442819715 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackAndroidRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 31.391999999999996 - type: map_at_10 value: 42.597 - type: map_at_100 value: 44.07 - type: map_at_1000 value: 44.198 - type: map_at_3 value: 38.957 - type: map_at_5 value: 40.961 - type: mrr_at_1 value: 37.196 - type: mrr_at_10 value: 48.152 - type: mrr_at_100 value: 48.928 - type: mrr_at_1000 value: 48.964999999999996 - type: mrr_at_3 value: 45.446 - type: mrr_at_5 value: 47.205999999999996 - type: ndcg_at_1 value: 37.196 - type: ndcg_at_10 value: 49.089 - type: ndcg_at_100 value: 54.471000000000004 - type: ndcg_at_1000 value: 56.385 - type: ndcg_at_3 value: 43.699 - type: ndcg_at_5 value: 46.22 - type: precision_at_1 value: 37.196 - type: precision_at_10 value: 9.313 - type: precision_at_100 value: 1.478 - type: precision_at_1000 value: 0.198 - type: precision_at_3 value: 20.839 - type: precision_at_5 value: 14.936 - type: recall_at_1 value: 31.391999999999996 - type: recall_at_10 value: 61.876 - type: recall_at_100 value: 84.214 - type: recall_at_1000 value: 95.985 - type: recall_at_3 value: 46.6 - type: recall_at_5 value: 53.588 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackEnglishRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 29.083 - type: map_at_10 value: 38.812999999999995 - type: map_at_100 value: 40.053 - type: map_at_1000 value: 40.188 - type: map_at_3 value: 36.111 - type: map_at_5 value: 37.519000000000005 - type: mrr_at_1 value: 36.497 - type: mrr_at_10 value: 44.85 - type: mrr_at_100 value: 45.546 - type: mrr_at_1000 value: 45.593 - type: mrr_at_3 value: 42.686 - type: mrr_at_5 value: 43.909 - type: ndcg_at_1 value: 36.497 - type: ndcg_at_10 value: 44.443 - type: ndcg_at_100 value: 48.979 - type: ndcg_at_1000 value: 51.154999999999994 - type: ndcg_at_3 value: 40.660000000000004 - type: ndcg_at_5 value: 42.193000000000005 - type: precision_at_1 value: 36.497 - type: precision_at_10 value: 8.433 - type: precision_at_100 value: 1.369 - type: precision_at_1000 value: 0.185 - type: precision_at_3 value: 19.894000000000002 - type: precision_at_5 value: 13.873 - type: recall_at_1 value: 29.083 - type: recall_at_10 value: 54.313 - type: recall_at_100 value: 73.792 - type: recall_at_1000 value: 87.629 - type: recall_at_3 value: 42.257 - type: recall_at_5 value: 47.066 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGamingRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 38.556000000000004 - type: map_at_10 value: 50.698 - type: map_at_100 value: 51.705 - type: map_at_1000 value: 51.768 - type: map_at_3 value: 47.848 - type: map_at_5 value: 49.358000000000004 - type: mrr_at_1 value: 43.95 - type: mrr_at_10 value: 54.191 - type: mrr_at_100 value: 54.852999999999994 - type: mrr_at_1000 value: 54.885 - type: mrr_at_3 value: 51.954 - type: mrr_at_5 value: 53.13 - type: ndcg_at_1 value: 43.95 - type: ndcg_at_10 value: 56.516 - type: ndcg_at_100 value: 60.477000000000004 - type: ndcg_at_1000 value: 61.746 - type: ndcg_at_3 value: 51.601 - type: ndcg_at_5 value: 53.795 - type: precision_at_1 value: 43.95 - type: precision_at_10 value: 9.009 - type: precision_at_100 value: 1.189 - type: precision_at_1000 value: 0.135 - type: precision_at_3 value: 22.989 - type: precision_at_5 value: 15.473 - type: recall_at_1 value: 38.556000000000004 - type: recall_at_10 value: 70.159 - type: recall_at_100 value: 87.132 - type: recall_at_1000 value: 96.16 - type: recall_at_3 value: 56.906 - type: recall_at_5 value: 62.332 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGisRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 24.238 - type: map_at_10 value: 32.5 - type: map_at_100 value: 33.637 - type: map_at_1000 value: 33.719 - type: map_at_3 value: 30.026999999999997 - type: map_at_5 value: 31.555 - type: mrr_at_1 value: 26.328000000000003 - type: mrr_at_10 value: 34.44 - type: mrr_at_100 value: 35.455999999999996 - type: mrr_at_1000 value: 35.521 - type: mrr_at_3 value: 32.034 - type: mrr_at_5 value: 33.565 - type: ndcg_at_1 value: 26.328000000000003 - type: ndcg_at_10 value: 37.202 - type: ndcg_at_100 value: 42.728 - type: ndcg_at_1000 value: 44.792 - type: ndcg_at_3 value: 32.368 - type: ndcg_at_5 value: 35.008 - type: precision_at_1 value: 26.328000000000003 - type: precision_at_10 value: 5.7059999999999995 - type: precision_at_100 value: 0.8880000000000001 - type: precision_at_1000 value: 0.11100000000000002 - type: precision_at_3 value: 13.672 - type: precision_at_5 value: 9.74 - type: recall_at_1 value: 24.238 - type: recall_at_10 value: 49.829 - type: recall_at_100 value: 75.21 - type: recall_at_1000 value: 90.521 - type: recall_at_3 value: 36.867 - type: recall_at_5 value: 43.241 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackMathematicaRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 15.378 - type: map_at_10 value: 22.817999999999998 - type: map_at_100 value: 23.977999999999998 - type: map_at_1000 value: 24.108 - type: map_at_3 value: 20.719 - type: map_at_5 value: 21.889 - type: mrr_at_1 value: 19.03 - type: mrr_at_10 value: 27.022000000000002 - type: mrr_at_100 value: 28.011999999999997 - type: mrr_at_1000 value: 28.096 - type: mrr_at_3 value: 24.855 - type: mrr_at_5 value: 26.029999999999998 - type: ndcg_at_1 value: 19.03 - type: ndcg_at_10 value: 27.526 - type: ndcg_at_100 value: 33.040000000000006 - type: ndcg_at_1000 value: 36.187000000000005 - type: ndcg_at_3 value: 23.497 - type: ndcg_at_5 value: 25.334 - type: precision_at_1 value: 19.03 - type: precision_at_10 value: 4.963 - type: precision_at_100 value: 0.893 - type: precision_at_1000 value: 0.13 - type: precision_at_3 value: 11.360000000000001 - type: precision_at_5 value: 8.134 - type: recall_at_1 value: 15.378 - type: recall_at_10 value: 38.061 - type: recall_at_100 value: 61.754 - type: recall_at_1000 value: 84.259 - type: recall_at_3 value: 26.788 - type: recall_at_5 value: 31.326999999999998 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackPhysicsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.511999999999997 - type: map_at_10 value: 37.429 - type: map_at_100 value: 38.818000000000005 - type: map_at_1000 value: 38.924 - type: map_at_3 value: 34.625 - type: map_at_5 value: 36.064 - type: mrr_at_1 value: 33.300999999999995 - type: mrr_at_10 value: 43.036 - type: mrr_at_100 value: 43.894 - type: mrr_at_1000 value: 43.936 - type: mrr_at_3 value: 40.825 - type: mrr_at_5 value: 42.028 - type: ndcg_at_1 value: 33.300999999999995 - type: ndcg_at_10 value: 43.229 - type: ndcg_at_100 value: 48.992000000000004 - type: ndcg_at_1000 value: 51.02100000000001 - type: ndcg_at_3 value: 38.794000000000004 - type: ndcg_at_5 value: 40.65 - type: precision_at_1 value: 33.300999999999995 - type: precision_at_10 value: 7.777000000000001 - type: precision_at_100 value: 1.269 - type: precision_at_1000 value: 0.163 - type: precision_at_3 value: 18.351 - type: precision_at_5 value: 12.762 - type: recall_at_1 value: 27.511999999999997 - type: recall_at_10 value: 54.788000000000004 - type: recall_at_100 value: 79.105 - type: recall_at_1000 value: 92.49199999999999 - type: recall_at_3 value: 41.924 - type: recall_at_5 value: 47.026 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackProgrammersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 24.117 - type: map_at_10 value: 33.32 - type: map_at_100 value: 34.677 - type: map_at_1000 value: 34.78 - type: map_at_3 value: 30.233999999999998 - type: map_at_5 value: 31.668000000000003 - type: mrr_at_1 value: 29.566 - type: mrr_at_10 value: 38.244 - type: mrr_at_100 value: 39.245000000000005 - type: mrr_at_1000 value: 39.296 - type: mrr_at_3 value: 35.864000000000004 - type: mrr_at_5 value: 36.919999999999995 - type: ndcg_at_1 value: 29.566 - type: ndcg_at_10 value: 39.127 - type: ndcg_at_100 value: 44.989000000000004 - type: ndcg_at_1000 value: 47.189 - type: ndcg_at_3 value: 34.039 - type: ndcg_at_5 value: 35.744 - type: precision_at_1 value: 29.566 - type: precision_at_10 value: 7.385999999999999 - type: precision_at_100 value: 1.204 - type: precision_at_1000 value: 0.158 - type: precision_at_3 value: 16.286 - type: precision_at_5 value: 11.484 - type: recall_at_1 value: 24.117 - type: recall_at_10 value: 51.559999999999995 - type: recall_at_100 value: 77.104 - type: recall_at_1000 value: 91.79899999999999 - type: recall_at_3 value: 36.82 - type: recall_at_5 value: 41.453 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 25.17625 - type: map_at_10 value: 34.063916666666664 - type: map_at_100 value: 35.255500000000005 - type: map_at_1000 value: 35.37275 - type: map_at_3 value: 31.351666666666667 - type: map_at_5 value: 32.80608333333333 - type: mrr_at_1 value: 29.59783333333333 - type: mrr_at_10 value: 38.0925 - type: mrr_at_100 value: 38.957249999999995 - type: mrr_at_1000 value: 39.01608333333333 - type: mrr_at_3 value: 35.77625 - type: mrr_at_5 value: 37.04991666666667 - type: ndcg_at_1 value: 29.59783333333333 - type: ndcg_at_10 value: 39.343666666666664 - type: ndcg_at_100 value: 44.488249999999994 - type: ndcg_at_1000 value: 46.83358333333334 - type: ndcg_at_3 value: 34.69708333333333 - type: ndcg_at_5 value: 36.75075 - type: precision_at_1 value: 29.59783333333333 - type: precision_at_10 value: 6.884083333333332 - type: precision_at_100 value: 1.114 - type: precision_at_1000 value: 0.15108333333333332 - type: precision_at_3 value: 15.965250000000003 - type: precision_at_5 value: 11.246500000000001 - type: recall_at_1 value: 25.17625 - type: recall_at_10 value: 51.015999999999984 - type: recall_at_100 value: 73.60174999999998 - type: recall_at_1000 value: 89.849 - type: recall_at_3 value: 37.88399999999999 - type: recall_at_5 value: 43.24541666666666 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackStatsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 24.537 - type: map_at_10 value: 31.081999999999997 - type: map_at_100 value: 32.042 - type: map_at_1000 value: 32.141 - type: map_at_3 value: 29.137 - type: map_at_5 value: 30.079 - type: mrr_at_1 value: 27.454 - type: mrr_at_10 value: 33.694 - type: mrr_at_100 value: 34.579 - type: mrr_at_1000 value: 34.649 - type: mrr_at_3 value: 32.004 - type: mrr_at_5 value: 32.794000000000004 - type: ndcg_at_1 value: 27.454 - type: ndcg_at_10 value: 34.915 - type: ndcg_at_100 value: 39.641 - type: ndcg_at_1000 value: 42.105 - type: ndcg_at_3 value: 31.276 - type: ndcg_at_5 value: 32.65 - type: precision_at_1 value: 27.454 - type: precision_at_10 value: 5.337 - type: precision_at_100 value: 0.8250000000000001 - type: precision_at_1000 value: 0.11199999999999999 - type: precision_at_3 value: 13.241 - type: precision_at_5 value: 8.895999999999999 - type: recall_at_1 value: 24.537 - type: recall_at_10 value: 44.324999999999996 - type: recall_at_100 value: 65.949 - type: recall_at_1000 value: 84.017 - type: recall_at_3 value: 33.857 - type: recall_at_5 value: 37.316 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackTexRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 17.122 - type: map_at_10 value: 24.32 - type: map_at_100 value: 25.338 - type: map_at_1000 value: 25.462 - type: map_at_3 value: 22.064 - type: map_at_5 value: 23.322000000000003 - type: mrr_at_1 value: 20.647 - type: mrr_at_10 value: 27.858 - type: mrr_at_100 value: 28.743999999999996 - type: mrr_at_1000 value: 28.819 - type: mrr_at_3 value: 25.769 - type: mrr_at_5 value: 26.964 - type: ndcg_at_1 value: 20.647 - type: ndcg_at_10 value: 28.849999999999998 - type: ndcg_at_100 value: 33.849000000000004 - type: ndcg_at_1000 value: 36.802 - type: ndcg_at_3 value: 24.799 - type: ndcg_at_5 value: 26.682 - type: precision_at_1 value: 20.647 - type: precision_at_10 value: 5.2170000000000005 - type: precision_at_100 value: 0.906 - type: precision_at_1000 value: 0.134 - type: precision_at_3 value: 11.769 - type: precision_at_5 value: 8.486 - type: recall_at_1 value: 17.122 - type: recall_at_10 value: 38.999 - type: recall_at_100 value: 61.467000000000006 - type: recall_at_1000 value: 82.716 - type: recall_at_3 value: 27.601 - type: recall_at_5 value: 32.471 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackUnixRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 24.396 - type: map_at_10 value: 33.415 - type: map_at_100 value: 34.521 - type: map_at_1000 value: 34.631 - type: map_at_3 value: 30.703999999999997 - type: map_at_5 value: 32.166 - type: mrr_at_1 value: 28.825 - type: mrr_at_10 value: 37.397000000000006 - type: mrr_at_100 value: 38.286 - type: mrr_at_1000 value: 38.346000000000004 - type: mrr_at_3 value: 35.028 - type: mrr_at_5 value: 36.32 - type: ndcg_at_1 value: 28.825 - type: ndcg_at_10 value: 38.656 - type: ndcg_at_100 value: 43.856 - type: ndcg_at_1000 value: 46.31 - type: ndcg_at_3 value: 33.793 - type: ndcg_at_5 value: 35.909 - type: precision_at_1 value: 28.825 - type: precision_at_10 value: 6.567 - type: precision_at_100 value: 1.0330000000000001 - type: precision_at_1000 value: 0.135 - type: precision_at_3 value: 15.516 - type: precision_at_5 value: 10.914 - type: recall_at_1 value: 24.396 - type: recall_at_10 value: 50.747 - type: recall_at_100 value: 73.477 - type: recall_at_1000 value: 90.801 - type: recall_at_3 value: 37.1 - type: recall_at_5 value: 42.589 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWebmastersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 25.072 - type: map_at_10 value: 34.307 - type: map_at_100 value: 35.725 - type: map_at_1000 value: 35.943999999999996 - type: map_at_3 value: 30.906 - type: map_at_5 value: 32.818000000000005 - type: mrr_at_1 value: 29.644 - type: mrr_at_10 value: 38.673 - type: mrr_at_100 value: 39.459 - type: mrr_at_1000 value: 39.527 - type: mrr_at_3 value: 35.771 - type: mrr_at_5 value: 37.332 - type: ndcg_at_1 value: 29.644 - type: ndcg_at_10 value: 40.548 - type: ndcg_at_100 value: 45.678999999999995 - type: ndcg_at_1000 value: 48.488 - type: ndcg_at_3 value: 34.887 - type: ndcg_at_5 value: 37.543 - type: precision_at_1 value: 29.644 - type: precision_at_10 value: 7.688000000000001 - type: precision_at_100 value: 1.482 - type: precision_at_1000 value: 0.23600000000000002 - type: precision_at_3 value: 16.206 - type: precision_at_5 value: 12.016 - type: recall_at_1 value: 25.072 - type: recall_at_10 value: 53.478 - type: recall_at_100 value: 76.07300000000001 - type: recall_at_1000 value: 93.884 - type: recall_at_3 value: 37.583 - type: recall_at_5 value: 44.464 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWordpressRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 20.712 - type: map_at_10 value: 27.467999999999996 - type: map_at_100 value: 28.502 - type: map_at_1000 value: 28.610000000000003 - type: map_at_3 value: 24.887999999999998 - type: map_at_5 value: 26.273999999999997 - type: mrr_at_1 value: 22.736 - type: mrr_at_10 value: 29.553 - type: mrr_at_100 value: 30.485 - type: mrr_at_1000 value: 30.56 - type: mrr_at_3 value: 27.078999999999997 - type: mrr_at_5 value: 28.401 - type: ndcg_at_1 value: 22.736 - type: ndcg_at_10 value: 32.023 - type: ndcg_at_100 value: 37.158 - type: ndcg_at_1000 value: 39.823 - type: ndcg_at_3 value: 26.951999999999998 - type: ndcg_at_5 value: 29.281000000000002 - type: precision_at_1 value: 22.736 - type: precision_at_10 value: 5.213 - type: precision_at_100 value: 0.832 - type: precision_at_1000 value: 0.116 - type: precision_at_3 value: 11.459999999999999 - type: precision_at_5 value: 8.244 - type: recall_at_1 value: 20.712 - type: recall_at_10 value: 44.057 - type: recall_at_100 value: 67.944 - type: recall_at_1000 value: 87.925 - type: recall_at_3 value: 30.305 - type: recall_at_5 value: 36.071999999999996 - task: type: Retrieval dataset: type: climate-fever name: MTEB ClimateFEVER config: default split: test revision: None metrics: - type: map_at_1 value: 10.181999999999999 - type: map_at_10 value: 16.66 - type: map_at_100 value: 18.273 - type: map_at_1000 value: 18.45 - type: map_at_3 value: 14.141 - type: map_at_5 value: 15.455 - type: mrr_at_1 value: 22.15 - type: mrr_at_10 value: 32.062000000000005 - type: mrr_at_100 value: 33.116 - type: mrr_at_1000 value: 33.168 - type: mrr_at_3 value: 28.827 - type: mrr_at_5 value: 30.892999999999997 - type: ndcg_at_1 value: 22.15 - type: ndcg_at_10 value: 23.532 - type: ndcg_at_100 value: 30.358 - type: ndcg_at_1000 value: 33.783 - type: ndcg_at_3 value: 19.222 - type: ndcg_at_5 value: 20.919999999999998 - type: precision_at_1 value: 22.15 - type: precision_at_10 value: 7.185999999999999 - type: precision_at_100 value: 1.433 - type: precision_at_1000 value: 0.207 - type: precision_at_3 value: 13.941 - type: precision_at_5 value: 10.906 - type: recall_at_1 value: 10.181999999999999 - type: recall_at_10 value: 28.104000000000003 - type: recall_at_100 value: 51.998999999999995 - type: recall_at_1000 value: 71.311 - type: recall_at_3 value: 17.698 - type: recall_at_5 value: 22.262999999999998 - task: type: Retrieval dataset: type: dbpedia-entity name: MTEB DBPedia config: default split: test revision: None metrics: - type: map_at_1 value: 6.669 - type: map_at_10 value: 15.552 - type: map_at_100 value: 21.865000000000002 - type: map_at_1000 value: 23.268 - type: map_at_3 value: 11.309 - type: map_at_5 value: 13.084000000000001 - type: mrr_at_1 value: 55.50000000000001 - type: mrr_at_10 value: 66.46600000000001 - type: mrr_at_100 value: 66.944 - type: mrr_at_1000 value: 66.956 - type: mrr_at_3 value: 64.542 - type: mrr_at_5 value: 65.717 - type: ndcg_at_1 value: 44.75 - type: ndcg_at_10 value: 35.049 - type: ndcg_at_100 value: 39.073 - type: ndcg_at_1000 value: 46.208 - type: ndcg_at_3 value: 39.525 - type: ndcg_at_5 value: 37.156 - type: precision_at_1 value: 55.50000000000001 - type: precision_at_10 value: 27.800000000000004 - type: precision_at_100 value: 9.013 - type: precision_at_1000 value: 1.8800000000000001 - type: precision_at_3 value: 42.667 - type: precision_at_5 value: 36.0 - type: recall_at_1 value: 6.669 - type: recall_at_10 value: 21.811 - type: recall_at_100 value: 45.112 - type: recall_at_1000 value: 67.806 - type: recall_at_3 value: 13.373 - type: recall_at_5 value: 16.615 - task: type: Classification dataset: type: mteb/emotion name: MTEB EmotionClassification config: default split: test revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 metrics: - type: accuracy value: 48.769999999999996 - type: f1 value: 42.91448356376592 - task: type: Retrieval dataset: type: fever name: MTEB FEVER config: default split: test revision: None metrics: - type: map_at_1 value: 54.013 - type: map_at_10 value: 66.239 - type: map_at_100 value: 66.62599999999999 - type: map_at_1000 value: 66.644 - type: map_at_3 value: 63.965 - type: map_at_5 value: 65.45400000000001 - type: mrr_at_1 value: 58.221000000000004 - type: mrr_at_10 value: 70.43700000000001 - type: mrr_at_100 value: 70.744 - type: mrr_at_1000 value: 70.75099999999999 - type: mrr_at_3 value: 68.284 - type: mrr_at_5 value: 69.721 - type: ndcg_at_1 value: 58.221000000000004 - type: ndcg_at_10 value: 72.327 - type: ndcg_at_100 value: 73.953 - type: ndcg_at_1000 value: 74.312 - type: ndcg_at_3 value: 68.062 - type: ndcg_at_5 value: 70.56400000000001 - type: precision_at_1 value: 58.221000000000004 - type: precision_at_10 value: 9.521 - type: precision_at_100 value: 1.045 - type: precision_at_1000 value: 0.109 - type: precision_at_3 value: 27.348 - type: precision_at_5 value: 17.794999999999998 - type: recall_at_1 value: 54.013 - type: recall_at_10 value: 86.957 - type: recall_at_100 value: 93.911 - type: recall_at_1000 value: 96.38 - type: recall_at_3 value: 75.555 - type: recall_at_5 value: 81.671 - task: type: Retrieval dataset: type: fiqa name: MTEB FiQA2018 config: default split: test revision: None metrics: - type: map_at_1 value: 21.254 - type: map_at_10 value: 33.723 - type: map_at_100 value: 35.574 - type: map_at_1000 value: 35.730000000000004 - type: map_at_3 value: 29.473 - type: map_at_5 value: 31.543 - type: mrr_at_1 value: 41.358 - type: mrr_at_10 value: 49.498 - type: mrr_at_100 value: 50.275999999999996 - type: mrr_at_1000 value: 50.308 - type: mrr_at_3 value: 47.016000000000005 - type: mrr_at_5 value: 48.336 - type: ndcg_at_1 value: 41.358 - type: ndcg_at_10 value: 41.579 - type: ndcg_at_100 value: 48.455 - type: ndcg_at_1000 value: 51.165000000000006 - type: ndcg_at_3 value: 37.681 - type: ndcg_at_5 value: 38.49 - type: precision_at_1 value: 41.358 - type: precision_at_10 value: 11.543000000000001 - type: precision_at_100 value: 1.87 - type: precision_at_1000 value: 0.23600000000000002 - type: precision_at_3 value: 24.743000000000002 - type: precision_at_5 value: 17.994 - type: recall_at_1 value: 21.254 - type: recall_at_10 value: 48.698 - type: recall_at_100 value: 74.588 - type: recall_at_1000 value: 91.00200000000001 - type: recall_at_3 value: 33.939 - type: recall_at_5 value: 39.367000000000004 - task: type: Retrieval dataset: type: hotpotqa name: MTEB HotpotQA config: default split: test revision: None metrics: - type: map_at_1 value: 35.922 - type: map_at_10 value: 52.32599999999999 - type: map_at_100 value: 53.18000000000001 - type: map_at_1000 value: 53.245 - type: map_at_3 value: 49.294 - type: map_at_5 value: 51.202999999999996 - type: mrr_at_1 value: 71.843 - type: mrr_at_10 value: 78.24600000000001 - type: mrr_at_100 value: 78.515 - type: mrr_at_1000 value: 78.527 - type: mrr_at_3 value: 77.17500000000001 - type: mrr_at_5 value: 77.852 - type: ndcg_at_1 value: 71.843 - type: ndcg_at_10 value: 61.379 - type: ndcg_at_100 value: 64.535 - type: ndcg_at_1000 value: 65.888 - type: ndcg_at_3 value: 56.958 - type: ndcg_at_5 value: 59.434 - type: precision_at_1 value: 71.843 - type: precision_at_10 value: 12.686 - type: precision_at_100 value: 1.517 - type: precision_at_1000 value: 0.16999999999999998 - type: precision_at_3 value: 35.778 - type: precision_at_5 value: 23.422 - type: recall_at_1 value: 35.922 - type: recall_at_10 value: 63.43 - type: recall_at_100 value: 75.868 - type: recall_at_1000 value: 84.88900000000001 - type: recall_at_3 value: 53.666000000000004 - type: recall_at_5 value: 58.555 - task: type: Classification dataset: type: mteb/imdb name: MTEB ImdbClassification config: default split: test revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 metrics: - type: accuracy value: 79.4408 - type: ap value: 73.52820871620366 - type: f1 value: 79.36240238685001 - task: type: Retrieval dataset: type: msmarco name: MTEB MSMARCO config: default split: dev revision: None metrics: - type: map_at_1 value: 21.826999999999998 - type: map_at_10 value: 34.04 - type: map_at_100 value: 35.226 - type: map_at_1000 value: 35.275 - type: map_at_3 value: 30.165999999999997 - type: map_at_5 value: 32.318000000000005 - type: mrr_at_1 value: 22.464000000000002 - type: mrr_at_10 value: 34.631 - type: mrr_at_100 value: 35.752 - type: mrr_at_1000 value: 35.795 - type: mrr_at_3 value: 30.798 - type: mrr_at_5 value: 32.946999999999996 - type: ndcg_at_1 value: 22.464000000000002 - type: ndcg_at_10 value: 40.919 - type: ndcg_at_100 value: 46.632 - type: ndcg_at_1000 value: 47.833 - type: ndcg_at_3 value: 32.992 - type: ndcg_at_5 value: 36.834 - type: precision_at_1 value: 22.464000000000002 - type: precision_at_10 value: 6.494 - type: precision_at_100 value: 0.9369999999999999 - type: precision_at_1000 value: 0.104 - type: precision_at_3 value: 14.021 - type: precision_at_5 value: 10.347000000000001 - type: recall_at_1 value: 21.826999999999998 - type: recall_at_10 value: 62.132 - type: recall_at_100 value: 88.55199999999999 - type: recall_at_1000 value: 97.707 - type: recall_at_3 value: 40.541 - type: recall_at_5 value: 49.739 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (en) config: en split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 95.68399452804377 - type: f1 value: 95.25490609832268 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (en) config: en split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 83.15321477428182 - type: f1 value: 60.35476439087966 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (en) config: en split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 71.92669804976462 - type: f1 value: 69.22815107207565 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (en) config: en split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.4855413584398 - type: f1 value: 72.92107516103387 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-p2p name: MTEB MedrxivClusteringP2P config: default split: test revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 metrics: - type: v_measure value: 32.412679360205544 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-s2s name: MTEB MedrxivClusteringS2S config: default split: test revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 metrics: - type: v_measure value: 28.09211869875204 - task: type: Reranking dataset: type: mteb/mind_small name: MTEB MindSmallReranking config: default split: test revision: 3bdac13927fdc888b903db93b2ffdbd90b295a69 metrics: - type: map value: 30.540919056982545 - type: mrr value: 31.529904607063536 - task: type: Retrieval dataset: type: nfcorpus name: MTEB NFCorpus config: default split: test revision: None metrics: - type: map_at_1 value: 5.745 - type: map_at_10 value: 12.013 - type: map_at_100 value: 15.040000000000001 - type: map_at_1000 value: 16.427 - type: map_at_3 value: 8.841000000000001 - type: map_at_5 value: 10.289 - type: mrr_at_1 value: 45.201 - type: mrr_at_10 value: 53.483999999999995 - type: mrr_at_100 value: 54.20700000000001 - type: mrr_at_1000 value: 54.252 - type: mrr_at_3 value: 51.29 - type: mrr_at_5 value: 52.73 - type: ndcg_at_1 value: 43.808 - type: ndcg_at_10 value: 32.445 - type: ndcg_at_100 value: 30.031000000000002 - type: ndcg_at_1000 value: 39.007 - type: ndcg_at_3 value: 37.204 - type: ndcg_at_5 value: 35.07 - type: precision_at_1 value: 45.201 - type: precision_at_10 value: 23.684 - type: precision_at_100 value: 7.600999999999999 - type: precision_at_1000 value: 2.043 - type: precision_at_3 value: 33.953 - type: precision_at_5 value: 29.412 - type: recall_at_1 value: 5.745 - type: recall_at_10 value: 16.168 - type: recall_at_100 value: 30.875999999999998 - type: recall_at_1000 value: 62.686 - type: recall_at_3 value: 9.75 - type: recall_at_5 value: 12.413 - task: type: Retrieval dataset: type: nq name: MTEB NQ config: default split: test revision: None metrics: - type: map_at_1 value: 37.828 - type: map_at_10 value: 53.239000000000004 - type: map_at_100 value: 54.035999999999994 - type: map_at_1000 value: 54.067 - type: map_at_3 value: 49.289 - type: map_at_5 value: 51.784 - type: mrr_at_1 value: 42.497 - type: mrr_at_10 value: 55.916999999999994 - type: mrr_at_100 value: 56.495 - type: mrr_at_1000 value: 56.516999999999996 - type: mrr_at_3 value: 52.800000000000004 - type: mrr_at_5 value: 54.722 - type: ndcg_at_1 value: 42.468 - type: ndcg_at_10 value: 60.437 - type: ndcg_at_100 value: 63.731 - type: ndcg_at_1000 value: 64.41799999999999 - type: ndcg_at_3 value: 53.230999999999995 - type: ndcg_at_5 value: 57.26 - type: precision_at_1 value: 42.468 - type: precision_at_10 value: 9.47 - type: precision_at_100 value: 1.1360000000000001 - type: precision_at_1000 value: 0.12 - type: precision_at_3 value: 23.724999999999998 - type: precision_at_5 value: 16.593 - type: recall_at_1 value: 37.828 - type: recall_at_10 value: 79.538 - type: recall_at_100 value: 93.646 - type: recall_at_1000 value: 98.72999999999999 - type: recall_at_3 value: 61.134 - type: recall_at_5 value: 70.377 - task: type: Retrieval dataset: type: quora name: MTEB QuoraRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 70.548 - type: map_at_10 value: 84.466 - type: map_at_100 value: 85.10600000000001 - type: map_at_1000 value: 85.123 - type: map_at_3 value: 81.57600000000001 - type: map_at_5 value: 83.399 - type: mrr_at_1 value: 81.24 - type: mrr_at_10 value: 87.457 - type: mrr_at_100 value: 87.574 - type: mrr_at_1000 value: 87.575 - type: mrr_at_3 value: 86.507 - type: mrr_at_5 value: 87.205 - type: ndcg_at_1 value: 81.25 - type: ndcg_at_10 value: 88.203 - type: ndcg_at_100 value: 89.457 - type: ndcg_at_1000 value: 89.563 - type: ndcg_at_3 value: 85.465 - type: ndcg_at_5 value: 87.007 - type: precision_at_1 value: 81.25 - type: precision_at_10 value: 13.373 - type: precision_at_100 value: 1.5270000000000001 - type: precision_at_1000 value: 0.157 - type: precision_at_3 value: 37.417 - type: precision_at_5 value: 24.556 - type: recall_at_1 value: 70.548 - type: recall_at_10 value: 95.208 - type: recall_at_100 value: 99.514 - type: recall_at_1000 value: 99.988 - type: recall_at_3 value: 87.214 - type: recall_at_5 value: 91.696 - task: type: Clustering dataset: type: mteb/reddit-clustering name: MTEB RedditClustering config: default split: test revision: 24640382cdbf8abc73003fb0fa6d111a705499eb metrics: - type: v_measure value: 53.04822095496839 - task: type: Clustering dataset: type: mteb/reddit-clustering-p2p name: MTEB RedditClusteringP2P config: default split: test revision: 282350215ef01743dc01b456c7f5241fa8937f16 metrics: - type: v_measure value: 60.30778476474675 - task: type: Retrieval dataset: type: scidocs name: MTEB SCIDOCS config: default split: test revision: None metrics: - type: map_at_1 value: 4.692 - type: map_at_10 value: 11.766 - type: map_at_100 value: 13.904 - type: map_at_1000 value: 14.216999999999999 - type: map_at_3 value: 8.245 - type: map_at_5 value: 9.92 - type: mrr_at_1 value: 23.0 - type: mrr_at_10 value: 33.78 - type: mrr_at_100 value: 34.922 - type: mrr_at_1000 value: 34.973 - type: mrr_at_3 value: 30.2 - type: mrr_at_5 value: 32.565 - type: ndcg_at_1 value: 23.0 - type: ndcg_at_10 value: 19.863 - type: ndcg_at_100 value: 28.141 - type: ndcg_at_1000 value: 33.549 - type: ndcg_at_3 value: 18.434 - type: ndcg_at_5 value: 16.384 - type: precision_at_1 value: 23.0 - type: precision_at_10 value: 10.39 - type: precision_at_100 value: 2.235 - type: precision_at_1000 value: 0.35300000000000004 - type: precision_at_3 value: 17.133000000000003 - type: precision_at_5 value: 14.44 - type: recall_at_1 value: 4.692 - type: recall_at_10 value: 21.025 - type: recall_at_100 value: 45.324999999999996 - type: recall_at_1000 value: 71.675 - type: recall_at_3 value: 10.440000000000001 - type: recall_at_5 value: 14.64 - task: type: STS dataset: type: mteb/sickr-sts name: MTEB SICK-R config: default split: test revision: a6ea5a8cab320b040a23452cc28066d9beae2cee metrics: - type: cos_sim_pearson value: 84.96178184892842 - type: cos_sim_spearman value: 79.6487740813199 - type: euclidean_pearson value: 82.06661161625023 - type: euclidean_spearman value: 79.64876769031183 - type: manhattan_pearson value: 82.07061164575131 - type: manhattan_spearman value: 79.65197039464537 - task: type: STS dataset: type: mteb/sts12-sts name: MTEB STS12 config: default split: test revision: a0d554a64d88156834ff5ae9920b964011b16384 metrics: - type: cos_sim_pearson value: 84.15305604100027 - type: cos_sim_spearman value: 74.27447427941591 - type: euclidean_pearson value: 80.52737337565307 - type: euclidean_spearman value: 74.27416077132192 - type: manhattan_pearson value: 80.53728571140387 - type: manhattan_spearman value: 74.28853605753457 - task: type: STS dataset: type: mteb/sts13-sts name: MTEB STS13 config: default split: test revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca metrics: - type: cos_sim_pearson value: 83.44386080639279 - type: cos_sim_spearman value: 84.17947648159536 - type: euclidean_pearson value: 83.34145388129387 - type: euclidean_spearman value: 84.17947648159536 - type: manhattan_pearson value: 83.30699061927966 - type: manhattan_spearman value: 84.18125737380451 - task: type: STS dataset: type: mteb/sts14-sts name: MTEB STS14 config: default split: test revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 metrics: - type: cos_sim_pearson value: 81.57392220985612 - type: cos_sim_spearman value: 78.80745014464101 - type: euclidean_pearson value: 80.01660371487199 - type: euclidean_spearman value: 78.80741240102256 - type: manhattan_pearson value: 79.96810779507953 - type: manhattan_spearman value: 78.75600400119448 - task: type: STS dataset: type: mteb/sts15-sts name: MTEB STS15 config: default split: test revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 metrics: - type: cos_sim_pearson value: 86.85421063026625 - type: cos_sim_spearman value: 87.55320285299192 - type: euclidean_pearson value: 86.69750143323517 - type: euclidean_spearman value: 87.55320284326378 - type: manhattan_pearson value: 86.63379169960379 - type: manhattan_spearman value: 87.4815029877984 - task: type: STS dataset: type: mteb/sts16-sts name: MTEB STS16 config: default split: test revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 metrics: - type: cos_sim_pearson value: 84.31314130411842 - type: cos_sim_spearman value: 85.3489588181433 - type: euclidean_pearson value: 84.13240933463535 - type: euclidean_spearman value: 85.34902871403281 - type: manhattan_pearson value: 84.01183086503559 - type: manhattan_spearman value: 85.19316703166102 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-en) config: en-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 89.09979781689536 - type: cos_sim_spearman value: 88.87813323759015 - type: euclidean_pearson value: 88.65413031123792 - type: euclidean_spearman value: 88.87813323759015 - type: manhattan_pearson value: 88.61818758256024 - type: manhattan_spearman value: 88.81044100494604 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (en) config: en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 62.30693258111531 - type: cos_sim_spearman value: 62.195516523251946 - type: euclidean_pearson value: 62.951283701049476 - type: euclidean_spearman value: 62.195516523251946 - type: manhattan_pearson value: 63.068322281439535 - type: manhattan_spearman value: 62.10621171028406 - task: type: STS dataset: type: mteb/stsbenchmark-sts name: MTEB STSBenchmark config: default split: test revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 metrics: - type: cos_sim_pearson value: 84.27092833763909 - type: cos_sim_spearman value: 84.84429717949759 - type: euclidean_pearson value: 84.8516966060792 - type: euclidean_spearman value: 84.84429717949759 - type: manhattan_pearson value: 84.82203139242881 - type: manhattan_spearman value: 84.8358503952945 - task: type: Reranking dataset: type: mteb/scidocs-reranking name: MTEB SciDocsRR config: default split: test revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab metrics: - type: map value: 83.10290863981409 - type: mrr value: 95.31168450286097 - task: type: Retrieval dataset: type: scifact name: MTEB SciFact config: default split: test revision: None metrics: - type: map_at_1 value: 52.161 - type: map_at_10 value: 62.138000000000005 - type: map_at_100 value: 62.769 - type: map_at_1000 value: 62.812 - type: map_at_3 value: 59.111000000000004 - type: map_at_5 value: 60.995999999999995 - type: mrr_at_1 value: 55.333 - type: mrr_at_10 value: 63.504000000000005 - type: mrr_at_100 value: 64.036 - type: mrr_at_1000 value: 64.08 - type: mrr_at_3 value: 61.278 - type: mrr_at_5 value: 62.778 - type: ndcg_at_1 value: 55.333 - type: ndcg_at_10 value: 66.678 - type: ndcg_at_100 value: 69.415 - type: ndcg_at_1000 value: 70.453 - type: ndcg_at_3 value: 61.755 - type: ndcg_at_5 value: 64.546 - type: precision_at_1 value: 55.333 - type: precision_at_10 value: 9.033 - type: precision_at_100 value: 1.043 - type: precision_at_1000 value: 0.11199999999999999 - type: precision_at_3 value: 24.221999999999998 - type: precision_at_5 value: 16.333000000000002 - type: recall_at_1 value: 52.161 - type: recall_at_10 value: 79.156 - type: recall_at_100 value: 91.333 - type: recall_at_1000 value: 99.333 - type: recall_at_3 value: 66.43299999999999 - type: recall_at_5 value: 73.272 - task: type: PairClassification dataset: type: mteb/sprintduplicatequestions-pairclassification name: MTEB SprintDuplicateQuestions config: default split: test revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 metrics: - type: cos_sim_accuracy value: 99.81287128712871 - type: cos_sim_ap value: 95.30034785910676 - type: cos_sim_f1 value: 90.28629856850716 - type: cos_sim_precision value: 92.36401673640168 - type: cos_sim_recall value: 88.3 - type: dot_accuracy value: 99.81287128712871 - type: dot_ap value: 95.30034785910676 - type: dot_f1 value: 90.28629856850716 - type: dot_precision value: 92.36401673640168 - type: dot_recall value: 88.3 - type: euclidean_accuracy value: 99.81287128712871 - type: euclidean_ap value: 95.30034785910676 - type: euclidean_f1 value: 90.28629856850716 - type: euclidean_precision value: 92.36401673640168 - type: euclidean_recall value: 88.3 - type: manhattan_accuracy value: 99.80990099009901 - type: manhattan_ap value: 95.26880751950654 - type: manhattan_f1 value: 90.22177419354838 - type: manhattan_precision value: 90.95528455284553 - type: manhattan_recall value: 89.5 - type: max_accuracy value: 99.81287128712871 - type: max_ap value: 95.30034785910676 - type: max_f1 value: 90.28629856850716 - task: type: Clustering dataset: type: mteb/stackexchange-clustering name: MTEB StackExchangeClustering config: default split: test revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 metrics: - type: v_measure value: 58.518662504351184 - task: type: Clustering dataset: type: mteb/stackexchange-clustering-p2p name: MTEB StackExchangeClusteringP2P config: default split: test revision: 815ca46b2622cec33ccafc3735d572c266efdb44 metrics: - type: v_measure value: 34.96168178378587 - task: type: Reranking dataset: type: mteb/stackoverflowdupquestions-reranking name: MTEB StackOverflowDupQuestions config: default split: test revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 metrics: - type: map value: 52.04862593471896 - type: mrr value: 52.97238402936932 - task: type: Summarization dataset: type: mteb/summeval name: MTEB SummEval config: default split: test revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c metrics: - type: cos_sim_pearson value: 30.092545236479946 - type: cos_sim_spearman value: 31.599851000175498 - type: dot_pearson value: 30.092542723901676 - type: dot_spearman value: 31.599851000175498 - task: type: Retrieval dataset: type: trec-covid name: MTEB TRECCOVID config: default split: test revision: None metrics: - type: map_at_1 value: 0.189 - type: map_at_10 value: 1.662 - type: map_at_100 value: 9.384 - type: map_at_1000 value: 22.669 - type: map_at_3 value: 0.5559999999999999 - type: map_at_5 value: 0.9039999999999999 - type: mrr_at_1 value: 68.0 - type: mrr_at_10 value: 81.01899999999999 - type: mrr_at_100 value: 81.01899999999999 - type: mrr_at_1000 value: 81.01899999999999 - type: mrr_at_3 value: 79.333 - type: mrr_at_5 value: 80.733 - type: ndcg_at_1 value: 63.0 - type: ndcg_at_10 value: 65.913 - type: ndcg_at_100 value: 51.895 - type: ndcg_at_1000 value: 46.967 - type: ndcg_at_3 value: 65.49199999999999 - type: ndcg_at_5 value: 66.69699999999999 - type: precision_at_1 value: 68.0 - type: precision_at_10 value: 71.6 - type: precision_at_100 value: 53.66 - type: precision_at_1000 value: 21.124000000000002 - type: precision_at_3 value: 72.667 - type: precision_at_5 value: 74.0 - type: recall_at_1 value: 0.189 - type: recall_at_10 value: 1.913 - type: recall_at_100 value: 12.601999999999999 - type: recall_at_1000 value: 44.296 - type: recall_at_3 value: 0.605 - type: recall_at_5 value: 1.018 - task: type: Retrieval dataset: type: webis-touche2020 name: MTEB Touche2020 config: default split: test revision: None metrics: - type: map_at_1 value: 2.701 - type: map_at_10 value: 10.445 - type: map_at_100 value: 17.324 - type: map_at_1000 value: 19.161 - type: map_at_3 value: 5.497 - type: map_at_5 value: 7.278 - type: mrr_at_1 value: 30.612000000000002 - type: mrr_at_10 value: 45.534 - type: mrr_at_100 value: 45.792 - type: mrr_at_1000 value: 45.806999999999995 - type: mrr_at_3 value: 37.755 - type: mrr_at_5 value: 43.469 - type: ndcg_at_1 value: 26.531 - type: ndcg_at_10 value: 26.235000000000003 - type: ndcg_at_100 value: 39.17 - type: ndcg_at_1000 value: 51.038 - type: ndcg_at_3 value: 23.625 - type: ndcg_at_5 value: 24.338 - type: precision_at_1 value: 30.612000000000002 - type: precision_at_10 value: 24.285999999999998 - type: precision_at_100 value: 8.224 - type: precision_at_1000 value: 1.6179999999999999 - type: precision_at_3 value: 24.490000000000002 - type: precision_at_5 value: 24.898 - type: recall_at_1 value: 2.701 - type: recall_at_10 value: 17.997 - type: recall_at_100 value: 51.766999999999996 - type: recall_at_1000 value: 87.863 - type: recall_at_3 value: 6.295000000000001 - type: recall_at_5 value: 9.993 - task: type: Classification dataset: type: mteb/toxic_conversations_50k name: MTEB ToxicConversationsClassification config: default split: test revision: d7c0de2777da35d6aae2200a62c6e0e5af397c4c metrics: - type: accuracy value: 73.3474 - type: ap value: 15.393431414459924 - type: f1 value: 56.466681887882416 - task: type: Classification dataset: type: mteb/tweet_sentiment_extraction name: MTEB TweetSentimentExtractionClassification config: default split: test revision: d604517c81ca91fe16a244d1248fc021f9ecee7a metrics: - type: accuracy value: 62.062818336163 - type: f1 value: 62.11230840463252 - task: type: Clustering dataset: type: mteb/twentynewsgroups-clustering name: MTEB TwentyNewsgroupsClustering config: default split: test revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 metrics: - type: v_measure value: 42.464892820845115 - task: type: PairClassification dataset: type: mteb/twittersemeval2015-pairclassification name: MTEB TwitterSemEval2015 config: default split: test revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 metrics: - type: cos_sim_accuracy value: 86.15962329379508 - type: cos_sim_ap value: 74.73674057919256 - type: cos_sim_f1 value: 68.81245642574947 - type: cos_sim_precision value: 61.48255813953488 - type: cos_sim_recall value: 78.12664907651715 - type: dot_accuracy value: 86.15962329379508 - type: dot_ap value: 74.7367634988281 - type: dot_f1 value: 68.81245642574947 - type: dot_precision value: 61.48255813953488 - type: dot_recall value: 78.12664907651715 - type: euclidean_accuracy value: 86.15962329379508 - type: euclidean_ap value: 74.7367761466634 - type: euclidean_f1 value: 68.81245642574947 - type: euclidean_precision value: 61.48255813953488 - type: euclidean_recall value: 78.12664907651715 - type: manhattan_accuracy value: 86.21326816474935 - type: manhattan_ap value: 74.64416473733951 - type: manhattan_f1 value: 68.80924855491331 - type: manhattan_precision value: 61.23456790123457 - type: manhattan_recall value: 78.52242744063325 - type: max_accuracy value: 86.21326816474935 - type: max_ap value: 74.7367761466634 - type: max_f1 value: 68.81245642574947 - task: type: PairClassification dataset: type: mteb/twitterurlcorpus-pairclassification name: MTEB TwitterURLCorpus config: default split: test revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf metrics: - type: cos_sim_accuracy value: 88.97620988085536 - type: cos_sim_ap value: 86.08680845745758 - type: cos_sim_f1 value: 78.02793637114438 - type: cos_sim_precision value: 73.11082699683736 - type: cos_sim_recall value: 83.65414228518632 - type: dot_accuracy value: 88.97620988085536 - type: dot_ap value: 86.08681149437946 - type: dot_f1 value: 78.02793637114438 - type: dot_precision value: 73.11082699683736 - type: dot_recall value: 83.65414228518632 - type: euclidean_accuracy value: 88.97620988085536 - type: euclidean_ap value: 86.08681215460771 - type: euclidean_f1 value: 78.02793637114438 - type: euclidean_precision value: 73.11082699683736 - type: euclidean_recall value: 83.65414228518632 - type: manhattan_accuracy value: 88.88888888888889 - type: manhattan_ap value: 86.02916327562438 - type: manhattan_f1 value: 78.02063045516843 - type: manhattan_precision value: 73.38851947346994 - type: manhattan_recall value: 83.2768709578072 - type: max_accuracy value: 88.97620988085536 - type: max_ap value: 86.08681215460771 - type: max_f1 value: 78.02793637114438 --- <!-- TODO: add evaluation results here --> <br><br> <p align="center"> <img src="https://aeiljuispo.cloudimg.io/v7/https://cdn-uploads.huggingface.co/production/uploads/603763514de52ff951d89793/AFoybzd5lpBQXEBrQHuTt.png?w=200&h=200&f=face" alt="Finetuner logo: Finetuner helps you to create experiments in order to improve embeddings on search tasks. It accompanies you to deliver the last mile of performance-tuning for neural search applications." width="150px"> </p> <p align="center"> <b>The text embedding set trained by <a href="https://jina.ai/"><b>Jina AI</b></a>.</b> </p> ## Quick Start The easiest way to starting using `jina-embeddings-v2-base-en` is to use Jina AI's [Embedding API](https://jina.ai/embeddings/). ## Intended Usage & Model Info `jina-embeddings-v2-base-en` is an English, monolingual **embedding model** supporting **8192 sequence length**. It is based on a BERT architecture (JinaBERT) that supports the symmetric bidirectional variant of [ALiBi](https://arxiv.org/abs/2108.12409) to allow longer sequence length. The backbone `jina-bert-v2-base-en` is pretrained on the C4 dataset. The model is further trained on Jina AI's collection of more than 400 millions of sentence pairs and hard negatives. These pairs were obtained from various domains and were carefully selected through a thorough cleaning process. The embedding model was trained using 512 sequence length, but extrapolates to 8k sequence length (or even longer) thanks to ALiBi. This makes our model useful for a range of use cases, especially when processing long documents is needed, including long document retrieval, semantic textual similarity, text reranking, recommendation, RAG and LLM-based generative search, etc. With a standard size of 137 million parameters, the model enables fast inference while delivering better performance than our small model. It is recommended to use a single GPU for inference. Additionally, we provide the following embedding models: - [`jina-embeddings-v2-small-en`](https://huggingface.co/jinaai/jina-embeddings-v2-small-en): 33 million parameters. - [`jina-embeddings-v2-base-en`](https://huggingface.co/jinaai/jina-embeddings-v2-base-en): 137 million parameters **(you are here)**. - [`jina-embeddings-v2-base-zh`](https://huggingface.co/jinaai/jina-embeddings-v2-base-zh): Chinese-English Bilingual embeddings. - [`jina-embeddings-v2-base-de`](https://huggingface.co/jinaai/jina-embeddings-v2-base-de): German-English Bilingual embeddings. - [`jina-embeddings-v2-base-es`](https://huggingface.co/jinaai/jina-embeddings-v2-base-es): Spanish-English Bilingual embeddings. ## Data & Parameters Jina Embeddings V2 [technical report](https://arxiv.org/abs/2310.19923) ## Usage **<details><summary>Please apply mean pooling when integrating the model.</summary>** <p> ### Why mean pooling? `mean poooling` takes all token embeddings from model output and averaging them at sentence/paragraph level. It has been proved to be the most effective way to produce high-quality sentence embeddings. We offer an `encode` function to deal with this. However, if you would like to do it without using the default `encode` function: ```python import torch import torch.nn.functional as F from transformers import AutoTokenizer, AutoModel def mean_pooling(model_output, attention_mask): token_embeddings = model_output[0] input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) sentences = ['How is the weather today?', 'What is the current weather like today?'] tokenizer = AutoTokenizer.from_pretrained('jinaai/jina-embeddings-v2-small-en') model = AutoModel.from_pretrained('jinaai/jina-embeddings-v2-small-en', trust_remote_code=True) encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') with torch.no_grad(): model_output = model(**encoded_input) embeddings = mean_pooling(model_output, encoded_input['attention_mask']) embeddings = F.normalize(embeddings, p=2, dim=1) ``` </p> </details> You can use Jina Embedding models directly from transformers package. ```python !pip install transformers from transformers import AutoModel from numpy.linalg import norm cos_sim = lambda a,b: (a @ b.T) / (norm(a)*norm(b)) model = AutoModel.from_pretrained('jinaai/jina-embeddings-v2-base-en', trust_remote_code=True) # trust_remote_code is needed to use the encode method embeddings = model.encode(['How is the weather today?', 'What is the current weather like today?']) print(cos_sim(embeddings[0], embeddings[1])) ``` If you only want to handle shorter sequence, such as 2k, pass the `max_length` parameter to the `encode` function: ```python embeddings = model.encode( ['Very long ... document'], max_length=2048 ) ``` Using the its latest release (v2.3.0) sentence-transformers also supports Jina embeddings (Please make sure that you are logged into huggingface as well): ```python !pip install -U sentence-transformers from sentence_transformers import SentenceTransformer from sentence_transformers.util import cos_sim model = SentenceTransformer( "jinaai/jina-embeddings-v2-base-en", # switch to en/zh for English or Chinese trust_remote_code=True ) # control your input sequence length up to 8192 model.max_seq_length = 1024 embeddings = model.encode([ 'How is the weather today?', 'What is the current weather like today?' ]) print(cos_sim(embeddings[0], embeddings[1])) ``` ## Alternatives to Using Transformers (or SentencTransformers) Package 1. _Managed SaaS_: Get started with a free key on Jina AI's [Embedding API](https://jina.ai/embeddings/). 2. _Private and high-performance deployment_: Get started by picking from our suite of models and deploy them on [AWS Sagemaker](https://aws.amazon.com/marketplace/seller-profile?id=seller-stch2ludm6vgy). ## Use Jina Embeddings for RAG According to the latest blog post from [LLamaIndex](https://blog.llamaindex.ai/boosting-rag-picking-the-best-embedding-reranker-models-42d079022e83), > In summary, to achieve the peak performance in both hit rate and MRR, the combination of OpenAI or JinaAI-Base embeddings with the CohereRerank/bge-reranker-large reranker stands out. <img src="https://miro.medium.com/v2/resize:fit:4800/format:webp/1*ZP2RVejCZovF3FDCg-Bx3A.png" width="780px"> ## Plans 1. Bilingual embedding models supporting more European & Asian languages, including Spanish, French, Italian and Japanese. 2. Multimodal embedding models enable Multimodal RAG applications. 3. High-performt rerankers. ## Trouble Shooting **Loading of Model Code failed** If you forgot to pass the `trust_remote_code=True` flag when calling `AutoModel.from_pretrained` or initializing the model via the `SentenceTransformer` class, you will receive an error that the model weights could not be initialized. This is caused by tranformers falling back to creating a default BERT model, instead of a jina-embedding model: ```bash Some weights of the model checkpoint at jinaai/jina-embeddings-v2-base-en were not used when initializing BertModel: ['encoder.layer.2.mlp.layernorm.weight', 'encoder.layer.3.mlp.layernorm.weight', 'encoder.layer.10.mlp.wo.bias', 'encoder.layer.5.mlp.wo.bias', 'encoder.layer.2.mlp.layernorm.bias', 'encoder.layer.1.mlp.gated_layers.weight', 'encoder.layer.5.mlp.gated_layers.weight', 'encoder.layer.8.mlp.layernorm.bias', ... ``` **User is not logged into Huggingface** The model is only availabe under [gated access](https://huggingface.co/docs/hub/models-gated). This means you need to be logged into huggingface load load it. If you receive the following error, you need to provide an access token, either by using the huggingface-cli or providing the token via an environment variable as described above: ```bash OSError: jinaai/jina-embeddings-v2-base-en is not a local folder and is not a valid model identifier listed on 'https://huggingface.co/models' If this is a private repository, make sure to pass a token having permission to this repo with `use_auth_token` or log in with `huggingface-cli login` and pass `use_auth_token=True`. ``` ## Contact Join our [Discord community](https://discord.jina.ai) and chat with other community members about ideas. ## Citation If you find Jina Embeddings useful in your research, please cite the following paper: ``` @misc{günther2023jina, title={Jina Embeddings 2: 8192-Token General-Purpose Text Embeddings for Long Documents}, author={Michael Günther and Jackmin Ong and Isabelle Mohr and Alaeddine Abdessalem and Tanguy Abel and Mohammad Kalim Akram and Susana Guzman and Georgios Mastrapas and Saba Sturua and Bo Wang and Maximilian Werk and Nan Wang and Han Xiao}, year={2023}, eprint={2310.19923}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

microsoft/phi-2

microsoft

transformers

text-generation

--- license: mit license_link: https://huggingface.co/microsoft/phi-2/resolve/main/LICENSE language: - en pipeline_tag: text-generation tags: - nlp - code --- ## Model Summary Phi-2 is a Transformer with **2.7 billion** parameters. It was trained using the same data sources as [Phi-1.5](https://huggingface.co/microsoft/phi-1.5), augmented with a new data source that consists of various NLP synthetic texts and filtered websites (for safety and educational value). When assessed against benchmarks testing common sense, language understanding, and logical reasoning, Phi-2 showcased a nearly state-of-the-art performance among models with less than 13 billion parameters. Our model hasn't been fine-tuned through reinforcement learning from human feedback. The intention behind crafting this open-source model is to provide the research community with a non-restricted small model to explore vital safety challenges, such as reducing toxicity, understanding societal biases, enhancing controllability, and more. ## How to Use Phi-2 has been integrated in the development version (4.37.0.dev) of `transformers`. Until the official version is released through `pip`, ensure that you are doing one of the following: * When loading the model, ensure that `trust_remote_code=True` is passed as an argument of the `from_pretrained()` function. * Update your local `transformers` to the development version: `pip uninstall -y transformers && pip install git+https://github.com/huggingface/transformers`. The previous command is an alternative to cloning and installing from the source. The current `transformers` version can be verified with: `pip list | grep transformers`. ## Intended Uses Given the nature of the training data, the Phi-2 model is best suited for prompts using the QA format, the chat format, and the code format. ### QA Format: You can provide the prompt as a standalone question as follows: ```markdown Write a detailed analogy between mathematics and a lighthouse. ``` where the model generates the text after "." . To encourage the model to write more concise answers, you can also try the following QA format using "Instruct: \<prompt\>\nOutput:" ```markdown Instruct: Write a detailed analogy between mathematics and a lighthouse. Output: Mathematics is like a lighthouse. Just as a lighthouse guides ships safely to shore, mathematics provides a guiding light in the world of numbers and logic. It helps us navigate through complex problems and find solutions. Just as a lighthouse emits a steady beam of light, mathematics provides a consistent framework for reasoning and problem-solving. It illuminates the path to understanding and helps us make sense of the world around us. ``` where the model generates the text after "Output:". ### Chat Format: ```markdown Alice: I don't know why, I'm struggling to maintain focus while studying. Any suggestions? Bob: Well, have you tried creating a study schedule and sticking to it? Alice: Yes, I have, but it doesn't seem to help much. Bob: Hmm, maybe you should try studying in a quiet environment, like the library. Alice: ... ``` where the model generates the text after the first "Bob:". ### Code Format: ```python def print_prime(n): """ Print all primes between 1 and n """ primes = [] for num in range(2, n+1): is_prime = True for i in range(2, int(math.sqrt(num))+1): if num % i == 0: is_prime = False break if is_prime: primes.append(num) print(primes) ``` where the model generates the text after the comments. **Notes:** * Phi-2 is intended for QA, chat, and code purposes. The model-generated text/code should be treated as a starting point rather than a definitive solution for potential use cases. Users should be cautious when employing these models in their applications. * Direct adoption for production tasks without evaluation is out of scope of this project. As a result, the Phi-2 model has not been tested to ensure that it performs adequately for any production-level application. Please refer to the limitation sections of this document for more details. * If you are using `transformers<4.37.0`, always load the model with `trust_remote_code=True` to prevent side-effects. ## Sample Code ```python import torch from transformers import AutoModelForCausalLM, AutoTokenizer torch.set_default_device("cuda") model = AutoModelForCausalLM.from_pretrained("microsoft/phi-2", torch_dtype="auto", trust_remote_code=True) tokenizer = AutoTokenizer.from_pretrained("microsoft/phi-2", trust_remote_code=True) inputs = tokenizer('''def print_prime(n): """ Print all primes between 1 and n """''', return_tensors="pt", return_attention_mask=False) outputs = model.generate(**inputs, max_length=200) text = tokenizer.batch_decode(outputs)[0] print(text) ``` ## Limitations of Phi-2 * Generate Inaccurate Code and Facts: The model may produce incorrect code snippets and statements. Users should treat these outputs as suggestions or starting points, not as definitive or accurate solutions. * Limited Scope for code: Majority of Phi-2 training data is based in Python and use common packages such as "typing, math, random, collections, datetime, itertools". If the model generates Python scripts that utilize other packages or scripts in other languages, we strongly recommend users manually verify all API uses. * Unreliable Responses to Instruction: The model has not undergone instruction fine-tuning. As a result, it may struggle or fail to adhere to intricate or nuanced instructions provided by users. * Language Limitations: The model is primarily designed to understand standard English. Informal English, slang, or any other languages might pose challenges to its comprehension, leading to potential misinterpretations or errors in response. * Potential Societal Biases: Phi-2 is not entirely free from societal biases despite efforts in assuring training data safety. There's a possibility it may generate content that mirrors these societal biases, particularly if prompted or instructed to do so. We urge users to be aware of this and to exercise caution and critical thinking when interpreting model outputs. * Toxicity: Despite being trained with carefully selected data, the model can still produce harmful content if explicitly prompted or instructed to do so. We chose to release the model to help the open-source community develop the most effective ways to reduce the toxicity of a model directly after pretraining. * Verbosity: Phi-2 being a base model often produces irrelevant or extra text and responses following its first answer to user prompts within a single turn. This is due to its training dataset being primarily textbooks, which results in textbook-like responses. ## Training ### Model * Architecture: a Transformer-based model with next-word prediction objective * Context length: 2048 tokens * Dataset size: 250B tokens, combination of NLP synthetic data created by AOAI GPT-3.5 and filtered web data from Falcon RefinedWeb and SlimPajama, which was assessed by AOAI GPT-4. * Training tokens: 1.4T tokens * GPUs: 96xA100-80G * Training time: 14 days ### Software * [PyTorch](https://github.com/pytorch/pytorch) * [DeepSpeed](https://github.com/microsoft/DeepSpeed) * [Flash-Attention](https://github.com/HazyResearch/flash-attention) ### License The model is licensed under the [MIT license](https://huggingface.co/microsoft/phi-2/resolve/main/LICENSE). ## Trademarks This project may contain trademarks or logos for projects, products, or services. Authorized use of Microsoft trademarks or logos is subject to and must follow [Microsoft’s Trademark & Brand Guidelines](https://www.microsoft.com/en-us/legal/intellectualproperty/trademarks). Use of Microsoft trademarks or logos in modified versions of this project must not cause confusion or imply Microsoft sponsorship. Any use of third-party trademarks or logos are subject to those third-party’s policies.

mrm8488/bert2bert_shared-spanish-finetuned-summarization

mrm8488

transformers

summarization

--- tags: - summarization - news language: es datasets: - mlsum widget: - text: 'Al filo de las 22.00 horas del jueves, la Asamblea de Madrid vive un momento sorprendente: Vox decide no apoyar una propuesta del PP en favor del blindaje fiscal de la Comunidad. Se ha roto la unidad de los tres partidos de derechas. Es un hecho excepcional. Desde que arrancó la legislatura, PP, Cs y Vox han votado en bloque casi el 75% de las veces en el pleno de la Cámara. Juntos decidieron la composición de la Mesa de la Asamblea. Juntos invistieron presidenta a Isabel Díaz Ayuso. Y juntos han votado la mayoría de proposiciones no de ley, incluida la que ha marcado el esprint final de la campaña para las elecciones generales: acaban de instar al Gobierno de España a "la ilegalización inmediata" de los partidos separatistas "que atenten contra la unidad de la Nación". Los críticos de Cs no comparten el apoyo al texto de Vox contra el secesionisimo Ese balance retrata una necesidad antes que una complicidad, según fuentes del PP con predicamento en la dirección regional y nacional. Tras casi 15 años gobernando con mayoría absoluta, la formación conservadora vivió como una tortura la pasada legislatura, en la que dependió de Cs para sacar adelante sus iniciativas. El problema se agudizó tras las elecciones autonómicas de mayo. El PP ha tenido que formar con Cs el primer gobierno de coalición de la historia de la región, y ni siquiera con eso le basta para ganar las votaciones de la Cámara. Los dos socios gubernamentales necesitan a Vox, la menos predecible de las tres formaciones. "Tenemos que trabajar juntos defendiendo la unidad del país, por eso no quisimos dejar a Vox solo", dijo ayer Díaz Ayuso para justificar el apoyo de PP y Cs a la proposición de la extrema derecha sobre Cataluña. "Después nosotros llevábamos otra proposición para defender el blindaje fiscal de Madrid, y ahí Vox nos dejó atrás. No permitió que esto saliera. Es un grave error por su parte", prosiguió, recalcando el enfado del PP. "Demuestra que está más en cuestiones electoralistas", subrayó. "Los que pensamos, con nuestras inmensas diferencias, que tenemos cosas en común que nos unen como partidos que queremos Comunidades libres, con bajos impuestos, en las que se viva con seguridad y en paz, tenemos que estar unidos", argumentó. "Y por lo menos nosotros de nuestra línea no nos separamos". Al contrario de lo que está ocurriendo el Ayuntamiento de Madrid, donde el PP y Cs ya han defendido posiciones de voto distintas, pese a compartir el Gobierno, en la Asamblea los partidos de Díaz Ayuso e Ignacio Aguado están actuando con la máxima lealtad en las votaciones del pleno. Otra cosa son las comisiones. Y el caso Avalmadrid. Es en ese terreno donde Cs y Vox están buscando el margen de maniobra necesario para separarse del PP en plena campaña electoral, abandonando a su suerte a su socio para distinguirse ante los electores. —"Usted me ha dejado tirada", le espetó la presidenta de la Comunidad de Madrid a Rocío Monasterio tras saber que Vox permitiría que la izquierda tuviera mayoría en la comisión parlamentaria que investigará los avales concedidos por la empresa semipública entre 2007 y 2018, lo que podría incluir el de 400.000 euros aprobado en 2011, y nunca devuelto al completo, para una empresa participada por el padre de Isabel Díaz Ayuso. "Monasterio no es de fiar. Dice una cosa y hace la contraria", dice una fuente popular sobre las negociaciones mantenidas para repartirse los puestos de las diferentes comisiones, que Vox no cumplió tras buscar un segundo pacto con otras formaciones (que no llegó a buen puerto). Ilegalización de Vox Los tres partidos de derechas también se han enfrentado por la ubicación de Vox en el pleno. Las largas negociaciones para la investidura de Díaz Ayuso dejaron heridas abiertas. Y los diputados de Cs no desaprovechan la oportunidad de lanzar dardos contra los de Vox, pero luego coinciden con ellos en la mayoría de votaciones. Ocurrió, por ejemplo, el jueves, cuando se debatía la polémica proposición para instar al Gobierno nacional a ilegalizar a los partidos separatistas que atenten contra la unidad de España. —"Mostrar nuestra sorpresa ante la presentación por parte de Vox de esta propuesta", lanzó Araceli Gómez, diputada de la formación de Aguado. "Sorprende que planteen ustedes este asunto cuando está también sobre la mesa el debate de su propia ilegalización por atentar contra el ordenamiento jurídico o contra valores constitucionales como la igualdad o la no discriminación". Luego de esa descalificación, y ante la incredulidad de los diputados de los partidos de izquierdas, Cs unió sus votos a los de Vox y a los del PP. La decisión ha provocado polémica interna, como demuestra que Albert Rivera no la apoyara ayer explícitamente. Tampoco ha sido bien acogida por el sector crítico de la formación. Pero ha demostrado una cosa: en Madrid hay tres partidos que casi siempre votan como uno.' --- # Spanish BERT2BERT (BETO) fine-tuned on MLSUM ES for summarization ## Model [dccuchile/bert-base-spanish-wwm-cased](https://huggingface.co/dccuchile/bert-base-spanish-wwm-cased) (BERT Checkpoint) ## Dataset **MLSUM** is the first large-scale MultiLingual SUMmarization dataset. Obtained from online newspapers, it contains 1.5M+ article/summary pairs in five different languages -- namely, French, German, **Spanish**, Russian, Turkish. Together with English newspapers from the popular CNN/Daily mail dataset, the collected data form a large scale multilingual dataset which can enable new research directions for the text summarization community. We report cross-lingual comparative analyses based on state-of-the-art systems. These highlight existing biases which motivate the use of a multi-lingual dataset. [MLSUM es](https://huggingface.co/datasets/viewer/?dataset=mlsum) ## Results |Set|Metric| Value| |----|------|------| | Test |Rouge2 - mid -precision | **9.6**| | Test | Rouge2 - mid - recall | **8.4**| | Test | Rouge2 - mid - fmeasure | **8.7**| | Test | Rouge1 | 26.24 | | Test | Rouge2 | 8.9 | | Test | RougeL | 21.01| | Test | RougeLsum | 21.02 | ## Usage ```python import torch from transformers import BertTokenizerFast, EncoderDecoderModel device = 'cuda' if torch.cuda.is_available() else 'cpu' ckpt = 'mrm8488/bert2bert_shared-spanish-finetuned-summarization' tokenizer = BertTokenizerFast.from_pretrained(ckpt) model = EncoderDecoderModel.from_pretrained(ckpt).to(device) def generate_summary(text): inputs = tokenizer([text], padding="max_length", truncation=True, max_length=512, return_tensors="pt") input_ids = inputs.input_ids.to(device) attention_mask = inputs.attention_mask.to(device) output = model.generate(input_ids, attention_mask=attention_mask) return tokenizer.decode(output[0], skip_special_tokens=True) text = "Your text here..." generate_summary(text) ``` > Created by [Manuel Romero/@mrm8488](https://twitter.com/mrm8488) with the support of [Narrativa](https://www.narrativa.com/) > Made with <span style="color: #e25555;">&hearts;</span> in Spain

cardiffnlp/twitter-roberta-base-offensive

cardiffnlp

transformers

text-classification

# Twitter-roBERTa-base for Offensive Language Identification This is a roBERTa-base model trained on ~58M tweets and finetuned for offensive language identification with the TweetEval benchmark. - Paper: [_TweetEval_ benchmark (Findings of EMNLP 2020)](https://arxiv.org/pdf/2010.12421.pdf). - Git Repo: [Tweeteval official repository](https://github.com/cardiffnlp/tweeteval). ## Example of classification ```python from transformers import AutoModelForSequenceClassification from transformers import TFAutoModelForSequenceClassification from transformers import AutoTokenizer import numpy as np from scipy.special import softmax import csv import urllib.request # Preprocess text (username and link placeholders) def preprocess(text): new_text = [] for t in text.split(" "): t = '@user' if t.startswith('@') and len(t) > 1 else t t = 'http' if t.startswith('http') else t new_text.append(t) return " ".join(new_text) # Tasks: # emoji, emotion, hate, irony, offensive, sentiment # stance/abortion, stance/atheism, stance/climate, stance/feminist, stance/hillary task='offensive' MODEL = f"cardiffnlp/twitter-roberta-base-{task}" tokenizer = AutoTokenizer.from_pretrained(MODEL) # download label mapping labels=[] mapping_link = f"https://raw.githubusercontent.com/cardiffnlp/tweeteval/main/datasets/{task}/mapping.txt" with urllib.request.urlopen(mapping_link) as f: html = f.read().decode('utf-8').split("\n") csvreader = csv.reader(html, delimiter='\t') labels = [row[1] for row in csvreader if len(row) > 1] # PT model = AutoModelForSequenceClassification.from_pretrained(MODEL) model.save_pretrained(MODEL) text = "Good night 😊" text = preprocess(text) encoded_input = tokenizer(text, return_tensors='pt') output = model(**encoded_input) scores = output[0][0].detach().numpy() scores = softmax(scores) # # TF # model = TFAutoModelForSequenceClassification.from_pretrained(MODEL) # model.save_pretrained(MODEL) # text = "Good night 😊" # encoded_input = tokenizer(text, return_tensors='tf') # output = model(encoded_input) # scores = output[0][0].numpy() # scores = softmax(scores) ranking = np.argsort(scores) ranking = ranking[::-1] for i in range(scores.shape[0]): l = labels[ranking[i]] s = scores[ranking[i]] print(f"{i+1}) {l} {np.round(float(s), 4)}") ``` Output: ``` 1) not-offensive 0.9073 2) offensive 0.0927 ```

pyannote/speaker-diarization-3.0

pyannote

pyannote-audio

automatic-speech-recognition

--- tags: - pyannote - pyannote-audio - pyannote-audio-pipeline - audio - voice - speech - speaker - speaker-diarization - speaker-change-detection - voice-activity-detection - overlapped-speech-detection - automatic-speech-recognition license: mit extra_gated_prompt: "The collected information will help acquire a better knowledge of pyannote.audio userbase and help its maintainers improve it further. Though this pipeline uses MIT license and will always remain open-source, we will occasionnally email you about premium pipelines and paid services around pyannote." extra_gated_fields: Company/university: text Website: text --- Using this open-source pipeline in production? Make the most of it thanks to our [consulting services](https://herve.niderb.fr/consulting.html). # 🎹 Speaker diarization 3.0 This pipeline has been trained by Séverin Baroudi with [pyannote.audio](https://github.com/pyannote/pyannote-audio) `3.0.0` using a combination of the training sets of AISHELL, AliMeeting, AMI, AVA-AVD, DIHARD, Ego4D, MSDWild, REPERE, and VoxConverse. It ingests mono audio sampled at 16kHz and outputs speaker diarization as an [`Annotation`](http://pyannote.github.io/pyannote-core/structure.html#annotation) instance: * stereo or multi-channel audio files are automatically downmixed to mono by averaging the channels. * audio files sampled at a different rate are resampled to 16kHz automatically upon loading. ## Requirements 1. Install [`pyannote.audio`](https://github.com/pyannote/pyannote-audio) `3.0` with `pip install pyannote.audio` 2. Accept [`pyannote/segmentation-3.0`](https://hf.co/pyannote/segmentation-3.0) user conditions 3. Accept [`pyannote/speaker-diarization-3.0`](https://hf.co/pyannote-speaker-diarization-3.0) user conditions 4. Create access token at [`hf.co/settings/tokens`](https://hf.co/settings/tokens). ## Usage ```python # instantiate the pipeline from pyannote.audio import Pipeline pipeline = Pipeline.from_pretrained( "pyannote/speaker-diarization-3.0", use_auth_token="HUGGINGFACE_ACCESS_TOKEN_GOES_HERE") # run the pipeline on an audio file diarization = pipeline("audio.wav") # dump the diarization output to disk using RTTM format with open("audio.rttm", "w") as rttm: diarization.write_rttm(rttm) ``` ### Processing on GPU `pyannote.audio` pipelines run on CPU by default. You can send them to GPU with the following lines: ```python import torch pipeline.to(torch.device("cuda")) ``` Real-time factor is around 2.5% using one Nvidia Tesla V100 SXM2 GPU (for the neural inference part) and one Intel Cascade Lake 6248 CPU (for the clustering part). In other words, it takes approximately 1.5 minutes to process a one hour conversation. ### Processing from memory Pre-loading audio files in memory may result in faster processing: ```python waveform, sample_rate = torchaudio.load("audio.wav") diarization = pipeline({"waveform": waveform, "sample_rate": sample_rate}) ``` ### Monitoring progress Hooks are available to monitor the progress of the pipeline: ```python from pyannote.audio.pipelines.utils.hook import ProgressHook with ProgressHook() as hook: diarization = pipeline("audio.wav", hook=hook) ``` ### Controlling the number of speakers In case the number of speakers is known in advance, one can use the `num_speakers` option: ```python diarization = pipeline("audio.wav", num_speakers=2) ``` One can also provide lower and/or upper bounds on the number of speakers using `min_speakers` and `max_speakers` options: ```python diarization = pipeline("audio.wav", min_speakers=2, max_speakers=5) ``` ## Benchmark This pipeline has been benchmarked on a large collection of datasets. Processing is fully automatic: * no manual voice activity detection (as is sometimes the case in the literature) * no manual number of speakers (though it is possible to provide it to the pipeline) * no fine-tuning of the internal models nor tuning of the pipeline hyper-parameters to each dataset ... with the least forgiving diarization error rate (DER) setup (named *"Full"* in [this paper](https://doi.org/10.1016/j.csl.2021.101254)): * no forgiveness collar * evaluation of overlapped speech | Benchmark | [DER%](. "Diarization error rate") | [FA%](. "False alarm rate") | [Miss%](. "Missed detection rate") | [Conf%](. "Speaker confusion rate") | Expected output | File-level evaluation | | ------------------------------------------------------------------------------------------------------------------------------------------- | ---------------------------------- | --------------------------- | ---------------------------------- | ----------------------------------- | ----------------------------------------------------------------------------------------------------------------------------- | ----------------------------------------------------------------------------------------------------------------------------- | | [AISHELL-4](http://www.openslr.org/111/) | 12.3 | 3.8 | 4.4 | 4.1 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AISHELL.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AISHELL.SpeakerDiarization.Benchmark.test.eval) | | [AliMeeting (*channel 1*)](https://www.openslr.org/119/) | 24.3 | 4.4 | 10.0 | 9.9 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AliMeeting.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AliMeeting.SpeakerDiarization.Benchmark.test.eval) | | [AMI (*headset mix,*](https://groups.inf.ed.ac.uk/ami/corpus/) [*only_words*)](https://github.com/BUTSpeechFIT/AMI-diarization-setup) | 19.0 | 3.6 | 9.5 | 5.9 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AMI.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AMI.SpeakerDiarization.Benchmark.test.eval) | | [AMI (*array1, channel 1,*](https://groups.inf.ed.ac.uk/ami/corpus/) [*only_words)*](https://github.com/BUTSpeechFIT/AMI-diarization-setup) | 22.2 | 3.8 | 11.2 | 7.3 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AMI-SDM.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AMI-SDM.SpeakerDiarization.Benchmark.test.eval) | | [AVA-AVD](https://arxiv.org/abs/2111.14448) | 49.1 | 10.8 | 15.7| 22.5 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AVA-AVD.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/AVA-AVD.SpeakerDiarization.Benchmark.test.eval) | | [DIHARD 3 (*Full*)](https://arxiv.org/abs/2012.01477) | 21.7 | 6.2 | 8.1 | 7.3 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/DIHARD.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/DIHARD.SpeakerDiarization.Benchmark.test.eval) | | [MSDWild](https://x-lance.github.io/MSDWILD/) | 24.6 | 5.8 | 8.0 | 10.7 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/MSDWILD.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/MSDWILD.SpeakerDiarization.Benchmark.test.eval) | | [REPERE (*phase 2*)](https://islrn.org/resources/360-758-359-485-0/) | 7.8 | 1.8 | 2.6 | 3.5 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/REPERE.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/REPERE.SpeakerDiarization.Benchmark.test.eval) | | [VoxConverse (*v0.3*)](https://github.com/joonson/voxconverse) | 11.3 | 4.1 | 3.4 | 3.8 | [RTTM](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/VoxConverse.SpeakerDiarization.Benchmark.test.rttm) | [eval](https://huggingface.co/pyannote/speaker-diarization-3.0.0/blob/main/reproducible_research/VoxConverse.SpeakerDiarization.Benchmark.test.eval) | ## Citations ```bibtex @inproceedings{Plaquet23, author={Alexis Plaquet and Hervé Bredin}, title={{Powerset multi-class cross entropy loss for neural speaker diarization}}, year=2023, booktitle={Proc. INTERSPEECH 2023}, } ``` ```bibtex @inproceedings{Bredin23, author={Hervé Bredin}, title={{pyannote.audio 2.1 speaker diarization pipeline: principle, benchmark, and recipe}}, year=2023, booktitle={Proc. INTERSPEECH 2023}, } ```

mistralai/Mixtral-8x7B-Instruct-v0.1

mistralai

transformers

text-generation

--- license: apache-2.0 language: - fr - it - de - es - en inference: parameters: temperature: 0.5 widget: - messages: - role: user content: What is your favorite condiment? --- # Model Card for Mixtral-8x7B The Mixtral-8x7B Large Language Model (LLM) is a pretrained generative Sparse Mixture of Experts. The Mixtral-8x7B outperforms Llama 2 70B on most benchmarks we tested. For full details of this model please read our [release blog post](https://mistral.ai/news/mixtral-of-experts/). ## Warning This repo contains weights that are compatible with [vLLM](https://github.com/vllm-project/vllm) serving of the model as well as Hugging Face [transformers](https://github.com/huggingface/transformers) library. It is based on the original Mixtral [torrent release](magnet:?xt=urn:btih:5546272da9065eddeb6fcd7ffddeef5b75be79a7&dn=mixtral-8x7b-32kseqlen&tr=udp%3A%2F%http://2Fopentracker.i2p.rocks%3A6969%2Fannounce&tr=http%3A%2F%http://2Ftracker.openbittorrent.com%3A80%2Fannounce), but the file format and parameter names are different. Please note that model cannot (yet) be instantiated with HF. ## Instruction format This format must be strictly respected, otherwise the model will generate sub-optimal outputs. The template used to build a prompt for the Instruct model is defined as follows: ``` <s> [INST] Instruction [/INST] Model answer</s> [INST] Follow-up instruction [/INST] ``` Note that `<s>` and `</s>` are special tokens for beginning of string (BOS) and end of string (EOS) while [INST] and [/INST] are regular strings. As reference, here is the pseudo-code used to tokenize instructions during fine-tuning: ```python def tokenize(text): return tok.encode(text, add_special_tokens=False) [BOS_ID] + tokenize("[INST]") + tokenize(USER_MESSAGE_1) + tokenize("[/INST]") + tokenize(BOT_MESSAGE_1) + [EOS_ID] + … tokenize("[INST]") + tokenize(USER_MESSAGE_N) + tokenize("[/INST]") + tokenize(BOT_MESSAGE_N) + [EOS_ID] ``` In the pseudo-code above, note that the `tokenize` method should not add a BOS or EOS token automatically, but should add a prefix space. In the Transformers library, one can use [chat templates](https://huggingface.co/docs/transformers/main/en/chat_templating) which make sure the right format is applied. ## Run the model ```python from transformers import AutoModelForCausalLM, AutoTokenizer model_id = "mistralai/Mixtral-8x7B-Instruct-v0.1" tokenizer = AutoTokenizer.from_pretrained(model_id) model = AutoModelForCausalLM.from_pretrained(model_id, device_map="auto") messages = [ {"role": "user", "content": "What is your favourite condiment?"}, {"role": "assistant", "content": "Well, I'm quite partial to a good squeeze of fresh lemon juice. It adds just the right amount of zesty flavour to whatever I'm cooking up in the kitchen!"}, {"role": "user", "content": "Do you have mayonnaise recipes?"} ] inputs = tokenizer.apply_chat_template(messages, return_tensors="pt").to("cuda") outputs = model.generate(inputs, max_new_tokens=20) print(tokenizer.decode(outputs[0], skip_special_tokens=True)) ``` By default, transformers will load the model in full precision. Therefore you might be interested to further reduce down the memory requirements to run the model through the optimizations we offer in HF ecosystem: ### In half-precision Note `float16` precision only works on GPU devices <details> <summary> Click to expand </summary> ```diff + import torch from transformers import AutoModelForCausalLM, AutoTokenizer model_id = "mistralai/Mixtral-8x7B-Instruct-v0.1" tokenizer = AutoTokenizer.from_pretrained(model_id) + model = AutoModelForCausalLM.from_pretrained(model_id, torch_dtype=torch.float16, device_map="auto") messages = [ {"role": "user", "content": "What is your favourite condiment?"}, {"role": "assistant", "content": "Well, I'm quite partial to a good squeeze of fresh lemon juice. It adds just the right amount of zesty flavour to whatever I'm cooking up in the kitchen!"}, {"role": "user", "content": "Do you have mayonnaise recipes?"} ] input_ids = tokenizer.apply_chat_template(messages, return_tensors="pt").to("cuda") outputs = model.generate(input_ids, max_new_tokens=20) print(tokenizer.decode(outputs[0], skip_special_tokens=True)) ``` </details> ### Lower precision using (8-bit & 4-bit) using `bitsandbytes` <details> <summary> Click to expand </summary> ```diff + import torch from transformers import AutoModelForCausalLM, AutoTokenizer model_id = "mistralai/Mixtral-8x7B-Instruct-v0.1" tokenizer = AutoTokenizer.from_pretrained(model_id) + model = AutoModelForCausalLM.from_pretrained(model_id, load_in_4bit=True, device_map="auto") text = "Hello my name is" messages = [ {"role": "user", "content": "What is your favourite condiment?"}, {"role": "assistant", "content": "Well, I'm quite partial to a good squeeze of fresh lemon juice. It adds just the right amount of zesty flavour to whatever I'm cooking up in the kitchen!"}, {"role": "user", "content": "Do you have mayonnaise recipes?"} ] input_ids = tokenizer.apply_chat_template(messages, return_tensors="pt").to("cuda") outputs = model.generate(input_ids, max_new_tokens=20) print(tokenizer.decode(outputs[0], skip_special_tokens=True)) ``` </details> ### Load the model with Flash Attention 2 <details> <summary> Click to expand </summary> ```diff + import torch from transformers import AutoModelForCausalLM, AutoTokenizer model_id = "mistralai/Mixtral-8x7B-Instruct-v0.1" tokenizer = AutoTokenizer.from_pretrained(model_id) + model = AutoModelForCausalLM.from_pretrained(model_id, use_flash_attention_2=True, device_map="auto") messages = [ {"role": "user", "content": "What is your favourite condiment?"}, {"role": "assistant", "content": "Well, I'm quite partial to a good squeeze of fresh lemon juice. It adds just the right amount of zesty flavour to whatever I'm cooking up in the kitchen!"}, {"role": "user", "content": "Do you have mayonnaise recipes?"} ] input_ids = tokenizer.apply_chat_template(messages, return_tensors="pt").to("cuda") outputs = model.generate(input_ids, max_new_tokens=20) print(tokenizer.decode(outputs[0], skip_special_tokens=True)) ``` </details> ## Limitations The Mixtral-8x7B Instruct model is a quick demonstration that the base model can be easily fine-tuned to achieve compelling performance. It does not have any moderation mechanisms. We're looking forward to engaging with the community on ways to make the model finely respect guardrails, allowing for deployment in environments requiring moderated outputs. # The Mistral AI Team Albert Jiang, Alexandre Sablayrolles, Arthur Mensch, Blanche Savary, Chris Bamford, Devendra Singh Chaplot, Diego de las Casas, Emma Bou Hanna, Florian Bressand, Gianna Lengyel, Guillaume Bour, Guillaume Lample, Lélio Renard Lavaud, Louis Ternon, Lucile Saulnier, Marie-Anne Lachaux, Pierre Stock, Teven Le Scao, Théophile Gervet, Thibaut Lavril, Thomas Wang, Timothée Lacroix, William El Sayed.

timm/resnet18.a1_in1k

timm

timm

image-classification

--- tags: - image-classification - timm license: apache-2.0 library_name: timm --- # Model card for resnet18.a1_in1k A ResNet-B image classification model. This model features: * ReLU activations * single layer 7x7 convolution with pooling * 1x1 convolution shortcut downsample Trained on ImageNet-1k in `timm` using recipe template described below. Recipe details: * ResNet Strikes Back `A1` recipe * LAMB optimizer with BCE loss * Cosine LR schedule with warmup ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 11.7 - GMACs: 1.8 - Activations (M): 2.5 - Image size: train = 224 x 224, test = 288 x 288 - **Papers:** - ResNet strikes back: An improved training procedure in timm: https://arxiv.org/abs/2110.00476 - Deep Residual Learning for Image Recognition: https://arxiv.org/abs/1512.03385 - **Original:** https://github.com/huggingface/pytorch-image-models ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('resnet18.a1_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Feature Map Extraction ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'resnet18.a1_in1k', pretrained=True, features_only=True, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 for o in output: # print shape of each feature map in output # e.g.: # torch.Size([1, 64, 112, 112]) # torch.Size([1, 64, 56, 56]) # torch.Size([1, 128, 28, 28]) # torch.Size([1, 256, 14, 14]) # torch.Size([1, 512, 7, 7]) print(o.shape) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'resnet18.a1_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled, a (1, 512, 7, 7) shaped tensor output = model.forward_head(output, pre_logits=True) # output is a (1, num_features) shaped tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). |model |img_size|top1 |top5 |param_count|gmacs|macts|img/sec| |------------------------------------------|--------|-----|-----|-----------|-----|-----|-------| |[seresnextaa101d_32x8d.sw_in12k_ft_in1k_288](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k_288)|320 |86.72|98.17|93.6 |35.2 |69.7 |451 | |[seresnextaa101d_32x8d.sw_in12k_ft_in1k_288](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k_288)|288 |86.51|98.08|93.6 |28.5 |56.4 |560 | |[seresnextaa101d_32x8d.sw_in12k_ft_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k)|288 |86.49|98.03|93.6 |28.5 |56.4 |557 | |[seresnextaa101d_32x8d.sw_in12k_ft_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k)|224 |85.96|97.82|93.6 |17.2 |34.2 |923 | |[resnext101_32x32d.fb_wsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x32d.fb_wsl_ig1b_ft_in1k)|224 |85.11|97.44|468.5 |87.3 |91.1 |254 | |[resnetrs420.tf_in1k](https://huggingface.co/timm/resnetrs420.tf_in1k)|416 |85.0 |97.12|191.9 |108.4|213.8|134 | |[ecaresnet269d.ra2_in1k](https://huggingface.co/timm/ecaresnet269d.ra2_in1k)|352 |84.96|97.22|102.1 |50.2 |101.2|291 | |[ecaresnet269d.ra2_in1k](https://huggingface.co/timm/ecaresnet269d.ra2_in1k)|320 |84.73|97.18|102.1 |41.5 |83.7 |353 | |[resnetrs350.tf_in1k](https://huggingface.co/timm/resnetrs350.tf_in1k)|384 |84.71|96.99|164.0 |77.6 |154.7|183 | |[seresnextaa101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.ah_in1k)|288 |84.57|97.08|93.6 |28.5 |56.4 |557 | |[resnetrs200.tf_in1k](https://huggingface.co/timm/resnetrs200.tf_in1k)|320 |84.45|97.08|93.2 |31.5 |67.8 |446 | |[resnetrs270.tf_in1k](https://huggingface.co/timm/resnetrs270.tf_in1k)|352 |84.43|96.97|129.9 |51.1 |105.5|280 | |[seresnext101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101d_32x8d.ah_in1k)|288 |84.36|96.92|93.6 |27.6 |53.0 |595 | |[seresnet152d.ra2_in1k](https://huggingface.co/timm/seresnet152d.ra2_in1k)|320 |84.35|97.04|66.8 |24.1 |47.7 |610 | |[resnetrs350.tf_in1k](https://huggingface.co/timm/resnetrs350.tf_in1k)|288 |84.3 |96.94|164.0 |43.7 |87.1 |333 | |[resnext101_32x8d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x8d.fb_swsl_ig1b_ft_in1k)|224 |84.28|97.17|88.8 |16.5 |31.2 |1100 | |[resnetrs420.tf_in1k](https://huggingface.co/timm/resnetrs420.tf_in1k)|320 |84.24|96.86|191.9 |64.2 |126.6|228 | |[seresnext101_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101_32x8d.ah_in1k)|288 |84.19|96.87|93.6 |27.2 |51.6 |613 | |[resnext101_32x16d.fb_wsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x16d.fb_wsl_ig1b_ft_in1k)|224 |84.18|97.19|194.0 |36.3 |51.2 |581 | |[resnetaa101d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa101d.sw_in12k_ft_in1k)|288 |84.11|97.11|44.6 |15.1 |29.0 |1144 | |[resnet200d.ra2_in1k](https://huggingface.co/timm/resnet200d.ra2_in1k)|320 |83.97|96.82|64.7 |31.2 |67.3 |518 | |[resnetrs200.tf_in1k](https://huggingface.co/timm/resnetrs200.tf_in1k)|256 |83.87|96.75|93.2 |20.2 |43.4 |692 | |[seresnextaa101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.ah_in1k)|224 |83.86|96.65|93.6 |17.2 |34.2 |923 | |[resnetrs152.tf_in1k](https://huggingface.co/timm/resnetrs152.tf_in1k)|320 |83.72|96.61|86.6 |24.3 |48.1 |617 | |[seresnet152d.ra2_in1k](https://huggingface.co/timm/seresnet152d.ra2_in1k)|256 |83.69|96.78|66.8 |15.4 |30.6 |943 | |[seresnext101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101d_32x8d.ah_in1k)|224 |83.68|96.61|93.6 |16.7 |32.0 |986 | |[resnet152d.ra2_in1k](https://huggingface.co/timm/resnet152d.ra2_in1k)|320 |83.67|96.74|60.2 |24.1 |47.7 |706 | |[resnetrs270.tf_in1k](https://huggingface.co/timm/resnetrs270.tf_in1k)|256 |83.59|96.61|129.9 |27.1 |55.8 |526 | |[seresnext101_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101_32x8d.ah_in1k)|224 |83.58|96.4 |93.6 |16.5 |31.2 |1013 | |[resnetaa101d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa101d.sw_in12k_ft_in1k)|224 |83.54|96.83|44.6 |9.1 |17.6 |1864 | |[resnet152.a1h_in1k](https://huggingface.co/timm/resnet152.a1h_in1k)|288 |83.46|96.54|60.2 |19.1 |37.3 |904 | |[resnext101_32x16d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x16d.fb_swsl_ig1b_ft_in1k)|224 |83.35|96.85|194.0 |36.3 |51.2 |582 | |[resnet200d.ra2_in1k](https://huggingface.co/timm/resnet200d.ra2_in1k)|256 |83.23|96.53|64.7 |20.0 |43.1 |809 | |[resnext101_32x4d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x4d.fb_swsl_ig1b_ft_in1k)|224 |83.22|96.75|44.2 |8.0 |21.2 |1814 | |[resnext101_64x4d.c1_in1k](https://huggingface.co/timm/resnext101_64x4d.c1_in1k)|288 |83.16|96.38|83.5 |25.7 |51.6 |590 | |[resnet152d.ra2_in1k](https://huggingface.co/timm/resnet152d.ra2_in1k)|256 |83.14|96.38|60.2 |15.4 |30.5 |1096 | |[resnet101d.ra2_in1k](https://huggingface.co/timm/resnet101d.ra2_in1k)|320 |83.02|96.45|44.6 |16.5 |34.8 |992 | |[ecaresnet101d.miil_in1k](https://huggingface.co/timm/ecaresnet101d.miil_in1k)|288 |82.98|96.54|44.6 |13.4 |28.2 |1077 | |[resnext101_64x4d.tv_in1k](https://huggingface.co/timm/resnext101_64x4d.tv_in1k)|224 |82.98|96.25|83.5 |15.5 |31.2 |989 | |[resnetrs152.tf_in1k](https://huggingface.co/timm/resnetrs152.tf_in1k)|256 |82.86|96.28|86.6 |15.6 |30.8 |951 | |[resnext101_32x8d.tv2_in1k](https://huggingface.co/timm/resnext101_32x8d.tv2_in1k)|224 |82.83|96.22|88.8 |16.5 |31.2 |1099 | |[resnet152.a1h_in1k](https://huggingface.co/timm/resnet152.a1h_in1k)|224 |82.8 |96.13|60.2 |11.6 |22.6 |1486 | |[resnet101.a1h_in1k](https://huggingface.co/timm/resnet101.a1h_in1k)|288 |82.8 |96.32|44.6 |13.0 |26.8 |1291 | |[resnet152.a1_in1k](https://huggingface.co/timm/resnet152.a1_in1k)|288 |82.74|95.71|60.2 |19.1 |37.3 |905 | |[resnext101_32x8d.fb_wsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x8d.fb_wsl_ig1b_ft_in1k)|224 |82.69|96.63|88.8 |16.5 |31.2 |1100 | |[resnet152.a2_in1k](https://huggingface.co/timm/resnet152.a2_in1k)|288 |82.62|95.75|60.2 |19.1 |37.3 |904 | |[resnetaa50d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa50d.sw_in12k_ft_in1k)|288 |82.61|96.49|25.6 |8.9 |20.6 |1729 | |[resnet61q.ra2_in1k](https://huggingface.co/timm/resnet61q.ra2_in1k)|288 |82.53|96.13|36.8 |9.9 |21.5 |1773 | |[wide_resnet101_2.tv2_in1k](https://huggingface.co/timm/wide_resnet101_2.tv2_in1k)|224 |82.5 |96.02|126.9 |22.8 |21.2 |1078 | |[resnext101_64x4d.c1_in1k](https://huggingface.co/timm/resnext101_64x4d.c1_in1k)|224 |82.46|95.92|83.5 |15.5 |31.2 |987 | |[resnet51q.ra2_in1k](https://huggingface.co/timm/resnet51q.ra2_in1k)|288 |82.36|96.18|35.7 |8.1 |20.9 |1964 | |[ecaresnet50t.ra2_in1k](https://huggingface.co/timm/ecaresnet50t.ra2_in1k)|320 |82.35|96.14|25.6 |8.8 |24.1 |1386 | |[resnet101.a1_in1k](https://huggingface.co/timm/resnet101.a1_in1k)|288 |82.31|95.63|44.6 |13.0 |26.8 |1291 | |[resnetrs101.tf_in1k](https://huggingface.co/timm/resnetrs101.tf_in1k)|288 |82.29|96.01|63.6 |13.6 |28.5 |1078 | |[resnet152.tv2_in1k](https://huggingface.co/timm/resnet152.tv2_in1k)|224 |82.29|96.0 |60.2 |11.6 |22.6 |1484 | |[wide_resnet50_2.racm_in1k](https://huggingface.co/timm/wide_resnet50_2.racm_in1k)|288 |82.27|96.06|68.9 |18.9 |23.8 |1176 | |[resnet101d.ra2_in1k](https://huggingface.co/timm/resnet101d.ra2_in1k)|256 |82.26|96.07|44.6 |10.6 |22.2 |1542 | |[resnet101.a2_in1k](https://huggingface.co/timm/resnet101.a2_in1k)|288 |82.24|95.73|44.6 |13.0 |26.8 |1290 | |[seresnext50_32x4d.racm_in1k](https://huggingface.co/timm/seresnext50_32x4d.racm_in1k)|288 |82.2 |96.14|27.6 |7.0 |23.8 |1547 | |[ecaresnet101d.miil_in1k](https://huggingface.co/timm/ecaresnet101d.miil_in1k)|224 |82.18|96.05|44.6 |8.1 |17.1 |1771 | |[resnext50_32x4d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext50_32x4d.fb_swsl_ig1b_ft_in1k)|224 |82.17|96.22|25.0 |4.3 |14.4 |2943 | |[ecaresnet50t.a1_in1k](https://huggingface.co/timm/ecaresnet50t.a1_in1k)|288 |82.12|95.65|25.6 |7.1 |19.6 |1704 | |[resnext50_32x4d.a1h_in1k](https://huggingface.co/timm/resnext50_32x4d.a1h_in1k)|288 |82.03|95.94|25.0 |7.0 |23.8 |1745 | |[ecaresnet101d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet101d_pruned.miil_in1k)|288 |82.0 |96.15|24.9 |5.8 |12.7 |1787 | |[resnet61q.ra2_in1k](https://huggingface.co/timm/resnet61q.ra2_in1k)|256 |81.99|95.85|36.8 |7.8 |17.0 |2230 | |[resnext101_32x8d.tv2_in1k](https://huggingface.co/timm/resnext101_32x8d.tv2_in1k)|176 |81.98|95.72|88.8 |10.3 |19.4 |1768 | |[resnet152.a1_in1k](https://huggingface.co/timm/resnet152.a1_in1k)|224 |81.97|95.24|60.2 |11.6 |22.6 |1486 | |[resnet101.a1h_in1k](https://huggingface.co/timm/resnet101.a1h_in1k)|224 |81.93|95.75|44.6 |7.8 |16.2 |2122 | |[resnet101.tv2_in1k](https://huggingface.co/timm/resnet101.tv2_in1k)|224 |81.9 |95.77|44.6 |7.8 |16.2 |2118 | |[resnext101_32x16d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext101_32x16d.fb_ssl_yfcc100m_ft_in1k)|224 |81.84|96.1 |194.0 |36.3 |51.2 |583 | |[resnet51q.ra2_in1k](https://huggingface.co/timm/resnet51q.ra2_in1k)|256 |81.78|95.94|35.7 |6.4 |16.6 |2471 | |[resnet152.a2_in1k](https://huggingface.co/timm/resnet152.a2_in1k)|224 |81.77|95.22|60.2 |11.6 |22.6 |1485 | |[resnetaa50d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa50d.sw_in12k_ft_in1k)|224 |81.74|96.06|25.6 |5.4 |12.4 |2813 | |[ecaresnet50t.a2_in1k](https://huggingface.co/timm/ecaresnet50t.a2_in1k)|288 |81.65|95.54|25.6 |7.1 |19.6 |1703 | |[ecaresnet50d.miil_in1k](https://huggingface.co/timm/ecaresnet50d.miil_in1k)|288 |81.64|95.88|25.6 |7.2 |19.7 |1694 | |[resnext101_32x8d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext101_32x8d.fb_ssl_yfcc100m_ft_in1k)|224 |81.62|96.04|88.8 |16.5 |31.2 |1101 | |[wide_resnet50_2.tv2_in1k](https://huggingface.co/timm/wide_resnet50_2.tv2_in1k)|224 |81.61|95.76|68.9 |11.4 |14.4 |1930 | |[resnetaa50.a1h_in1k](https://huggingface.co/timm/resnetaa50.a1h_in1k)|288 |81.61|95.83|25.6 |8.5 |19.2 |1868 | |[resnet101.a1_in1k](https://huggingface.co/timm/resnet101.a1_in1k)|224 |81.5 |95.16|44.6 |7.8 |16.2 |2125 | |[resnext50_32x4d.a1_in1k](https://huggingface.co/timm/resnext50_32x4d.a1_in1k)|288 |81.48|95.16|25.0 |7.0 |23.8 |1745 | |[gcresnet50t.ra2_in1k](https://huggingface.co/timm/gcresnet50t.ra2_in1k)|288 |81.47|95.71|25.9 |6.9 |18.6 |2071 | |[wide_resnet50_2.racm_in1k](https://huggingface.co/timm/wide_resnet50_2.racm_in1k)|224 |81.45|95.53|68.9 |11.4 |14.4 |1929 | |[resnet50d.a1_in1k](https://huggingface.co/timm/resnet50d.a1_in1k)|288 |81.44|95.22|25.6 |7.2 |19.7 |1908 | |[ecaresnet50t.ra2_in1k](https://huggingface.co/timm/ecaresnet50t.ra2_in1k)|256 |81.44|95.67|25.6 |5.6 |15.4 |2168 | |[ecaresnetlight.miil_in1k](https://huggingface.co/timm/ecaresnetlight.miil_in1k)|288 |81.4 |95.82|30.2 |6.8 |13.9 |2132 | |[resnet50d.ra2_in1k](https://huggingface.co/timm/resnet50d.ra2_in1k)|288 |81.37|95.74|25.6 |7.2 |19.7 |1910 | |[resnet101.a2_in1k](https://huggingface.co/timm/resnet101.a2_in1k)|224 |81.32|95.19|44.6 |7.8 |16.2 |2125 | |[seresnet50.ra2_in1k](https://huggingface.co/timm/seresnet50.ra2_in1k)|288 |81.3 |95.65|28.1 |6.8 |18.4 |1803 | |[resnext50_32x4d.a2_in1k](https://huggingface.co/timm/resnext50_32x4d.a2_in1k)|288 |81.3 |95.11|25.0 |7.0 |23.8 |1746 | |[seresnext50_32x4d.racm_in1k](https://huggingface.co/timm/seresnext50_32x4d.racm_in1k)|224 |81.27|95.62|27.6 |4.3 |14.4 |2591 | |[ecaresnet50t.a1_in1k](https://huggingface.co/timm/ecaresnet50t.a1_in1k)|224 |81.26|95.16|25.6 |4.3 |11.8 |2823 | |[gcresnext50ts.ch_in1k](https://huggingface.co/timm/gcresnext50ts.ch_in1k)|288 |81.23|95.54|15.7 |4.8 |19.6 |2117 | |[senet154.gluon_in1k](https://huggingface.co/timm/senet154.gluon_in1k)|224 |81.23|95.35|115.1 |20.8 |38.7 |545 | |[resnet50.a1_in1k](https://huggingface.co/timm/resnet50.a1_in1k)|288 |81.22|95.11|25.6 |6.8 |18.4 |2089 | |[resnet50_gn.a1h_in1k](https://huggingface.co/timm/resnet50_gn.a1h_in1k)|288 |81.22|95.63|25.6 |6.8 |18.4 |676 | |[resnet50d.a2_in1k](https://huggingface.co/timm/resnet50d.a2_in1k)|288 |81.18|95.09|25.6 |7.2 |19.7 |1908 | |[resnet50.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnet50.fb_swsl_ig1b_ft_in1k)|224 |81.18|95.98|25.6 |4.1 |11.1 |3455 | |[resnext50_32x4d.tv2_in1k](https://huggingface.co/timm/resnext50_32x4d.tv2_in1k)|224 |81.17|95.34|25.0 |4.3 |14.4 |2933 | |[resnext50_32x4d.a1h_in1k](https://huggingface.co/timm/resnext50_32x4d.a1h_in1k)|224 |81.1 |95.33|25.0 |4.3 |14.4 |2934 | |[seresnet50.a2_in1k](https://huggingface.co/timm/seresnet50.a2_in1k)|288 |81.1 |95.23|28.1 |6.8 |18.4 |1801 | |[seresnet50.a1_in1k](https://huggingface.co/timm/seresnet50.a1_in1k)|288 |81.1 |95.12|28.1 |6.8 |18.4 |1799 | |[resnet152s.gluon_in1k](https://huggingface.co/timm/resnet152s.gluon_in1k)|224 |81.02|95.41|60.3 |12.9 |25.0 |1347 | |[resnet50.d_in1k](https://huggingface.co/timm/resnet50.d_in1k)|288 |80.97|95.44|25.6 |6.8 |18.4 |2085 | |[gcresnet50t.ra2_in1k](https://huggingface.co/timm/gcresnet50t.ra2_in1k)|256 |80.94|95.45|25.9 |5.4 |14.7 |2571 | |[resnext101_32x4d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext101_32x4d.fb_ssl_yfcc100m_ft_in1k)|224 |80.93|95.73|44.2 |8.0 |21.2 |1814 | |[resnet50.c1_in1k](https://huggingface.co/timm/resnet50.c1_in1k)|288 |80.91|95.55|25.6 |6.8 |18.4 |2084 | |[seresnext101_32x4d.gluon_in1k](https://huggingface.co/timm/seresnext101_32x4d.gluon_in1k)|224 |80.9 |95.31|49.0 |8.0 |21.3 |1585 | |[seresnext101_64x4d.gluon_in1k](https://huggingface.co/timm/seresnext101_64x4d.gluon_in1k)|224 |80.9 |95.3 |88.2 |15.5 |31.2 |918 | |[resnet50.c2_in1k](https://huggingface.co/timm/resnet50.c2_in1k)|288 |80.86|95.52|25.6 |6.8 |18.4 |2085 | |[resnet50.tv2_in1k](https://huggingface.co/timm/resnet50.tv2_in1k)|224 |80.85|95.43|25.6 |4.1 |11.1 |3450 | |[ecaresnet50t.a2_in1k](https://huggingface.co/timm/ecaresnet50t.a2_in1k)|224 |80.84|95.02|25.6 |4.3 |11.8 |2821 | |[ecaresnet101d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet101d_pruned.miil_in1k)|224 |80.79|95.62|24.9 |3.5 |7.7 |2961 | |[seresnet33ts.ra2_in1k](https://huggingface.co/timm/seresnet33ts.ra2_in1k)|288 |80.79|95.36|19.8 |6.0 |14.8 |2506 | |[ecaresnet50d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet50d_pruned.miil_in1k)|288 |80.79|95.58|19.9 |4.2 |10.6 |2349 | |[resnet50.a2_in1k](https://huggingface.co/timm/resnet50.a2_in1k)|288 |80.78|94.99|25.6 |6.8 |18.4 |2088 | |[resnet50.b1k_in1k](https://huggingface.co/timm/resnet50.b1k_in1k)|288 |80.71|95.43|25.6 |6.8 |18.4 |2087 | |[resnext50_32x4d.ra_in1k](https://huggingface.co/timm/resnext50_32x4d.ra_in1k)|288 |80.7 |95.39|25.0 |7.0 |23.8 |1749 | |[resnetrs101.tf_in1k](https://huggingface.co/timm/resnetrs101.tf_in1k)|192 |80.69|95.24|63.6 |6.0 |12.7 |2270 | |[resnet50d.a1_in1k](https://huggingface.co/timm/resnet50d.a1_in1k)|224 |80.68|94.71|25.6 |4.4 |11.9 |3162 | |[eca_resnet33ts.ra2_in1k](https://huggingface.co/timm/eca_resnet33ts.ra2_in1k)|288 |80.68|95.36|19.7 |6.0 |14.8 |2637 | |[resnet50.a1h_in1k](https://huggingface.co/timm/resnet50.a1h_in1k)|224 |80.67|95.3 |25.6 |4.1 |11.1 |3452 | |[resnext50d_32x4d.bt_in1k](https://huggingface.co/timm/resnext50d_32x4d.bt_in1k)|288 |80.67|95.42|25.0 |7.4 |25.1 |1626 | |[resnetaa50.a1h_in1k](https://huggingface.co/timm/resnetaa50.a1h_in1k)|224 |80.63|95.21|25.6 |5.2 |11.6 |3034 | |[ecaresnet50d.miil_in1k](https://huggingface.co/timm/ecaresnet50d.miil_in1k)|224 |80.61|95.32|25.6 |4.4 |11.9 |2813 | |[resnext101_64x4d.gluon_in1k](https://huggingface.co/timm/resnext101_64x4d.gluon_in1k)|224 |80.61|94.99|83.5 |15.5 |31.2 |989 | |[gcresnet33ts.ra2_in1k](https://huggingface.co/timm/gcresnet33ts.ra2_in1k)|288 |80.6 |95.31|19.9 |6.0 |14.8 |2578 | |[gcresnext50ts.ch_in1k](https://huggingface.co/timm/gcresnext50ts.ch_in1k)|256 |80.57|95.17|15.7 |3.8 |15.5 |2710 | |[resnet152.a3_in1k](https://huggingface.co/timm/resnet152.a3_in1k)|224 |80.56|95.0 |60.2 |11.6 |22.6 |1483 | |[resnet50d.ra2_in1k](https://huggingface.co/timm/resnet50d.ra2_in1k)|224 |80.53|95.16|25.6 |4.4 |11.9 |3164 | |[resnext50_32x4d.a1_in1k](https://huggingface.co/timm/resnext50_32x4d.a1_in1k)|224 |80.53|94.46|25.0 |4.3 |14.4 |2930 | |[wide_resnet101_2.tv2_in1k](https://huggingface.co/timm/wide_resnet101_2.tv2_in1k)|176 |80.48|94.98|126.9 |14.3 |13.2 |1719 | |[resnet152d.gluon_in1k](https://huggingface.co/timm/resnet152d.gluon_in1k)|224 |80.47|95.2 |60.2 |11.8 |23.4 |1428 | |[resnet50.b2k_in1k](https://huggingface.co/timm/resnet50.b2k_in1k)|288 |80.45|95.32|25.6 |6.8 |18.4 |2086 | |[ecaresnetlight.miil_in1k](https://huggingface.co/timm/ecaresnetlight.miil_in1k)|224 |80.45|95.24|30.2 |4.1 |8.4 |3530 | |[resnext50_32x4d.a2_in1k](https://huggingface.co/timm/resnext50_32x4d.a2_in1k)|224 |80.45|94.63|25.0 |4.3 |14.4 |2936 | |[wide_resnet50_2.tv2_in1k](https://huggingface.co/timm/wide_resnet50_2.tv2_in1k)|176 |80.43|95.09|68.9 |7.3 |9.0 |3015 | |[resnet101d.gluon_in1k](https://huggingface.co/timm/resnet101d.gluon_in1k)|224 |80.42|95.01|44.6 |8.1 |17.0 |2007 | |[resnet50.a1_in1k](https://huggingface.co/timm/resnet50.a1_in1k)|224 |80.38|94.6 |25.6 |4.1 |11.1 |3461 | |[seresnet33ts.ra2_in1k](https://huggingface.co/timm/seresnet33ts.ra2_in1k)|256 |80.36|95.1 |19.8 |4.8 |11.7 |3267 | |[resnext101_32x4d.gluon_in1k](https://huggingface.co/timm/resnext101_32x4d.gluon_in1k)|224 |80.34|94.93|44.2 |8.0 |21.2 |1814 | |[resnext50_32x4d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext50_32x4d.fb_ssl_yfcc100m_ft_in1k)|224 |80.32|95.4 |25.0 |4.3 |14.4 |2941 | |[resnet101s.gluon_in1k](https://huggingface.co/timm/resnet101s.gluon_in1k)|224 |80.28|95.16|44.7 |9.2 |18.6 |1851 | |[seresnet50.ra2_in1k](https://huggingface.co/timm/seresnet50.ra2_in1k)|224 |80.26|95.08|28.1 |4.1 |11.1 |2972 | |[resnetblur50.bt_in1k](https://huggingface.co/timm/resnetblur50.bt_in1k)|288 |80.24|95.24|25.6 |8.5 |19.9 |1523 | |[resnet50d.a2_in1k](https://huggingface.co/timm/resnet50d.a2_in1k)|224 |80.22|94.63|25.6 |4.4 |11.9 |3162 | |[resnet152.tv2_in1k](https://huggingface.co/timm/resnet152.tv2_in1k)|176 |80.2 |94.64|60.2 |7.2 |14.0 |2346 | |[seresnet50.a2_in1k](https://huggingface.co/timm/seresnet50.a2_in1k)|224 |80.08|94.74|28.1 |4.1 |11.1 |2969 | |[eca_resnet33ts.ra2_in1k](https://huggingface.co/timm/eca_resnet33ts.ra2_in1k)|256 |80.08|94.97|19.7 |4.8 |11.7 |3284 | |[gcresnet33ts.ra2_in1k](https://huggingface.co/timm/gcresnet33ts.ra2_in1k)|256 |80.06|94.99|19.9 |4.8 |11.7 |3216 | |[resnet50_gn.a1h_in1k](https://huggingface.co/timm/resnet50_gn.a1h_in1k)|224 |80.06|94.95|25.6 |4.1 |11.1 |1109 | |[seresnet50.a1_in1k](https://huggingface.co/timm/seresnet50.a1_in1k)|224 |80.02|94.71|28.1 |4.1 |11.1 |2962 | |[resnet50.ram_in1k](https://huggingface.co/timm/resnet50.ram_in1k)|288 |79.97|95.05|25.6 |6.8 |18.4 |2086 | |[resnet152c.gluon_in1k](https://huggingface.co/timm/resnet152c.gluon_in1k)|224 |79.92|94.84|60.2 |11.8 |23.4 |1455 | |[seresnext50_32x4d.gluon_in1k](https://huggingface.co/timm/seresnext50_32x4d.gluon_in1k)|224 |79.91|94.82|27.6 |4.3 |14.4 |2591 | |[resnet50.d_in1k](https://huggingface.co/timm/resnet50.d_in1k)|224 |79.91|94.67|25.6 |4.1 |11.1 |3456 | |[resnet101.tv2_in1k](https://huggingface.co/timm/resnet101.tv2_in1k)|176 |79.9 |94.6 |44.6 |4.9 |10.1 |3341 | |[resnetrs50.tf_in1k](https://huggingface.co/timm/resnetrs50.tf_in1k)|224 |79.89|94.97|35.7 |4.5 |12.1 |2774 | |[resnet50.c2_in1k](https://huggingface.co/timm/resnet50.c2_in1k)|224 |79.88|94.87|25.6 |4.1 |11.1 |3455 | |[ecaresnet26t.ra2_in1k](https://huggingface.co/timm/ecaresnet26t.ra2_in1k)|320 |79.86|95.07|16.0 |5.2 |16.4 |2168 | |[resnet50.a2_in1k](https://huggingface.co/timm/resnet50.a2_in1k)|224 |79.85|94.56|25.6 |4.1 |11.1 |3460 | |[resnet50.ra_in1k](https://huggingface.co/timm/resnet50.ra_in1k)|288 |79.83|94.97|25.6 |6.8 |18.4 |2087 | |[resnet101.a3_in1k](https://huggingface.co/timm/resnet101.a3_in1k)|224 |79.82|94.62|44.6 |7.8 |16.2 |2114 | |[resnext50_32x4d.ra_in1k](https://huggingface.co/timm/resnext50_32x4d.ra_in1k)|224 |79.76|94.6 |25.0 |4.3 |14.4 |2943 | |[resnet50.c1_in1k](https://huggingface.co/timm/resnet50.c1_in1k)|224 |79.74|94.95|25.6 |4.1 |11.1 |3455 | |[ecaresnet50d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet50d_pruned.miil_in1k)|224 |79.74|94.87|19.9 |2.5 |6.4 |3929 | |[resnet33ts.ra2_in1k](https://huggingface.co/timm/resnet33ts.ra2_in1k)|288 |79.71|94.83|19.7 |6.0 |14.8 |2710 | |[resnet152.gluon_in1k](https://huggingface.co/timm/resnet152.gluon_in1k)|224 |79.68|94.74|60.2 |11.6 |22.6 |1486 | |[resnext50d_32x4d.bt_in1k](https://huggingface.co/timm/resnext50d_32x4d.bt_in1k)|224 |79.67|94.87|25.0 |4.5 |15.2 |2729 | |[resnet50.bt_in1k](https://huggingface.co/timm/resnet50.bt_in1k)|288 |79.63|94.91|25.6 |6.8 |18.4 |2086 | |[ecaresnet50t.a3_in1k](https://huggingface.co/timm/ecaresnet50t.a3_in1k)|224 |79.56|94.72|25.6 |4.3 |11.8 |2805 | |[resnet101c.gluon_in1k](https://huggingface.co/timm/resnet101c.gluon_in1k)|224 |79.53|94.58|44.6 |8.1 |17.0 |2062 | |[resnet50.b1k_in1k](https://huggingface.co/timm/resnet50.b1k_in1k)|224 |79.52|94.61|25.6 |4.1 |11.1 |3459 | |[resnet50.tv2_in1k](https://huggingface.co/timm/resnet50.tv2_in1k)|176 |79.42|94.64|25.6 |2.6 |6.9 |5397 | |[resnet32ts.ra2_in1k](https://huggingface.co/timm/resnet32ts.ra2_in1k)|288 |79.4 |94.66|18.0 |5.9 |14.6 |2752 | |[resnet50.b2k_in1k](https://huggingface.co/timm/resnet50.b2k_in1k)|224 |79.38|94.57|25.6 |4.1 |11.1 |3459 | |[resnext50_32x4d.tv2_in1k](https://huggingface.co/timm/resnext50_32x4d.tv2_in1k)|176 |79.37|94.3 |25.0 |2.7 |9.0 |4577 | |[resnext50_32x4d.gluon_in1k](https://huggingface.co/timm/resnext50_32x4d.gluon_in1k)|224 |79.36|94.43|25.0 |4.3 |14.4 |2942 | |[resnext101_32x8d.tv_in1k](https://huggingface.co/timm/resnext101_32x8d.tv_in1k)|224 |79.31|94.52|88.8 |16.5 |31.2 |1100 | |[resnet101.gluon_in1k](https://huggingface.co/timm/resnet101.gluon_in1k)|224 |79.31|94.53|44.6 |7.8 |16.2 |2125 | |[resnetblur50.bt_in1k](https://huggingface.co/timm/resnetblur50.bt_in1k)|224 |79.31|94.63|25.6 |5.2 |12.0 |2524 | |[resnet50.a1h_in1k](https://huggingface.co/timm/resnet50.a1h_in1k)|176 |79.27|94.49|25.6 |2.6 |6.9 |5404 | |[resnext50_32x4d.a3_in1k](https://huggingface.co/timm/resnext50_32x4d.a3_in1k)|224 |79.25|94.31|25.0 |4.3 |14.4 |2931 | |[resnet50.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnet50.fb_ssl_yfcc100m_ft_in1k)|224 |79.22|94.84|25.6 |4.1 |11.1 |3451 | |[resnet33ts.ra2_in1k](https://huggingface.co/timm/resnet33ts.ra2_in1k)|256 |79.21|94.56|19.7 |4.8 |11.7 |3392 | |[resnet50d.gluon_in1k](https://huggingface.co/timm/resnet50d.gluon_in1k)|224 |79.07|94.48|25.6 |4.4 |11.9 |3162 | |[resnet50.ram_in1k](https://huggingface.co/timm/resnet50.ram_in1k)|224 |79.03|94.38|25.6 |4.1 |11.1 |3453 | |[resnet50.am_in1k](https://huggingface.co/timm/resnet50.am_in1k)|224 |79.01|94.39|25.6 |4.1 |11.1 |3461 | |[resnet32ts.ra2_in1k](https://huggingface.co/timm/resnet32ts.ra2_in1k)|256 |79.01|94.37|18.0 |4.6 |11.6 |3440 | |[ecaresnet26t.ra2_in1k](https://huggingface.co/timm/ecaresnet26t.ra2_in1k)|256 |78.9 |94.54|16.0 |3.4 |10.5 |3421 | |[resnet152.a3_in1k](https://huggingface.co/timm/resnet152.a3_in1k)|160 |78.89|94.11|60.2 |5.9 |11.5 |2745 | |[wide_resnet101_2.tv_in1k](https://huggingface.co/timm/wide_resnet101_2.tv_in1k)|224 |78.84|94.28|126.9 |22.8 |21.2 |1079 | |[seresnext26d_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26d_32x4d.bt_in1k)|288 |78.83|94.24|16.8 |4.5 |16.8 |2251 | |[resnet50.ra_in1k](https://huggingface.co/timm/resnet50.ra_in1k)|224 |78.81|94.32|25.6 |4.1 |11.1 |3454 | |[seresnext26t_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26t_32x4d.bt_in1k)|288 |78.74|94.33|16.8 |4.5 |16.7 |2264 | |[resnet50s.gluon_in1k](https://huggingface.co/timm/resnet50s.gluon_in1k)|224 |78.72|94.23|25.7 |5.5 |13.5 |2796 | |[resnet50d.a3_in1k](https://huggingface.co/timm/resnet50d.a3_in1k)|224 |78.71|94.24|25.6 |4.4 |11.9 |3154 | |[wide_resnet50_2.tv_in1k](https://huggingface.co/timm/wide_resnet50_2.tv_in1k)|224 |78.47|94.09|68.9 |11.4 |14.4 |1934 | |[resnet50.bt_in1k](https://huggingface.co/timm/resnet50.bt_in1k)|224 |78.46|94.27|25.6 |4.1 |11.1 |3454 | |[resnet34d.ra2_in1k](https://huggingface.co/timm/resnet34d.ra2_in1k)|288 |78.43|94.35|21.8 |6.5 |7.5 |3291 | |[gcresnext26ts.ch_in1k](https://huggingface.co/timm/gcresnext26ts.ch_in1k)|288 |78.42|94.04|10.5 |3.1 |13.3 |3226 | |[resnet26t.ra2_in1k](https://huggingface.co/timm/resnet26t.ra2_in1k)|320 |78.33|94.13|16.0 |5.2 |16.4 |2391 | |[resnet152.tv_in1k](https://huggingface.co/timm/resnet152.tv_in1k)|224 |78.32|94.04|60.2 |11.6 |22.6 |1487 | |[seresnext26ts.ch_in1k](https://huggingface.co/timm/seresnext26ts.ch_in1k)|288 |78.28|94.1 |10.4 |3.1 |13.3 |3062 | |[bat_resnext26ts.ch_in1k](https://huggingface.co/timm/bat_resnext26ts.ch_in1k)|256 |78.25|94.1 |10.7 |2.5 |12.5 |3393 | |[resnet50.a3_in1k](https://huggingface.co/timm/resnet50.a3_in1k)|224 |78.06|93.78|25.6 |4.1 |11.1 |3450 | |[resnet50c.gluon_in1k](https://huggingface.co/timm/resnet50c.gluon_in1k)|224 |78.0 |93.99|25.6 |4.4 |11.9 |3286 | |[eca_resnext26ts.ch_in1k](https://huggingface.co/timm/eca_resnext26ts.ch_in1k)|288 |78.0 |93.91|10.3 |3.1 |13.3 |3297 | |[seresnext26t_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26t_32x4d.bt_in1k)|224 |77.98|93.75|16.8 |2.7 |10.1 |3841 | |[resnet34.a1_in1k](https://huggingface.co/timm/resnet34.a1_in1k)|288 |77.92|93.77|21.8 |6.1 |6.2 |3609 | |[resnet101.a3_in1k](https://huggingface.co/timm/resnet101.a3_in1k)|160 |77.88|93.71|44.6 |4.0 |8.3 |3926 | |[resnet26t.ra2_in1k](https://huggingface.co/timm/resnet26t.ra2_in1k)|256 |77.87|93.84|16.0 |3.4 |10.5 |3772 | |[seresnext26ts.ch_in1k](https://huggingface.co/timm/seresnext26ts.ch_in1k)|256 |77.86|93.79|10.4 |2.4 |10.5 |4263 | |[resnetrs50.tf_in1k](https://huggingface.co/timm/resnetrs50.tf_in1k)|160 |77.82|93.81|35.7 |2.3 |6.2 |5238 | |[gcresnext26ts.ch_in1k](https://huggingface.co/timm/gcresnext26ts.ch_in1k)|256 |77.81|93.82|10.5 |2.4 |10.5 |4183 | |[ecaresnet50t.a3_in1k](https://huggingface.co/timm/ecaresnet50t.a3_in1k)|160 |77.79|93.6 |25.6 |2.2 |6.0 |5329 | |[resnext50_32x4d.a3_in1k](https://huggingface.co/timm/resnext50_32x4d.a3_in1k)|160 |77.73|93.32|25.0 |2.2 |7.4 |5576 | |[resnext50_32x4d.tv_in1k](https://huggingface.co/timm/resnext50_32x4d.tv_in1k)|224 |77.61|93.7 |25.0 |4.3 |14.4 |2944 | |[seresnext26d_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26d_32x4d.bt_in1k)|224 |77.59|93.61|16.8 |2.7 |10.2 |3807 | |[resnet50.gluon_in1k](https://huggingface.co/timm/resnet50.gluon_in1k)|224 |77.58|93.72|25.6 |4.1 |11.1 |3455 | |[eca_resnext26ts.ch_in1k](https://huggingface.co/timm/eca_resnext26ts.ch_in1k)|256 |77.44|93.56|10.3 |2.4 |10.5 |4284 | |[resnet26d.bt_in1k](https://huggingface.co/timm/resnet26d.bt_in1k)|288 |77.41|93.63|16.0 |4.3 |13.5 |2907 | |[resnet101.tv_in1k](https://huggingface.co/timm/resnet101.tv_in1k)|224 |77.38|93.54|44.6 |7.8 |16.2 |2125 | |[resnet50d.a3_in1k](https://huggingface.co/timm/resnet50d.a3_in1k)|160 |77.22|93.27|25.6 |2.2 |6.1 |5982 | |[resnext26ts.ra2_in1k](https://huggingface.co/timm/resnext26ts.ra2_in1k)|288 |77.17|93.47|10.3 |3.1 |13.3 |3392 | |[resnet34.a2_in1k](https://huggingface.co/timm/resnet34.a2_in1k)|288 |77.15|93.27|21.8 |6.1 |6.2 |3615 | |[resnet34d.ra2_in1k](https://huggingface.co/timm/resnet34d.ra2_in1k)|224 |77.1 |93.37|21.8 |3.9 |4.5 |5436 | |[seresnet50.a3_in1k](https://huggingface.co/timm/seresnet50.a3_in1k)|224 |77.02|93.07|28.1 |4.1 |11.1 |2952 | |[resnext26ts.ra2_in1k](https://huggingface.co/timm/resnext26ts.ra2_in1k)|256 |76.78|93.13|10.3 |2.4 |10.5 |4410 | |[resnet26d.bt_in1k](https://huggingface.co/timm/resnet26d.bt_in1k)|224 |76.7 |93.17|16.0 |2.6 |8.2 |4859 | |[resnet34.bt_in1k](https://huggingface.co/timm/resnet34.bt_in1k)|288 |76.5 |93.35|21.8 |6.1 |6.2 |3617 | |[resnet34.a1_in1k](https://huggingface.co/timm/resnet34.a1_in1k)|224 |76.42|92.87|21.8 |3.7 |3.7 |5984 | |[resnet26.bt_in1k](https://huggingface.co/timm/resnet26.bt_in1k)|288 |76.35|93.18|16.0 |3.9 |12.2 |3331 | |[resnet50.tv_in1k](https://huggingface.co/timm/resnet50.tv_in1k)|224 |76.13|92.86|25.6 |4.1 |11.1 |3457 | |[resnet50.a3_in1k](https://huggingface.co/timm/resnet50.a3_in1k)|160 |75.96|92.5 |25.6 |2.1 |5.7 |6490 | |[resnet34.a2_in1k](https://huggingface.co/timm/resnet34.a2_in1k)|224 |75.52|92.44|21.8 |3.7 |3.7 |5991 | |[resnet26.bt_in1k](https://huggingface.co/timm/resnet26.bt_in1k)|224 |75.3 |92.58|16.0 |2.4 |7.4 |5583 | |[resnet34.bt_in1k](https://huggingface.co/timm/resnet34.bt_in1k)|224 |75.16|92.18|21.8 |3.7 |3.7 |5994 | |[seresnet50.a3_in1k](https://huggingface.co/timm/seresnet50.a3_in1k)|160 |75.1 |92.08|28.1 |2.1 |5.7 |5513 | |[resnet34.gluon_in1k](https://huggingface.co/timm/resnet34.gluon_in1k)|224 |74.57|91.98|21.8 |3.7 |3.7 |5984 | |[resnet18d.ra2_in1k](https://huggingface.co/timm/resnet18d.ra2_in1k)|288 |73.81|91.83|11.7 |3.4 |5.4 |5196 | |[resnet34.tv_in1k](https://huggingface.co/timm/resnet34.tv_in1k)|224 |73.32|91.42|21.8 |3.7 |3.7 |5979 | |[resnet18.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnet18.fb_swsl_ig1b_ft_in1k)|224 |73.28|91.73|11.7 |1.8 |2.5 |10213 | |[resnet18.a1_in1k](https://huggingface.co/timm/resnet18.a1_in1k)|288 |73.16|91.03|11.7 |3.0 |4.1 |6050 | |[resnet34.a3_in1k](https://huggingface.co/timm/resnet34.a3_in1k)|224 |72.98|91.11|21.8 |3.7 |3.7 |5967 | |[resnet18.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnet18.fb_ssl_yfcc100m_ft_in1k)|224 |72.6 |91.42|11.7 |1.8 |2.5 |10213 | |[resnet18.a2_in1k](https://huggingface.co/timm/resnet18.a2_in1k)|288 |72.37|90.59|11.7 |3.0 |4.1 |6051 | |[resnet14t.c3_in1k](https://huggingface.co/timm/resnet14t.c3_in1k)|224 |72.26|90.31|10.1 |1.7 |5.8 |7026 | |[resnet18d.ra2_in1k](https://huggingface.co/timm/resnet18d.ra2_in1k)|224 |72.26|90.68|11.7 |2.1 |3.3 |8707 | |[resnet18.a1_in1k](https://huggingface.co/timm/resnet18.a1_in1k)|224 |71.49|90.07|11.7 |1.8 |2.5 |10187 | |[resnet14t.c3_in1k](https://huggingface.co/timm/resnet14t.c3_in1k)|176 |71.31|89.69|10.1 |1.1 |3.6 |10970 | |[resnet18.gluon_in1k](https://huggingface.co/timm/resnet18.gluon_in1k)|224 |70.84|89.76|11.7 |1.8 |2.5 |10210 | |[resnet18.a2_in1k](https://huggingface.co/timm/resnet18.a2_in1k)|224 |70.64|89.47|11.7 |1.8 |2.5 |10194 | |[resnet34.a3_in1k](https://huggingface.co/timm/resnet34.a3_in1k)|160 |70.56|89.52|21.8 |1.9 |1.9 |10737 | |[resnet18.tv_in1k](https://huggingface.co/timm/resnet18.tv_in1k)|224 |69.76|89.07|11.7 |1.8 |2.5 |10205 | |[resnet10t.c3_in1k](https://huggingface.co/timm/resnet10t.c3_in1k)|224 |68.34|88.03|5.4 |1.1 |2.4 |13079 | |[resnet18.a3_in1k](https://huggingface.co/timm/resnet18.a3_in1k)|224 |68.25|88.17|11.7 |1.8 |2.5 |10167 | |[resnet10t.c3_in1k](https://huggingface.co/timm/resnet10t.c3_in1k)|176 |66.71|86.96|5.4 |0.7 |1.5 |20327 | |[resnet18.a3_in1k](https://huggingface.co/timm/resnet18.a3_in1k)|160 |65.66|86.26|11.7 |0.9 |1.3 |18229 | ## Citation ```bibtex @inproceedings{wightman2021resnet, title={ResNet strikes back: An improved training procedure in timm}, author={Wightman, Ross and Touvron, Hugo and Jegou, Herve}, booktitle={NeurIPS 2021 Workshop on ImageNet: Past, Present, and Future} } ``` ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ``` ```bibtex @article{He2015, author = {Kaiming He and Xiangyu Zhang and Shaoqing Ren and Jian Sun}, title = {Deep Residual Learning for Image Recognition}, journal = {arXiv preprint arXiv:1512.03385}, year = {2015} } ```

thenlper/gte-base

thenlper

sentence-transformers

sentence-similarity

--- tags: - mteb - sentence-similarity - sentence-transformers - Sentence Transformers model-index: - name: gte-base results: - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en) config: en split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 74.17910447761193 - type: ap value: 36.827146398068926 - type: f1 value: 68.11292888046363 - task: type: Classification dataset: type: mteb/amazon_polarity name: MTEB AmazonPolarityClassification config: default split: test revision: e2d317d38cd51312af73b3d32a06d1a08b442046 metrics: - type: accuracy value: 91.77345000000001 - type: ap value: 88.33530426691347 - type: f1 value: 91.76549906404642 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (en) config: en split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 48.964 - type: f1 value: 48.22995586184998 - task: type: Retrieval dataset: type: arguana name: MTEB ArguAna config: default split: test revision: None metrics: - type: map_at_1 value: 32.147999999999996 - type: map_at_10 value: 48.253 - type: map_at_100 value: 49.038 - type: map_at_1000 value: 49.042 - type: map_at_3 value: 43.433 - type: map_at_5 value: 46.182 - type: mrr_at_1 value: 32.717 - type: mrr_at_10 value: 48.467 - type: mrr_at_100 value: 49.252 - type: mrr_at_1000 value: 49.254999999999995 - type: mrr_at_3 value: 43.599 - type: mrr_at_5 value: 46.408 - type: ndcg_at_1 value: 32.147999999999996 - type: ndcg_at_10 value: 57.12199999999999 - type: ndcg_at_100 value: 60.316 - type: ndcg_at_1000 value: 60.402 - type: ndcg_at_3 value: 47.178 - type: ndcg_at_5 value: 52.146 - type: precision_at_1 value: 32.147999999999996 - type: precision_at_10 value: 8.542 - type: precision_at_100 value: 0.9900000000000001 - type: precision_at_1000 value: 0.1 - type: precision_at_3 value: 19.346 - type: precision_at_5 value: 14.026 - type: recall_at_1 value: 32.147999999999996 - type: recall_at_10 value: 85.42 - type: recall_at_100 value: 99.004 - type: recall_at_1000 value: 99.644 - type: recall_at_3 value: 58.037000000000006 - type: recall_at_5 value: 70.128 - task: type: Clustering dataset: type: mteb/arxiv-clustering-p2p name: MTEB ArxivClusteringP2P config: default split: test revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d metrics: - type: v_measure value: 48.59706013699614 - task: type: Clustering dataset: type: mteb/arxiv-clustering-s2s name: MTEB ArxivClusteringS2S config: default split: test revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 metrics: - type: v_measure value: 43.01463593002057 - task: type: Reranking dataset: type: mteb/askubuntudupquestions-reranking name: MTEB AskUbuntuDupQuestions config: default split: test revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 metrics: - type: map value: 61.80250355752458 - type: mrr value: 74.79455216989844 - task: type: STS dataset: type: mteb/biosses-sts name: MTEB BIOSSES config: default split: test revision: d3fb88f8f02e40887cd149695127462bbcf29b4a metrics: - type: cos_sim_pearson value: 89.87448576082345 - type: cos_sim_spearman value: 87.64235843637468 - type: euclidean_pearson value: 88.4901825511062 - type: euclidean_spearman value: 87.74537283182033 - type: manhattan_pearson value: 88.39040638362911 - type: manhattan_spearman value: 87.62669542888003 - task: type: Classification dataset: type: mteb/banking77 name: MTEB Banking77Classification config: default split: test revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 metrics: - type: accuracy value: 85.06818181818183 - type: f1 value: 85.02524460098233 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-p2p name: MTEB BiorxivClusteringP2P config: default split: test revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 metrics: - type: v_measure value: 38.20471092679967 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-s2s name: MTEB BiorxivClusteringS2S config: default split: test revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 metrics: - type: v_measure value: 36.58967592147641 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackAndroidRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 32.411 - type: map_at_10 value: 45.162 - type: map_at_100 value: 46.717 - type: map_at_1000 value: 46.836 - type: map_at_3 value: 41.428 - type: map_at_5 value: 43.54 - type: mrr_at_1 value: 39.914 - type: mrr_at_10 value: 51.534 - type: mrr_at_100 value: 52.185 - type: mrr_at_1000 value: 52.22 - type: mrr_at_3 value: 49.046 - type: mrr_at_5 value: 50.548 - type: ndcg_at_1 value: 39.914 - type: ndcg_at_10 value: 52.235 - type: ndcg_at_100 value: 57.4 - type: ndcg_at_1000 value: 58.982 - type: ndcg_at_3 value: 47.332 - type: ndcg_at_5 value: 49.62 - type: precision_at_1 value: 39.914 - type: precision_at_10 value: 10.258000000000001 - type: precision_at_100 value: 1.6219999999999999 - type: precision_at_1000 value: 0.20500000000000002 - type: precision_at_3 value: 23.462 - type: precision_at_5 value: 16.71 - type: recall_at_1 value: 32.411 - type: recall_at_10 value: 65.408 - type: recall_at_100 value: 87.248 - type: recall_at_1000 value: 96.951 - type: recall_at_3 value: 50.349999999999994 - type: recall_at_5 value: 57.431 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackEnglishRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 31.911 - type: map_at_10 value: 42.608000000000004 - type: map_at_100 value: 43.948 - type: map_at_1000 value: 44.089 - type: map_at_3 value: 39.652 - type: map_at_5 value: 41.236 - type: mrr_at_1 value: 40.064 - type: mrr_at_10 value: 48.916 - type: mrr_at_100 value: 49.539 - type: mrr_at_1000 value: 49.583 - type: mrr_at_3 value: 46.741 - type: mrr_at_5 value: 48.037 - type: ndcg_at_1 value: 40.064 - type: ndcg_at_10 value: 48.442 - type: ndcg_at_100 value: 52.798 - type: ndcg_at_1000 value: 54.871 - type: ndcg_at_3 value: 44.528 - type: ndcg_at_5 value: 46.211 - type: precision_at_1 value: 40.064 - type: precision_at_10 value: 9.178 - type: precision_at_100 value: 1.452 - type: precision_at_1000 value: 0.193 - type: precision_at_3 value: 21.614 - type: precision_at_5 value: 15.185 - type: recall_at_1 value: 31.911 - type: recall_at_10 value: 58.155 - type: recall_at_100 value: 76.46300000000001 - type: recall_at_1000 value: 89.622 - type: recall_at_3 value: 46.195 - type: recall_at_5 value: 51.288999999999994 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGamingRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 40.597 - type: map_at_10 value: 54.290000000000006 - type: map_at_100 value: 55.340999999999994 - type: map_at_1000 value: 55.388999999999996 - type: map_at_3 value: 50.931000000000004 - type: map_at_5 value: 52.839999999999996 - type: mrr_at_1 value: 46.646 - type: mrr_at_10 value: 57.524 - type: mrr_at_100 value: 58.225 - type: mrr_at_1000 value: 58.245999999999995 - type: mrr_at_3 value: 55.235 - type: mrr_at_5 value: 56.589 - type: ndcg_at_1 value: 46.646 - type: ndcg_at_10 value: 60.324999999999996 - type: ndcg_at_100 value: 64.30900000000001 - type: ndcg_at_1000 value: 65.19 - type: ndcg_at_3 value: 54.983000000000004 - type: ndcg_at_5 value: 57.621 - type: precision_at_1 value: 46.646 - type: precision_at_10 value: 9.774 - type: precision_at_100 value: 1.265 - type: precision_at_1000 value: 0.13799999999999998 - type: precision_at_3 value: 24.911 - type: precision_at_5 value: 16.977999999999998 - type: recall_at_1 value: 40.597 - type: recall_at_10 value: 74.773 - type: recall_at_100 value: 91.61200000000001 - type: recall_at_1000 value: 97.726 - type: recall_at_3 value: 60.458 - type: recall_at_5 value: 66.956 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGisRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.122 - type: map_at_10 value: 36.711 - type: map_at_100 value: 37.775 - type: map_at_1000 value: 37.842999999999996 - type: map_at_3 value: 33.693 - type: map_at_5 value: 35.607 - type: mrr_at_1 value: 29.153000000000002 - type: mrr_at_10 value: 38.873999999999995 - type: mrr_at_100 value: 39.739000000000004 - type: mrr_at_1000 value: 39.794000000000004 - type: mrr_at_3 value: 36.102000000000004 - type: mrr_at_5 value: 37.876 - type: ndcg_at_1 value: 29.153000000000002 - type: ndcg_at_10 value: 42.048 - type: ndcg_at_100 value: 47.144999999999996 - type: ndcg_at_1000 value: 48.901 - type: ndcg_at_3 value: 36.402 - type: ndcg_at_5 value: 39.562999999999995 - type: precision_at_1 value: 29.153000000000002 - type: precision_at_10 value: 6.4750000000000005 - type: precision_at_100 value: 0.951 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 15.479999999999999 - type: precision_at_5 value: 11.028 - type: recall_at_1 value: 27.122 - type: recall_at_10 value: 56.279999999999994 - type: recall_at_100 value: 79.597 - type: recall_at_1000 value: 92.804 - type: recall_at_3 value: 41.437000000000005 - type: recall_at_5 value: 49.019 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackMathematicaRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 17.757 - type: map_at_10 value: 26.739 - type: map_at_100 value: 28.015 - type: map_at_1000 value: 28.127999999999997 - type: map_at_3 value: 23.986 - type: map_at_5 value: 25.514 - type: mrr_at_1 value: 22.015 - type: mrr_at_10 value: 31.325999999999997 - type: mrr_at_100 value: 32.368 - type: mrr_at_1000 value: 32.426 - type: mrr_at_3 value: 28.897000000000002 - type: mrr_at_5 value: 30.147000000000002 - type: ndcg_at_1 value: 22.015 - type: ndcg_at_10 value: 32.225 - type: ndcg_at_100 value: 38.405 - type: ndcg_at_1000 value: 40.932 - type: ndcg_at_3 value: 27.403 - type: ndcg_at_5 value: 29.587000000000003 - type: precision_at_1 value: 22.015 - type: precision_at_10 value: 5.9830000000000005 - type: precision_at_100 value: 1.051 - type: precision_at_1000 value: 0.13899999999999998 - type: precision_at_3 value: 13.391 - type: precision_at_5 value: 9.602 - type: recall_at_1 value: 17.757 - type: recall_at_10 value: 44.467 - type: recall_at_100 value: 71.53699999999999 - type: recall_at_1000 value: 89.281 - type: recall_at_3 value: 31.095 - type: recall_at_5 value: 36.818 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackPhysicsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 30.354 - type: map_at_10 value: 42.134 - type: map_at_100 value: 43.429 - type: map_at_1000 value: 43.532 - type: map_at_3 value: 38.491 - type: map_at_5 value: 40.736 - type: mrr_at_1 value: 37.247 - type: mrr_at_10 value: 47.775 - type: mrr_at_100 value: 48.522999999999996 - type: mrr_at_1000 value: 48.567 - type: mrr_at_3 value: 45.059 - type: mrr_at_5 value: 46.811 - type: ndcg_at_1 value: 37.247 - type: ndcg_at_10 value: 48.609 - type: ndcg_at_100 value: 53.782 - type: ndcg_at_1000 value: 55.666000000000004 - type: ndcg_at_3 value: 42.866 - type: ndcg_at_5 value: 46.001 - type: precision_at_1 value: 37.247 - type: precision_at_10 value: 8.892999999999999 - type: precision_at_100 value: 1.341 - type: precision_at_1000 value: 0.168 - type: precision_at_3 value: 20.5 - type: precision_at_5 value: 14.976 - type: recall_at_1 value: 30.354 - type: recall_at_10 value: 62.273 - type: recall_at_100 value: 83.65599999999999 - type: recall_at_1000 value: 95.82000000000001 - type: recall_at_3 value: 46.464 - type: recall_at_5 value: 54.225 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackProgrammersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 26.949 - type: map_at_10 value: 37.230000000000004 - type: map_at_100 value: 38.644 - type: map_at_1000 value: 38.751999999999995 - type: map_at_3 value: 33.816 - type: map_at_5 value: 35.817 - type: mrr_at_1 value: 33.446999999999996 - type: mrr_at_10 value: 42.970000000000006 - type: mrr_at_100 value: 43.873 - type: mrr_at_1000 value: 43.922 - type: mrr_at_3 value: 40.467999999999996 - type: mrr_at_5 value: 41.861 - type: ndcg_at_1 value: 33.446999999999996 - type: ndcg_at_10 value: 43.403000000000006 - type: ndcg_at_100 value: 49.247 - type: ndcg_at_1000 value: 51.361999999999995 - type: ndcg_at_3 value: 38.155 - type: ndcg_at_5 value: 40.643 - type: precision_at_1 value: 33.446999999999996 - type: precision_at_10 value: 8.128 - type: precision_at_100 value: 1.274 - type: precision_at_1000 value: 0.163 - type: precision_at_3 value: 18.493000000000002 - type: precision_at_5 value: 13.333 - type: recall_at_1 value: 26.949 - type: recall_at_10 value: 56.006 - type: recall_at_100 value: 80.99199999999999 - type: recall_at_1000 value: 95.074 - type: recall_at_3 value: 40.809 - type: recall_at_5 value: 47.57 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.243583333333333 - type: map_at_10 value: 37.193250000000006 - type: map_at_100 value: 38.44833333333334 - type: map_at_1000 value: 38.56083333333333 - type: map_at_3 value: 34.06633333333333 - type: map_at_5 value: 35.87858333333334 - type: mrr_at_1 value: 32.291583333333335 - type: mrr_at_10 value: 41.482749999999996 - type: mrr_at_100 value: 42.33583333333333 - type: mrr_at_1000 value: 42.38683333333333 - type: mrr_at_3 value: 38.952999999999996 - type: mrr_at_5 value: 40.45333333333333 - type: ndcg_at_1 value: 32.291583333333335 - type: ndcg_at_10 value: 42.90533333333334 - type: ndcg_at_100 value: 48.138666666666666 - type: ndcg_at_1000 value: 50.229083333333335 - type: ndcg_at_3 value: 37.76133333333334 - type: ndcg_at_5 value: 40.31033333333334 - type: precision_at_1 value: 32.291583333333335 - type: precision_at_10 value: 7.585583333333333 - type: precision_at_100 value: 1.2045000000000001 - type: precision_at_1000 value: 0.15733333333333335 - type: precision_at_3 value: 17.485416666666666 - type: precision_at_5 value: 12.5145 - type: recall_at_1 value: 27.243583333333333 - type: recall_at_10 value: 55.45108333333334 - type: recall_at_100 value: 78.25858333333335 - type: recall_at_1000 value: 92.61716666666665 - type: recall_at_3 value: 41.130583333333334 - type: recall_at_5 value: 47.73133333333334 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackStatsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 26.325 - type: map_at_10 value: 32.795 - type: map_at_100 value: 33.96 - type: map_at_1000 value: 34.054 - type: map_at_3 value: 30.64 - type: map_at_5 value: 31.771 - type: mrr_at_1 value: 29.908 - type: mrr_at_10 value: 35.83 - type: mrr_at_100 value: 36.868 - type: mrr_at_1000 value: 36.928 - type: mrr_at_3 value: 33.896 - type: mrr_at_5 value: 34.893 - type: ndcg_at_1 value: 29.908 - type: ndcg_at_10 value: 36.746 - type: ndcg_at_100 value: 42.225 - type: ndcg_at_1000 value: 44.523 - type: ndcg_at_3 value: 32.82 - type: ndcg_at_5 value: 34.583000000000006 - type: precision_at_1 value: 29.908 - type: precision_at_10 value: 5.6129999999999995 - type: precision_at_100 value: 0.9079999999999999 - type: precision_at_1000 value: 0.11800000000000001 - type: precision_at_3 value: 13.753000000000002 - type: precision_at_5 value: 9.417 - type: recall_at_1 value: 26.325 - type: recall_at_10 value: 45.975 - type: recall_at_100 value: 70.393 - type: recall_at_1000 value: 87.217 - type: recall_at_3 value: 35.195 - type: recall_at_5 value: 39.69 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackTexRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 17.828 - type: map_at_10 value: 25.759 - type: map_at_100 value: 26.961000000000002 - type: map_at_1000 value: 27.094 - type: map_at_3 value: 23.166999999999998 - type: map_at_5 value: 24.610000000000003 - type: mrr_at_1 value: 21.61 - type: mrr_at_10 value: 29.605999999999998 - type: mrr_at_100 value: 30.586000000000002 - type: mrr_at_1000 value: 30.664 - type: mrr_at_3 value: 27.214 - type: mrr_at_5 value: 28.571 - type: ndcg_at_1 value: 21.61 - type: ndcg_at_10 value: 30.740000000000002 - type: ndcg_at_100 value: 36.332 - type: ndcg_at_1000 value: 39.296 - type: ndcg_at_3 value: 26.11 - type: ndcg_at_5 value: 28.297 - type: precision_at_1 value: 21.61 - type: precision_at_10 value: 5.643 - type: precision_at_100 value: 1.0 - type: precision_at_1000 value: 0.14400000000000002 - type: precision_at_3 value: 12.4 - type: precision_at_5 value: 9.119 - type: recall_at_1 value: 17.828 - type: recall_at_10 value: 41.876000000000005 - type: recall_at_100 value: 66.648 - type: recall_at_1000 value: 87.763 - type: recall_at_3 value: 28.957 - type: recall_at_5 value: 34.494 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackUnixRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.921000000000003 - type: map_at_10 value: 37.156 - type: map_at_100 value: 38.399 - type: map_at_1000 value: 38.498 - type: map_at_3 value: 34.134 - type: map_at_5 value: 35.936 - type: mrr_at_1 value: 32.649 - type: mrr_at_10 value: 41.19 - type: mrr_at_100 value: 42.102000000000004 - type: mrr_at_1000 value: 42.157 - type: mrr_at_3 value: 38.464 - type: mrr_at_5 value: 40.148 - type: ndcg_at_1 value: 32.649 - type: ndcg_at_10 value: 42.679 - type: ndcg_at_100 value: 48.27 - type: ndcg_at_1000 value: 50.312 - type: ndcg_at_3 value: 37.269000000000005 - type: ndcg_at_5 value: 40.055 - type: precision_at_1 value: 32.649 - type: precision_at_10 value: 7.155 - type: precision_at_100 value: 1.124 - type: precision_at_1000 value: 0.14100000000000001 - type: precision_at_3 value: 16.791 - type: precision_at_5 value: 12.015 - type: recall_at_1 value: 27.921000000000003 - type: recall_at_10 value: 55.357 - type: recall_at_100 value: 79.476 - type: recall_at_1000 value: 93.314 - type: recall_at_3 value: 40.891 - type: recall_at_5 value: 47.851 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWebmastersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 25.524 - type: map_at_10 value: 35.135 - type: map_at_100 value: 36.665 - type: map_at_1000 value: 36.886 - type: map_at_3 value: 31.367 - type: map_at_5 value: 33.724 - type: mrr_at_1 value: 30.631999999999998 - type: mrr_at_10 value: 39.616 - type: mrr_at_100 value: 40.54 - type: mrr_at_1000 value: 40.585 - type: mrr_at_3 value: 36.462 - type: mrr_at_5 value: 38.507999999999996 - type: ndcg_at_1 value: 30.631999999999998 - type: ndcg_at_10 value: 41.61 - type: ndcg_at_100 value: 47.249 - type: ndcg_at_1000 value: 49.662 - type: ndcg_at_3 value: 35.421 - type: ndcg_at_5 value: 38.811 - type: precision_at_1 value: 30.631999999999998 - type: precision_at_10 value: 8.123 - type: precision_at_100 value: 1.5810000000000002 - type: precision_at_1000 value: 0.245 - type: precision_at_3 value: 16.337 - type: precision_at_5 value: 12.568999999999999 - type: recall_at_1 value: 25.524 - type: recall_at_10 value: 54.994 - type: recall_at_100 value: 80.03099999999999 - type: recall_at_1000 value: 95.25099999999999 - type: recall_at_3 value: 37.563 - type: recall_at_5 value: 46.428999999999995 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWordpressRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 22.224 - type: map_at_10 value: 30.599999999999998 - type: map_at_100 value: 31.526 - type: map_at_1000 value: 31.629 - type: map_at_3 value: 27.491 - type: map_at_5 value: 29.212 - type: mrr_at_1 value: 24.214 - type: mrr_at_10 value: 32.632 - type: mrr_at_100 value: 33.482 - type: mrr_at_1000 value: 33.550000000000004 - type: mrr_at_3 value: 29.852 - type: mrr_at_5 value: 31.451 - type: ndcg_at_1 value: 24.214 - type: ndcg_at_10 value: 35.802 - type: ndcg_at_100 value: 40.502 - type: ndcg_at_1000 value: 43.052 - type: ndcg_at_3 value: 29.847 - type: ndcg_at_5 value: 32.732 - type: precision_at_1 value: 24.214 - type: precision_at_10 value: 5.804 - type: precision_at_100 value: 0.885 - type: precision_at_1000 value: 0.121 - type: precision_at_3 value: 12.692999999999998 - type: precision_at_5 value: 9.242 - type: recall_at_1 value: 22.224 - type: recall_at_10 value: 49.849 - type: recall_at_100 value: 71.45 - type: recall_at_1000 value: 90.583 - type: recall_at_3 value: 34.153 - type: recall_at_5 value: 41.004000000000005 - task: type: Retrieval dataset: type: climate-fever name: MTEB ClimateFEVER config: default split: test revision: None metrics: - type: map_at_1 value: 12.386999999999999 - type: map_at_10 value: 20.182 - type: map_at_100 value: 21.86 - type: map_at_1000 value: 22.054000000000002 - type: map_at_3 value: 17.165 - type: map_at_5 value: 18.643 - type: mrr_at_1 value: 26.906000000000002 - type: mrr_at_10 value: 37.907999999999994 - type: mrr_at_100 value: 38.868 - type: mrr_at_1000 value: 38.913 - type: mrr_at_3 value: 34.853 - type: mrr_at_5 value: 36.567 - type: ndcg_at_1 value: 26.906000000000002 - type: ndcg_at_10 value: 28.103 - type: ndcg_at_100 value: 35.073 - type: ndcg_at_1000 value: 38.653 - type: ndcg_at_3 value: 23.345 - type: ndcg_at_5 value: 24.828 - type: precision_at_1 value: 26.906000000000002 - type: precision_at_10 value: 8.547 - type: precision_at_100 value: 1.617 - type: precision_at_1000 value: 0.22799999999999998 - type: precision_at_3 value: 17.025000000000002 - type: precision_at_5 value: 12.834000000000001 - type: recall_at_1 value: 12.386999999999999 - type: recall_at_10 value: 33.306999999999995 - type: recall_at_100 value: 57.516 - type: recall_at_1000 value: 77.74799999999999 - type: recall_at_3 value: 21.433 - type: recall_at_5 value: 25.915 - task: type: Retrieval dataset: type: dbpedia-entity name: MTEB DBPedia config: default split: test revision: None metrics: - type: map_at_1 value: 9.322 - type: map_at_10 value: 20.469 - type: map_at_100 value: 28.638 - type: map_at_1000 value: 30.433 - type: map_at_3 value: 14.802000000000001 - type: map_at_5 value: 17.297 - type: mrr_at_1 value: 68.75 - type: mrr_at_10 value: 76.29599999999999 - type: mrr_at_100 value: 76.62400000000001 - type: mrr_at_1000 value: 76.633 - type: mrr_at_3 value: 75.083 - type: mrr_at_5 value: 75.771 - type: ndcg_at_1 value: 54.87499999999999 - type: ndcg_at_10 value: 41.185 - type: ndcg_at_100 value: 46.400000000000006 - type: ndcg_at_1000 value: 54.223 - type: ndcg_at_3 value: 45.489000000000004 - type: ndcg_at_5 value: 43.161 - type: precision_at_1 value: 68.75 - type: precision_at_10 value: 32.300000000000004 - type: precision_at_100 value: 10.607999999999999 - type: precision_at_1000 value: 2.237 - type: precision_at_3 value: 49.083 - type: precision_at_5 value: 41.6 - type: recall_at_1 value: 9.322 - type: recall_at_10 value: 25.696 - type: recall_at_100 value: 52.898 - type: recall_at_1000 value: 77.281 - type: recall_at_3 value: 15.943 - type: recall_at_5 value: 19.836000000000002 - task: type: Classification dataset: type: mteb/emotion name: MTEB EmotionClassification config: default split: test revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 metrics: - type: accuracy value: 48.650000000000006 - type: f1 value: 43.528467245539396 - task: type: Retrieval dataset: type: fever name: MTEB FEVER config: default split: test revision: None metrics: - type: map_at_1 value: 66.56 - type: map_at_10 value: 76.767 - type: map_at_100 value: 77.054 - type: map_at_1000 value: 77.068 - type: map_at_3 value: 75.29299999999999 - type: map_at_5 value: 76.24 - type: mrr_at_1 value: 71.842 - type: mrr_at_10 value: 81.459 - type: mrr_at_100 value: 81.58800000000001 - type: mrr_at_1000 value: 81.59100000000001 - type: mrr_at_3 value: 80.188 - type: mrr_at_5 value: 81.038 - type: ndcg_at_1 value: 71.842 - type: ndcg_at_10 value: 81.51899999999999 - type: ndcg_at_100 value: 82.544 - type: ndcg_at_1000 value: 82.829 - type: ndcg_at_3 value: 78.92 - type: ndcg_at_5 value: 80.406 - type: precision_at_1 value: 71.842 - type: precision_at_10 value: 10.066 - type: precision_at_100 value: 1.076 - type: precision_at_1000 value: 0.11199999999999999 - type: precision_at_3 value: 30.703000000000003 - type: precision_at_5 value: 19.301 - type: recall_at_1 value: 66.56 - type: recall_at_10 value: 91.55 - type: recall_at_100 value: 95.67099999999999 - type: recall_at_1000 value: 97.539 - type: recall_at_3 value: 84.46900000000001 - type: recall_at_5 value: 88.201 - task: type: Retrieval dataset: type: fiqa name: MTEB FiQA2018 config: default split: test revision: None metrics: - type: map_at_1 value: 20.087 - type: map_at_10 value: 32.830999999999996 - type: map_at_100 value: 34.814 - type: map_at_1000 value: 34.999 - type: map_at_3 value: 28.198 - type: map_at_5 value: 30.779 - type: mrr_at_1 value: 38.889 - type: mrr_at_10 value: 48.415 - type: mrr_at_100 value: 49.187 - type: mrr_at_1000 value: 49.226 - type: mrr_at_3 value: 45.705 - type: mrr_at_5 value: 47.225 - type: ndcg_at_1 value: 38.889 - type: ndcg_at_10 value: 40.758 - type: ndcg_at_100 value: 47.671 - type: ndcg_at_1000 value: 50.744 - type: ndcg_at_3 value: 36.296 - type: ndcg_at_5 value: 37.852999999999994 - type: precision_at_1 value: 38.889 - type: precision_at_10 value: 11.466 - type: precision_at_100 value: 1.8499999999999999 - type: precision_at_1000 value: 0.24 - type: precision_at_3 value: 24.126 - type: precision_at_5 value: 18.21 - type: recall_at_1 value: 20.087 - type: recall_at_10 value: 48.042 - type: recall_at_100 value: 73.493 - type: recall_at_1000 value: 91.851 - type: recall_at_3 value: 32.694 - type: recall_at_5 value: 39.099000000000004 - task: type: Retrieval dataset: type: hotpotqa name: MTEB HotpotQA config: default split: test revision: None metrics: - type: map_at_1 value: 38.096000000000004 - type: map_at_10 value: 56.99999999999999 - type: map_at_100 value: 57.914 - type: map_at_1000 value: 57.984 - type: map_at_3 value: 53.900999999999996 - type: map_at_5 value: 55.827000000000005 - type: mrr_at_1 value: 76.19200000000001 - type: mrr_at_10 value: 81.955 - type: mrr_at_100 value: 82.164 - type: mrr_at_1000 value: 82.173 - type: mrr_at_3 value: 80.963 - type: mrr_at_5 value: 81.574 - type: ndcg_at_1 value: 76.19200000000001 - type: ndcg_at_10 value: 65.75 - type: ndcg_at_100 value: 68.949 - type: ndcg_at_1000 value: 70.342 - type: ndcg_at_3 value: 61.29 - type: ndcg_at_5 value: 63.747 - type: precision_at_1 value: 76.19200000000001 - type: precision_at_10 value: 13.571 - type: precision_at_100 value: 1.6070000000000002 - type: precision_at_1000 value: 0.179 - type: precision_at_3 value: 38.663 - type: precision_at_5 value: 25.136999999999997 - type: recall_at_1 value: 38.096000000000004 - type: recall_at_10 value: 67.853 - type: recall_at_100 value: 80.365 - type: recall_at_1000 value: 89.629 - type: recall_at_3 value: 57.995 - type: recall_at_5 value: 62.843 - task: type: Classification dataset: type: mteb/imdb name: MTEB ImdbClassification config: default split: test revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 metrics: - type: accuracy value: 85.95200000000001 - type: ap value: 80.73847277002109 - type: f1 value: 85.92406135678594 - task: type: Retrieval dataset: type: msmarco name: MTEB MSMARCO config: default split: dev revision: None metrics: - type: map_at_1 value: 20.916999999999998 - type: map_at_10 value: 33.23 - type: map_at_100 value: 34.427 - type: map_at_1000 value: 34.477000000000004 - type: map_at_3 value: 29.292 - type: map_at_5 value: 31.6 - type: mrr_at_1 value: 21.547 - type: mrr_at_10 value: 33.839999999999996 - type: mrr_at_100 value: 34.979 - type: mrr_at_1000 value: 35.022999999999996 - type: mrr_at_3 value: 29.988 - type: mrr_at_5 value: 32.259 - type: ndcg_at_1 value: 21.519 - type: ndcg_at_10 value: 40.209 - type: ndcg_at_100 value: 45.954 - type: ndcg_at_1000 value: 47.187 - type: ndcg_at_3 value: 32.227 - type: ndcg_at_5 value: 36.347 - type: precision_at_1 value: 21.519 - type: precision_at_10 value: 6.447 - type: precision_at_100 value: 0.932 - type: precision_at_1000 value: 0.104 - type: precision_at_3 value: 13.877999999999998 - type: precision_at_5 value: 10.404 - type: recall_at_1 value: 20.916999999999998 - type: recall_at_10 value: 61.7 - type: recall_at_100 value: 88.202 - type: recall_at_1000 value: 97.588 - type: recall_at_3 value: 40.044999999999995 - type: recall_at_5 value: 49.964999999999996 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (en) config: en split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 93.02781577747379 - type: f1 value: 92.83653922768306 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (en) config: en split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 72.04286365709075 - type: f1 value: 53.43867658525793 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (en) config: en split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 71.47276395427035 - type: f1 value: 69.77017399597342 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (en) config: en split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 76.3819771351715 - type: f1 value: 76.8484533435409 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-p2p name: MTEB MedrxivClusteringP2P config: default split: test revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 metrics: - type: v_measure value: 33.16515993299593 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-s2s name: MTEB MedrxivClusteringS2S config: default split: test revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 metrics: - type: v_measure value: 31.77145323314774 - task: type: Reranking dataset: type: mteb/mind_small name: MTEB MindSmallReranking config: default split: test revision: 3bdac13927fdc888b903db93b2ffdbd90b295a69 metrics: - type: map value: 32.53637706586391 - type: mrr value: 33.7312926288863 - task: type: Retrieval dataset: type: nfcorpus name: MTEB NFCorpus config: default split: test revision: None metrics: - type: map_at_1 value: 7.063999999999999 - type: map_at_10 value: 15.046999999999999 - type: map_at_100 value: 19.116 - type: map_at_1000 value: 20.702 - type: map_at_3 value: 10.932 - type: map_at_5 value: 12.751999999999999 - type: mrr_at_1 value: 50.464 - type: mrr_at_10 value: 58.189 - type: mrr_at_100 value: 58.733999999999995 - type: mrr_at_1000 value: 58.769000000000005 - type: mrr_at_3 value: 56.24400000000001 - type: mrr_at_5 value: 57.68299999999999 - type: ndcg_at_1 value: 48.142 - type: ndcg_at_10 value: 37.897 - type: ndcg_at_100 value: 35.264 - type: ndcg_at_1000 value: 44.033 - type: ndcg_at_3 value: 42.967 - type: ndcg_at_5 value: 40.815 - type: precision_at_1 value: 50.15500000000001 - type: precision_at_10 value: 28.235 - type: precision_at_100 value: 8.994 - type: precision_at_1000 value: 2.218 - type: precision_at_3 value: 40.041 - type: precision_at_5 value: 35.046 - type: recall_at_1 value: 7.063999999999999 - type: recall_at_10 value: 18.598 - type: recall_at_100 value: 35.577999999999996 - type: recall_at_1000 value: 67.43 - type: recall_at_3 value: 11.562999999999999 - type: recall_at_5 value: 14.771 - task: type: Retrieval dataset: type: nq name: MTEB NQ config: default split: test revision: None metrics: - type: map_at_1 value: 29.046 - type: map_at_10 value: 44.808 - type: map_at_100 value: 45.898 - type: map_at_1000 value: 45.927 - type: map_at_3 value: 40.19 - type: map_at_5 value: 42.897 - type: mrr_at_1 value: 32.706 - type: mrr_at_10 value: 47.275 - type: mrr_at_100 value: 48.075 - type: mrr_at_1000 value: 48.095 - type: mrr_at_3 value: 43.463 - type: mrr_at_5 value: 45.741 - type: ndcg_at_1 value: 32.706 - type: ndcg_at_10 value: 52.835 - type: ndcg_at_100 value: 57.345 - type: ndcg_at_1000 value: 57.985 - type: ndcg_at_3 value: 44.171 - type: ndcg_at_5 value: 48.661 - type: precision_at_1 value: 32.706 - type: precision_at_10 value: 8.895999999999999 - type: precision_at_100 value: 1.143 - type: precision_at_1000 value: 0.12 - type: precision_at_3 value: 20.238999999999997 - type: precision_at_5 value: 14.728 - type: recall_at_1 value: 29.046 - type: recall_at_10 value: 74.831 - type: recall_at_100 value: 94.192 - type: recall_at_1000 value: 98.897 - type: recall_at_3 value: 52.37500000000001 - type: recall_at_5 value: 62.732 - task: type: Retrieval dataset: type: quora name: MTEB QuoraRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 70.38799999999999 - type: map_at_10 value: 84.315 - type: map_at_100 value: 84.955 - type: map_at_1000 value: 84.971 - type: map_at_3 value: 81.33399999999999 - type: map_at_5 value: 83.21300000000001 - type: mrr_at_1 value: 81.03 - type: mrr_at_10 value: 87.395 - type: mrr_at_100 value: 87.488 - type: mrr_at_1000 value: 87.48899999999999 - type: mrr_at_3 value: 86.41499999999999 - type: mrr_at_5 value: 87.074 - type: ndcg_at_1 value: 81.04 - type: ndcg_at_10 value: 88.151 - type: ndcg_at_100 value: 89.38199999999999 - type: ndcg_at_1000 value: 89.479 - type: ndcg_at_3 value: 85.24000000000001 - type: ndcg_at_5 value: 86.856 - type: precision_at_1 value: 81.04 - type: precision_at_10 value: 13.372 - type: precision_at_100 value: 1.526 - type: precision_at_1000 value: 0.157 - type: precision_at_3 value: 37.217 - type: precision_at_5 value: 24.502 - type: recall_at_1 value: 70.38799999999999 - type: recall_at_10 value: 95.452 - type: recall_at_100 value: 99.59700000000001 - type: recall_at_1000 value: 99.988 - type: recall_at_3 value: 87.11 - type: recall_at_5 value: 91.662 - task: type: Clustering dataset: type: mteb/reddit-clustering name: MTEB RedditClustering config: default split: test revision: 24640382cdbf8abc73003fb0fa6d111a705499eb metrics: - type: v_measure value: 59.334991029213235 - task: type: Clustering dataset: type: mteb/reddit-clustering-p2p name: MTEB RedditClusteringP2P config: default split: test revision: 282350215ef01743dc01b456c7f5241fa8937f16 metrics: - type: v_measure value: 62.586500854616666 - task: type: Retrieval dataset: type: scidocs name: MTEB SCIDOCS config: default split: test revision: None metrics: - type: map_at_1 value: 5.153 - type: map_at_10 value: 14.277000000000001 - type: map_at_100 value: 16.922 - type: map_at_1000 value: 17.302999999999997 - type: map_at_3 value: 9.961 - type: map_at_5 value: 12.257 - type: mrr_at_1 value: 25.4 - type: mrr_at_10 value: 37.458000000000006 - type: mrr_at_100 value: 38.681 - type: mrr_at_1000 value: 38.722 - type: mrr_at_3 value: 34.1 - type: mrr_at_5 value: 36.17 - type: ndcg_at_1 value: 25.4 - type: ndcg_at_10 value: 23.132 - type: ndcg_at_100 value: 32.908 - type: ndcg_at_1000 value: 38.754 - type: ndcg_at_3 value: 21.82 - type: ndcg_at_5 value: 19.353 - type: precision_at_1 value: 25.4 - type: precision_at_10 value: 12.1 - type: precision_at_100 value: 2.628 - type: precision_at_1000 value: 0.402 - type: precision_at_3 value: 20.732999999999997 - type: precision_at_5 value: 17.34 - type: recall_at_1 value: 5.153 - type: recall_at_10 value: 24.54 - type: recall_at_100 value: 53.293 - type: recall_at_1000 value: 81.57 - type: recall_at_3 value: 12.613 - type: recall_at_5 value: 17.577 - task: type: STS dataset: type: mteb/sickr-sts name: MTEB SICK-R config: default split: test revision: a6ea5a8cab320b040a23452cc28066d9beae2cee metrics: - type: cos_sim_pearson value: 84.86284404925333 - type: cos_sim_spearman value: 78.85870555294795 - type: euclidean_pearson value: 82.20105295276093 - type: euclidean_spearman value: 78.92125617009592 - type: manhattan_pearson value: 82.15840025289069 - type: manhattan_spearman value: 78.85955732900803 - task: type: STS dataset: type: mteb/sts12-sts name: MTEB STS12 config: default split: test revision: a0d554a64d88156834ff5ae9920b964011b16384 metrics: - type: cos_sim_pearson value: 84.98747423389027 - type: cos_sim_spearman value: 75.71298531799367 - type: euclidean_pearson value: 81.59709559192291 - type: euclidean_spearman value: 75.40622749225653 - type: manhattan_pearson value: 81.55553547608804 - type: manhattan_spearman value: 75.39380235424899 - task: type: STS dataset: type: mteb/sts13-sts name: MTEB STS13 config: default split: test revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca metrics: - type: cos_sim_pearson value: 83.76861330695503 - type: cos_sim_spearman value: 85.72991921531624 - type: euclidean_pearson value: 84.84504307397536 - type: euclidean_spearman value: 86.02679162824732 - type: manhattan_pearson value: 84.79969439220142 - type: manhattan_spearman value: 85.99238837291625 - task: type: STS dataset: type: mteb/sts14-sts name: MTEB STS14 config: default split: test revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 metrics: - type: cos_sim_pearson value: 83.31929747511796 - type: cos_sim_spearman value: 81.50806522502528 - type: euclidean_pearson value: 82.93936686512777 - type: euclidean_spearman value: 81.54403447993224 - type: manhattan_pearson value: 82.89696981900828 - type: manhattan_spearman value: 81.52817825470865 - task: type: STS dataset: type: mteb/sts15-sts name: MTEB STS15 config: default split: test revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 metrics: - type: cos_sim_pearson value: 87.14413295332908 - type: cos_sim_spearman value: 88.81032027008195 - type: euclidean_pearson value: 88.19205563407645 - type: euclidean_spearman value: 88.89738339479216 - type: manhattan_pearson value: 88.11075942004189 - type: manhattan_spearman value: 88.8297061675564 - task: type: STS dataset: type: mteb/sts16-sts name: MTEB STS16 config: default split: test revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 metrics: - type: cos_sim_pearson value: 82.15980075557017 - type: cos_sim_spearman value: 83.81896308594801 - type: euclidean_pearson value: 83.11195254311338 - type: euclidean_spearman value: 84.10479481755407 - type: manhattan_pearson value: 83.13915225100556 - type: manhattan_spearman value: 84.09895591027859 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-en) config: en-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 87.93669480147919 - type: cos_sim_spearman value: 87.89861394614361 - type: euclidean_pearson value: 88.37316413202339 - type: euclidean_spearman value: 88.18033817842569 - type: manhattan_pearson value: 88.39427578879469 - type: manhattan_spearman value: 88.09185009236847 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (en) config: en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 66.62215083348255 - type: cos_sim_spearman value: 67.33243665716736 - type: euclidean_pearson value: 67.60871701996284 - type: euclidean_spearman value: 66.75929225238659 - type: manhattan_pearson value: 67.63907838970992 - type: manhattan_spearman value: 66.79313656754846 - task: type: STS dataset: type: mteb/stsbenchmark-sts name: MTEB STSBenchmark config: default split: test revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 metrics: - type: cos_sim_pearson value: 84.65549191934764 - type: cos_sim_spearman value: 85.73266847750143 - type: euclidean_pearson value: 85.75609932254318 - type: euclidean_spearman value: 85.9452287759371 - type: manhattan_pearson value: 85.69717413063573 - type: manhattan_spearman value: 85.86546318377046 - task: type: Reranking dataset: type: mteb/scidocs-reranking name: MTEB SciDocsRR config: default split: test revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab metrics: - type: map value: 87.08164129085783 - type: mrr value: 96.2877273416489 - task: type: Retrieval dataset: type: scifact name: MTEB SciFact config: default split: test revision: None metrics: - type: map_at_1 value: 62.09400000000001 - type: map_at_10 value: 71.712 - type: map_at_100 value: 72.128 - type: map_at_1000 value: 72.14399999999999 - type: map_at_3 value: 68.93 - type: map_at_5 value: 70.694 - type: mrr_at_1 value: 65.0 - type: mrr_at_10 value: 72.572 - type: mrr_at_100 value: 72.842 - type: mrr_at_1000 value: 72.856 - type: mrr_at_3 value: 70.44399999999999 - type: mrr_at_5 value: 71.744 - type: ndcg_at_1 value: 65.0 - type: ndcg_at_10 value: 76.178 - type: ndcg_at_100 value: 77.887 - type: ndcg_at_1000 value: 78.227 - type: ndcg_at_3 value: 71.367 - type: ndcg_at_5 value: 73.938 - type: precision_at_1 value: 65.0 - type: precision_at_10 value: 10.033 - type: precision_at_100 value: 1.097 - type: precision_at_1000 value: 0.11199999999999999 - type: precision_at_3 value: 27.667 - type: precision_at_5 value: 18.4 - type: recall_at_1 value: 62.09400000000001 - type: recall_at_10 value: 89.022 - type: recall_at_100 value: 96.833 - type: recall_at_1000 value: 99.333 - type: recall_at_3 value: 75.922 - type: recall_at_5 value: 82.428 - task: type: PairClassification dataset: type: mteb/sprintduplicatequestions-pairclassification name: MTEB SprintDuplicateQuestions config: default split: test revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 metrics: - type: cos_sim_accuracy value: 99.82178217821782 - type: cos_sim_ap value: 95.71282508220798 - type: cos_sim_f1 value: 90.73120494335737 - type: cos_sim_precision value: 93.52441613588111 - type: cos_sim_recall value: 88.1 - type: dot_accuracy value: 99.73960396039604 - type: dot_ap value: 92.98534606529098 - type: dot_f1 value: 86.83024536805209 - type: dot_precision value: 86.96088264794383 - type: dot_recall value: 86.7 - type: euclidean_accuracy value: 99.82475247524752 - type: euclidean_ap value: 95.72927039014849 - type: euclidean_f1 value: 90.89974293059126 - type: euclidean_precision value: 93.54497354497354 - type: euclidean_recall value: 88.4 - type: manhattan_accuracy value: 99.82574257425742 - type: manhattan_ap value: 95.72142177390405 - type: manhattan_f1 value: 91.00152516522625 - type: manhattan_precision value: 92.55429162357808 - type: manhattan_recall value: 89.5 - type: max_accuracy value: 99.82574257425742 - type: max_ap value: 95.72927039014849 - type: max_f1 value: 91.00152516522625 - task: type: Clustering dataset: type: mteb/stackexchange-clustering name: MTEB StackExchangeClustering config: default split: test revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 metrics: - type: v_measure value: 66.63957663468679 - task: type: Clustering dataset: type: mteb/stackexchange-clustering-p2p name: MTEB StackExchangeClusteringP2P config: default split: test revision: 815ca46b2622cec33ccafc3735d572c266efdb44 metrics: - type: v_measure value: 36.003307257923964 - task: type: Reranking dataset: type: mteb/stackoverflowdupquestions-reranking name: MTEB StackOverflowDupQuestions config: default split: test revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 metrics: - type: map value: 53.005825525863905 - type: mrr value: 53.854683919022165 - task: type: Summarization dataset: type: mteb/summeval name: MTEB SummEval config: default split: test revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c metrics: - type: cos_sim_pearson value: 30.503611569974098 - type: cos_sim_spearman value: 31.17155564248449 - type: dot_pearson value: 26.740428413981306 - type: dot_spearman value: 26.55727635469746 - task: type: Retrieval dataset: type: trec-covid name: MTEB TRECCOVID config: default split: test revision: None metrics: - type: map_at_1 value: 0.23600000000000002 - type: map_at_10 value: 1.7670000000000001 - type: map_at_100 value: 10.208 - type: map_at_1000 value: 25.997999999999998 - type: map_at_3 value: 0.605 - type: map_at_5 value: 0.9560000000000001 - type: mrr_at_1 value: 84.0 - type: mrr_at_10 value: 90.167 - type: mrr_at_100 value: 90.167 - type: mrr_at_1000 value: 90.167 - type: mrr_at_3 value: 89.667 - type: mrr_at_5 value: 90.167 - type: ndcg_at_1 value: 77.0 - type: ndcg_at_10 value: 68.783 - type: ndcg_at_100 value: 54.196 - type: ndcg_at_1000 value: 52.077 - type: ndcg_at_3 value: 71.642 - type: ndcg_at_5 value: 70.45700000000001 - type: precision_at_1 value: 84.0 - type: precision_at_10 value: 73.0 - type: precision_at_100 value: 55.48 - type: precision_at_1000 value: 23.102 - type: precision_at_3 value: 76.0 - type: precision_at_5 value: 74.8 - type: recall_at_1 value: 0.23600000000000002 - type: recall_at_10 value: 1.9869999999999999 - type: recall_at_100 value: 13.749 - type: recall_at_1000 value: 50.157 - type: recall_at_3 value: 0.633 - type: recall_at_5 value: 1.0290000000000001 - task: type: Retrieval dataset: type: webis-touche2020 name: MTEB Touche2020 config: default split: test revision: None metrics: - type: map_at_1 value: 1.437 - type: map_at_10 value: 8.791 - type: map_at_100 value: 15.001999999999999 - type: map_at_1000 value: 16.549 - type: map_at_3 value: 3.8080000000000003 - type: map_at_5 value: 5.632000000000001 - type: mrr_at_1 value: 20.408 - type: mrr_at_10 value: 36.96 - type: mrr_at_100 value: 37.912 - type: mrr_at_1000 value: 37.912 - type: mrr_at_3 value: 29.592000000000002 - type: mrr_at_5 value: 34.489999999999995 - type: ndcg_at_1 value: 19.387999999999998 - type: ndcg_at_10 value: 22.554 - type: ndcg_at_100 value: 35.197 - type: ndcg_at_1000 value: 46.58 - type: ndcg_at_3 value: 20.285 - type: ndcg_at_5 value: 21.924 - type: precision_at_1 value: 20.408 - type: precision_at_10 value: 21.837 - type: precision_at_100 value: 7.754999999999999 - type: precision_at_1000 value: 1.537 - type: precision_at_3 value: 21.769 - type: precision_at_5 value: 23.673 - type: recall_at_1 value: 1.437 - type: recall_at_10 value: 16.314999999999998 - type: recall_at_100 value: 47.635 - type: recall_at_1000 value: 82.963 - type: recall_at_3 value: 4.955 - type: recall_at_5 value: 8.805 - task: type: Classification dataset: type: mteb/toxic_conversations_50k name: MTEB ToxicConversationsClassification config: default split: test revision: d7c0de2777da35d6aae2200a62c6e0e5af397c4c metrics: - type: accuracy value: 71.6128 - type: ap value: 14.279639861175664 - type: f1 value: 54.922292491204274 - task: type: Classification dataset: type: mteb/tweet_sentiment_extraction name: MTEB TweetSentimentExtractionClassification config: default split: test revision: d604517c81ca91fe16a244d1248fc021f9ecee7a metrics: - type: accuracy value: 57.01188455008489 - type: f1 value: 57.377953019225515 - task: type: Clustering dataset: type: mteb/twentynewsgroups-clustering name: MTEB TwentyNewsgroupsClustering config: default split: test revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 metrics: - type: v_measure value: 52.306769136544254 - task: type: PairClassification dataset: type: mteb/twittersemeval2015-pairclassification name: MTEB TwitterSemEval2015 config: default split: test revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 metrics: - type: cos_sim_accuracy value: 85.64701674912082 - type: cos_sim_ap value: 72.46600945328552 - type: cos_sim_f1 value: 67.96572367648784 - type: cos_sim_precision value: 61.21801649397336 - type: cos_sim_recall value: 76.38522427440633 - type: dot_accuracy value: 82.33295583238957 - type: dot_ap value: 62.54843443071716 - type: dot_f1 value: 60.38378562507096 - type: dot_precision value: 52.99980067769583 - type: dot_recall value: 70.15831134564644 - type: euclidean_accuracy value: 85.7423854085951 - type: euclidean_ap value: 72.76873850945174 - type: euclidean_f1 value: 68.23556960543262 - type: euclidean_precision value: 61.3344559040202 - type: euclidean_recall value: 76.88654353562005 - type: manhattan_accuracy value: 85.74834594981225 - type: manhattan_ap value: 72.66825372446462 - type: manhattan_f1 value: 68.21539194662853 - type: manhattan_precision value: 62.185056472632496 - type: manhattan_recall value: 75.54089709762533 - type: max_accuracy value: 85.74834594981225 - type: max_ap value: 72.76873850945174 - type: max_f1 value: 68.23556960543262 - task: type: PairClassification dataset: type: mteb/twitterurlcorpus-pairclassification name: MTEB TwitterURLCorpus config: default split: test revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf metrics: - type: cos_sim_accuracy value: 88.73171110334924 - type: cos_sim_ap value: 85.51855542063649 - type: cos_sim_f1 value: 77.95706775700934 - type: cos_sim_precision value: 74.12524298805887 - type: cos_sim_recall value: 82.20665229442562 - type: dot_accuracy value: 86.94842240074514 - type: dot_ap value: 80.90995345771762 - type: dot_f1 value: 74.20765027322403 - type: dot_precision value: 70.42594385285575 - type: dot_recall value: 78.41854019094548 - type: euclidean_accuracy value: 88.73753250281368 - type: euclidean_ap value: 85.54712254033734 - type: euclidean_f1 value: 78.07565728654365 - type: euclidean_precision value: 75.1120597652081 - type: euclidean_recall value: 81.282722513089 - type: manhattan_accuracy value: 88.72588970388482 - type: manhattan_ap value: 85.52118291594071 - type: manhattan_f1 value: 78.04428724070593 - type: manhattan_precision value: 74.83219105490002 - type: manhattan_recall value: 81.54450261780106 - type: max_accuracy value: 88.73753250281368 - type: max_ap value: 85.54712254033734 - type: max_f1 value: 78.07565728654365 language: - en license: mit --- # gte-base General Text Embeddings (GTE) model. [Towards General Text Embeddings with Multi-stage Contrastive Learning](https://arxiv.org/abs/2308.03281) The GTE models are trained by Alibaba DAMO Academy. They are mainly based on the BERT framework and currently offer three different sizes of models, including [GTE-large](https://huggingface.co/thenlper/gte-large), [GTE-base](https://huggingface.co/thenlper/gte-base), and [GTE-small](https://huggingface.co/thenlper/gte-small). The GTE models are trained on a large-scale corpus of relevance text pairs, covering a wide range of domains and scenarios. This enables the GTE models to be applied to various downstream tasks of text embeddings, including **information retrieval**, **semantic textual similarity**, **text reranking**, etc. ## Metrics We compared the performance of the GTE models with other popular text embedding models on the MTEB benchmark. For more detailed comparison results, please refer to the [MTEB leaderboard](https://huggingface.co/spaces/mteb/leaderboard). | Model Name | Model Size (GB) | Dimension | Sequence Length | Average (56) | Clustering (11) | Pair Classification (3) | Reranking (4) | Retrieval (15) | STS (10) | Summarization (1) | Classification (12) | |:----:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:| | [**gte-large**](https://huggingface.co/thenlper/gte-large) | 0.67 | 1024 | 512 | **63.13** | 46.84 | 85.00 | 59.13 | 52.22 | 83.35 | 31.66 | 73.33 | | [**gte-base**](https://huggingface.co/thenlper/gte-base) | 0.22 | 768 | 512 | **62.39** | 46.2 | 84.57 | 58.61 | 51.14 | 82.3 | 31.17 | 73.01 | | [e5-large-v2](https://huggingface.co/intfloat/e5-large-v2) | 1.34 | 1024| 512 | 62.25 | 44.49 | 86.03 | 56.61 | 50.56 | 82.05 | 30.19 | 75.24 | | [e5-base-v2](https://huggingface.co/intfloat/e5-base-v2) | 0.44 | 768 | 512 | 61.5 | 43.80 | 85.73 | 55.91 | 50.29 | 81.05 | 30.28 | 73.84 | | [**gte-small**](https://huggingface.co/thenlper/gte-small) | 0.07 | 384 | 512 | **61.36** | 44.89 | 83.54 | 57.7 | 49.46 | 82.07 | 30.42 | 72.31 | | [text-embedding-ada-002](https://platform.openai.com/docs/guides/embeddings) | - | 1536 | 8192 | 60.99 | 45.9 | 84.89 | 56.32 | 49.25 | 80.97 | 30.8 | 70.93 | | [e5-small-v2](https://huggingface.co/intfloat/e5-base-v2) | 0.13 | 384 | 512 | 59.93 | 39.92 | 84.67 | 54.32 | 49.04 | 80.39 | 31.16 | 72.94 | | [sentence-t5-xxl](https://huggingface.co/sentence-transformers/sentence-t5-xxl) | 9.73 | 768 | 512 | 59.51 | 43.72 | 85.06 | 56.42 | 42.24 | 82.63 | 30.08 | 73.42 | | [all-mpnet-base-v2](https://huggingface.co/sentence-transformers/all-mpnet-base-v2) | 0.44 | 768 | 514 | 57.78 | 43.69 | 83.04 | 59.36 | 43.81 | 80.28 | 27.49 | 65.07 | | [sgpt-bloom-7b1-msmarco](https://huggingface.co/bigscience/sgpt-bloom-7b1-msmarco) | 28.27 | 4096 | 2048 | 57.59 | 38.93 | 81.9 | 55.65 | 48.22 | 77.74 | 33.6 | 66.19 | | [all-MiniLM-L12-v2](https://huggingface.co/sentence-transformers/all-MiniLM-L12-v2) | 0.13 | 384 | 512 | 56.53 | 41.81 | 82.41 | 58.44 | 42.69 | 79.8 | 27.9 | 63.21 | | [all-MiniLM-L6-v2](https://huggingface.co/sentence-transformers/all-MiniLM-L6-v2) | 0.09 | 384 | 512 | 56.26 | 42.35 | 82.37 | 58.04 | 41.95 | 78.9 | 30.81 | 63.05 | | [contriever-base-msmarco](https://huggingface.co/nthakur/contriever-base-msmarco) | 0.44 | 768 | 512 | 56.00 | 41.1 | 82.54 | 53.14 | 41.88 | 76.51 | 30.36 | 66.68 | | [sentence-t5-base](https://huggingface.co/sentence-transformers/sentence-t5-base) | 0.22 | 768 | 512 | 55.27 | 40.21 | 85.18 | 53.09 | 33.63 | 81.14 | 31.39 | 69.81 | ## Usage Code example ```python import torch.nn.functional as F from torch import Tensor from transformers import AutoTokenizer, AutoModel def average_pool(last_hidden_states: Tensor, attention_mask: Tensor) -> Tensor: last_hidden = last_hidden_states.masked_fill(~attention_mask[..., None].bool(), 0.0) return last_hidden.sum(dim=1) / attention_mask.sum(dim=1)[..., None] input_texts = [ "what is the capital of China?", "how to implement quick sort in python?", "Beijing", "sorting algorithms" ] tokenizer = AutoTokenizer.from_pretrained("thenlper/gte-base") model = AutoModel.from_pretrained("thenlper/gte-base") # Tokenize the input texts batch_dict = tokenizer(input_texts, max_length=512, padding=True, truncation=True, return_tensors='pt') outputs = model(**batch_dict) embeddings = average_pool(outputs.last_hidden_state, batch_dict['attention_mask']) # (Optionally) normalize embeddings embeddings = F.normalize(embeddings, p=2, dim=1) scores = (embeddings[:1] @ embeddings[1:].T) * 100 print(scores.tolist()) ``` Use with sentence-transformers: ```python from sentence_transformers import SentenceTransformer from sentence_transformers.util import cos_sim sentences = ['That is a happy person', 'That is a very happy person'] model = SentenceTransformer('thenlper/gte-base') embeddings = model.encode(sentences) print(cos_sim(embeddings[0], embeddings[1])) ``` ### Limitation This model exclusively caters to English texts, and any lengthy texts will be truncated to a maximum of 512 tokens. ### Citation If you find our paper or models helpful, please consider citing them as follows: ``` @article{li2023towards, title={Towards general text embeddings with multi-stage contrastive learning}, author={Li, Zehan and Zhang, Xin and Zhang, Yanzhao and Long, Dingkun and Xie, Pengjun and Zhang, Meishan}, journal={arXiv preprint arXiv:2308.03281}, year={2023} } ```

lfoppiano/MatTPUSciBERT

lfoppiano

transformers

fill-mask

# Material SciBERT (TPU): Improving language understanding in materials science **Work in progress** ## Introduction SciBERT-based model pre-trained with materials science scientific fulltext ## Authors Luca Foppiano Pedro Ortiz Suarez ## TLDR - Collected full-text from ~700000 articles provided by the National Institute for Materials Science (NIMS) TDM platform (https://dice.nims.go.jp/services/TDM-PF/en/), dataset called ScienceCorpus (SciCorpus) - We added to the SciBERT vocabulary (32k tokens), 100 domain-specific unknown words extracted from SciCorpus with a keywords modeler (KeyBERT) - Starting conditions: original SciBERT weights - Pre-train the model MatTpuSciBERT from on the Google Cloud with the TPU (Tensor Processing Unit) as follow: - 800000 steps with batch_size: 256, max_seq_length:512 - 100000 steps with batch_size: 2048, max_seq_length:128 - Fine-tuning and testing on NER on superconductors (https://github.com/lfoppiano/grobid-superconductors) and physical quantities (https://github.com/kermitt2/grobid-quantities) ## Related work ### BERT Implementations - BERT (the original) https://arxiv.org/abs/1810.04805 - RoBERTa (Re-implementation by Facebook) https://arxiv.org/abs/1907.11692 ### Relevant models - SciBERT: BERT, from scratch, scientific articles (biology + CS) https://github.com/allenai/scibert - MatSciBERT (Gupta): RoBERTa, from scratch, SciBERT vocab and weights, ~150 K paper limited to 4 MS families http://github.com/m3rg-iitd/matscibert - MaterialBERT: Not yet published - MatBERT (CEDER): BERT, from scratch, 2M documents on materials science (~60M paragraphs) https://github.com/lbnlp/MatBERT - BatteryBERT (Cole): BERT, mixed from scratch and with predefined weights https://github.com/ShuHuang/batterybert/ ### Results Results obtained via 10-fold cross-validation, using DeLFT (https://github.com/kermitt2/delft) #### NER Superconductors | Model | Precision | Recall | F1 | |----------------------|-----------|---------|--------| | SciBERT (baseline) | 81.62% | 84.23% | 82.90% | | MatSciBERT (Gupta) | 81.45% | 84.36% | 82.88% | | MatTPUSciBERT | 82.13% | 85.15% | 83.61% | | MatBERT (Ceder) | 81.25% | 83.99% | 82.60% | | BatteryScibert-cased | 81.09% | 84.14% | 82.59% | #### NER Quantities | Model | Precision | Recall | F1 | |----------------------|-----------|---------|----------| | SciBERT (baseline) | 88.73% | 86.76% | 87.73% | | MatSciBERT (Gupta) | 84.98% | 90.12% | 87.47% | | MatTPUSciBERT | 88.62% | 86.33% | 87.46% | | MatBERT (Ceder) | 85.08% | 89.93% | 87.44% | | BatteryScibert-cased | 85.02% | 89.30% | 87.11% | | BatteryScibert-cased | 81.09% | 84.14% | 82.59% | ## References This work was supported by Google, through the researchers program https://cloud.google.com/edu/researchers ## Acknowledgements TBA

cardiffnlp/twitter-xlm-roberta-base-sentiment

cardiffnlp

transformers

text-classification

--- language: multilingual widget: - text: "🤗" - text: "T'estimo! ❤️" - text: "I love you!" - text: "I hate you 🤮" - text: "Mahal kita!" - text: "사랑해!" - text: "난 너가 싫어" - text: "😍😍😍" --- # twitter-XLM-roBERTa-base for Sentiment Analysis This is a multilingual XLM-roBERTa-base model trained on ~198M tweets and finetuned for sentiment analysis. The sentiment fine-tuning was done on 8 languages (Ar, En, Fr, De, Hi, It, Sp, Pt) but it can be used for more languages (see paper for details). - Paper: [XLM-T: A Multilingual Language Model Toolkit for Twitter](https://arxiv.org/abs/2104.12250). - Git Repo: [XLM-T official repository](https://github.com/cardiffnlp/xlm-t). This model has been integrated into the [TweetNLP library](https://github.com/cardiffnlp/tweetnlp). ## Example Pipeline ```python from transformers import pipeline model_path = "cardiffnlp/twitter-xlm-roberta-base-sentiment" sentiment_task = pipeline("sentiment-analysis", model=model_path, tokenizer=model_path) sentiment_task("T'estimo!") ``` ``` [{'label': 'Positive', 'score': 0.6600581407546997}] ``` ## Full classification example ```python from transformers import AutoModelForSequenceClassification from transformers import TFAutoModelForSequenceClassification from transformers import AutoTokenizer, AutoConfig import numpy as np from scipy.special import softmax # Preprocess text (username and link placeholders) def preprocess(text): new_text = [] for t in text.split(" "): t = '@user' if t.startswith('@') and len(t) > 1 else t t = 'http' if t.startswith('http') else t new_text.append(t) return " ".join(new_text) MODEL = f"cardiffnlp/twitter-xlm-roberta-base-sentiment" tokenizer = AutoTokenizer.from_pretrained(MODEL) config = AutoConfig.from_pretrained(MODEL) # PT model = AutoModelForSequenceClassification.from_pretrained(MODEL) model.save_pretrained(MODEL) text = "Good night 😊" text = preprocess(text) encoded_input = tokenizer(text, return_tensors='pt') output = model(**encoded_input) scores = output[0][0].detach().numpy() scores = softmax(scores) # # TF # model = TFAutoModelForSequenceClassification.from_pretrained(MODEL) # model.save_pretrained(MODEL) # text = "Good night 😊" # encoded_input = tokenizer(text, return_tensors='tf') # output = model(encoded_input) # scores = output[0][0].numpy() # scores = softmax(scores) # Print labels and scores ranking = np.argsort(scores) ranking = ranking[::-1] for i in range(scores.shape[0]): l = config.id2label[ranking[i]] s = scores[ranking[i]] print(f"{i+1}) {l} {np.round(float(s), 4)}") ``` Output: ``` 1) Positive 0.7673 2) Neutral 0.2015 3) Negative 0.0313 ``` ### Reference ``` @inproceedings{barbieri-etal-2022-xlm, title = "{XLM}-{T}: Multilingual Language Models in {T}witter for Sentiment Analysis and Beyond", author = "Barbieri, Francesco and Espinosa Anke, Luis and Camacho-Collados, Jose", booktitle = "Proceedings of the Thirteenth Language Resources and Evaluation Conference", month = jun, year = "2022", address = "Marseille, France", publisher = "European Language Resources Association", url = "https://aclanthology.org/2022.lrec-1.27", pages = "258--266" } ```

sentence-transformers/msmarco-MiniLM-L-12-v3

sentence-transformers

sentence-transformers

sentence-similarity

--- license: apache-2.0 library_name: sentence-transformers tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers pipeline_tag: sentence-similarity --- # sentence-transformers/msmarco-MiniLM-L-12-v3 This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 384 dimensional dense vector space and can be used for tasks like clustering or semantic search. ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer sentences = ["This is an example sentence", "Each sentence is converted"] model = SentenceTransformer('sentence-transformers/msmarco-MiniLM-L-12-v3') embeddings = model.encode(sentences) print(embeddings) ``` ## Usage (HuggingFace Transformers) Without [sentence-transformers](https://www.SBERT.net), you can use the model like this: First, you pass your input through the transformer model, then you have to apply the right pooling-operation on-top of the contextualized word embeddings. ```python from transformers import AutoTokenizer, AutoModel import torch #Mean Pooling - Take attention mask into account for correct averaging def mean_pooling(model_output, attention_mask): token_embeddings = model_output[0] #First element of model_output contains all token embeddings input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) # Sentences we want sentence embeddings for sentences = ['This is an example sentence', 'Each sentence is converted'] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('sentence-transformers/msmarco-MiniLM-L-12-v3') model = AutoModel.from_pretrained('sentence-transformers/msmarco-MiniLM-L-12-v3') # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, max pooling. sentence_embeddings = mean_pooling(model_output, encoded_input['attention_mask']) print("Sentence embeddings:") print(sentence_embeddings) ``` ## Evaluation Results For an automated evaluation of this model, see the *Sentence Embeddings Benchmark*: [https://seb.sbert.net](https://seb.sbert.net?model_name=sentence-transformers/msmarco-MiniLM-L-12-v3) ## Full Model Architecture ``` SentenceTransformer( (0): Transformer({'max_seq_length': 512, 'do_lower_case': False}) with Transformer model: BertModel (1): Pooling({'word_embedding_dimension': 384, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False}) ) ``` ## Citing & Authors This model was trained by [sentence-transformers](https://www.sbert.net/). If you find this model helpful, feel free to cite our publication [Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks](https://arxiv.org/abs/1908.10084): ```bibtex @inproceedings{reimers-2019-sentence-bert, title = "Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks", author = "Reimers, Nils and Gurevych, Iryna", booktitle = "Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing", month = "11", year = "2019", publisher = "Association for Computational Linguistics", url = "http://arxiv.org/abs/1908.10084", } ```

microsoft/dit-base-finetuned-rvlcdip

microsoft

transformers

image-classification

--- tags: - dit - vision - image-classification datasets: - rvl_cdip widget: - src: https://huggingface.co/microsoft/dit-base-finetuned-rvlcdip/resolve/main/coca_cola_advertisement.png example_title: Advertisement - src: https://huggingface.co/microsoft/dit-base-finetuned-rvlcdip/resolve/main/scientific_publication.png example_title: Scientific publication --- # Document Image Transformer (base-sized model) Document Image Transformer (DiT) model pre-trained on IIT-CDIP (Lewis et al., 2006), a dataset that includes 42 million document images and fine-tuned on [RVL-CDIP](https://www.cs.cmu.edu/~aharley/rvl-cdip/), a dataset consisting of 400,000 grayscale images in 16 classes, with 25,000 images per class. It was introduced in the paper [DiT: Self-supervised Pre-training for Document Image Transformer](https://arxiv.org/abs/2203.02378) by Li et al. and first released in [this repository](https://github.com/microsoft/unilm/tree/master/dit). Note that DiT is identical to the architecture of [BEiT](https://huggingface.co/docs/transformers/model_doc/beit). Disclaimer: The team releasing DiT did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description The Document Image Transformer (DiT) is a transformer encoder model (BERT-like) pre-trained on a large collection of images in a self-supervised fashion. The pre-training objective for the model is to predict visual tokens from the encoder of a discrete VAE (dVAE), based on masked patches. Images are presented to the model as a sequence of fixed-size patches (resolution 16x16), which are linearly embedded. One also adds absolute position embeddings before feeding the sequence to the layers of the Transformer encoder. By pre-training the model, it learns an inner representation of images that can then be used to extract features useful for downstream tasks: if you have a dataset of labeled document images for instance, you can train a standard classifier by placing a linear layer on top of the pre-trained encoder. ## Intended uses & limitations You can use the raw model for encoding document images into a vector space, but it's mostly meant to be fine-tuned on tasks like document image classification, table detection or document layout analysis. See the [model hub](https://huggingface.co/models?search=microsoft/dit) to look for fine-tuned versions on a task that interests you. ### How to use Here is how to use this model in PyTorch: ```python from transformers import AutoImageProcessor, AutoModelForImageClassification import torch from PIL import Image image = Image.open('path_to_your_document_image').convert('RGB') processor = AutoImageProcessor.from_pretrained("microsoft/dit-base-finetuned-rvlcdip") model = AutoModelForImageClassification.from_pretrained("microsoft/dit-base-finetuned-rvlcdip") inputs = processor(images=image, return_tensors="pt") outputs = model(**inputs) logits = outputs.logits # model predicts one of the 16 RVL-CDIP classes predicted_class_idx = logits.argmax(-1).item() print("Predicted class:", model.config.id2label[predicted_class_idx]) ``` ### BibTeX entry and citation info ```bibtex @article{Lewis2006BuildingAT, title={Building a test collection for complex document information processing}, author={David D. Lewis and Gady Agam and Shlomo Engelson Argamon and Ophir Frieder and David A. Grossman and Jefferson Heard}, journal={Proceedings of the 29th annual international ACM SIGIR conference on Research and development in information retrieval}, year={2006} } ```

microsoft/trocr-small-printed

microsoft

transformers

image-to-text

--- tags: - trocr - image-to-text widget: - src: https://layoutlm.blob.core.windows.net/trocr/dataset/SROIE2019Task2Crop/train/X00016469612_1.jpg example_title: Printed 1 - src: https://layoutlm.blob.core.windows.net/trocr/dataset/SROIE2019Task2Crop/train/X51005255805_7.jpg example_title: Printed 2 - src: https://layoutlm.blob.core.windows.net/trocr/dataset/SROIE2019Task2Crop/train/X51005745214_6.jpg example_title: Printed 3 --- # TrOCR (small-sized model, fine-tuned on SROIE) TrOCR model fine-tuned on the [SROIE dataset](https://rrc.cvc.uab.es/?ch=13). It was introduced in the paper [TrOCR: Transformer-based Optical Character Recognition with Pre-trained Models](https://arxiv.org/abs/2109.10282) by Li et al. and first released in [this repository](https://github.com/microsoft/unilm/tree/master/trocr). ## Model description The TrOCR model is an encoder-decoder model, consisting of an image Transformer as encoder, and a text Transformer as decoder. The image encoder was initialized from the weights of DeiT, while the text decoder was initialized from the weights of UniLM. Images are presented to the model as a sequence of fixed-size patches (resolution 16x16), which are linearly embedded. One also adds absolute position embeddings before feeding the sequence to the layers of the Transformer encoder. Next, the Transformer text decoder autoregressively generates tokens. ## Intended uses & limitations You can use the raw model for optical character recognition (OCR) on single text-line images. See the [model hub](https://huggingface.co/models?search=microsoft/trocr) to look for fine-tuned versions on a task that interests you. ### How to use Here is how to use this model in PyTorch: ```python from transformers import TrOCRProcessor, VisionEncoderDecoderModel from PIL import Image import requests # load image from the IAM database (actually this model is meant to be used on printed text) url = 'https://fki.tic.heia-fr.ch/static/img/a01-122-02-00.jpg' image = Image.open(requests.get(url, stream=True).raw).convert("RGB") processor = TrOCRProcessor.from_pretrained('microsoft/trocr-small-printed') model = VisionEncoderDecoderModel.from_pretrained('microsoft/trocr-small-printed') pixel_values = processor(images=image, return_tensors="pt").pixel_values generated_ids = model.generate(pixel_values) generated_text = processor.batch_decode(generated_ids, skip_special_tokens=True)[0] ``` ### BibTeX entry and citation info ```bibtex @misc{li2021trocr, title={TrOCR: Transformer-based Optical Character Recognition with Pre-trained Models}, author={Minghao Li and Tengchao Lv and Lei Cui and Yijuan Lu and Dinei Florencio and Cha Zhang and Zhoujun Li and Furu Wei}, year={2021}, eprint={2109.10282}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

prithivida/parrot_adequacy_model

prithivida

transformers

text-classification

--- license: apache-2.0 --- Parrot THIS IS AN ANCILLARY MODEL FOR PARROT PARAPHRASER 1. What is Parrot? Parrot is a paraphrase-based utterance augmentation framework purpose-built to accelerate training NLU models. A paraphrase framework is more than just a paraphrasing model. Please refer to the GitHub page or The model card prithivida/parrot_paraphraser_on_T5

sentence-transformers/multi-qa-mpnet-base-dot-v1

sentence-transformers

sentence-transformers

sentence-similarity

--- language: - en library_name: sentence-transformers tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers datasets: - flax-sentence-embeddings/stackexchange_xml - ms_marco - gooaq - yahoo_answers_topics - search_qa - eli5 - natural_questions - trivia_qa - embedding-data/QQP - embedding-data/PAQ_pairs - embedding-data/Amazon-QA - embedding-data/WikiAnswers pipeline_tag: sentence-similarity --- # multi-qa-mpnet-base-dot-v1 This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 768 dimensional dense vector space and was designed for **semantic search**. It has been trained on 215M (question, answer) pairs from diverse sources. For an introduction to semantic search, have a look at: [SBERT.net - Semantic Search](https://www.sbert.net/examples/applications/semantic-search/README.html) ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer, util query = "How many people live in London?" docs = ["Around 9 Million people live in London", "London is known for its financial district"] #Load the model model = SentenceTransformer('sentence-transformers/multi-qa-mpnet-base-dot-v1') #Encode query and documents query_emb = model.encode(query) doc_emb = model.encode(docs) #Compute dot score between query and all document embeddings scores = util.dot_score(query_emb, doc_emb)[0].cpu().tolist() #Combine docs & scores doc_score_pairs = list(zip(docs, scores)) #Sort by decreasing score doc_score_pairs = sorted(doc_score_pairs, key=lambda x: x[1], reverse=True) #Output passages & scores for doc, score in doc_score_pairs: print(score, doc) ``` ## Usage (HuggingFace Transformers) Without [sentence-transformers](https://www.SBERT.net), you can use the model like this: First, you pass your input through the transformer model, then you have to apply the correct pooling-operation on-top of the contextualized word embeddings. ```python from transformers import AutoTokenizer, AutoModel import torch #CLS Pooling - Take output from first token def cls_pooling(model_output): return model_output.last_hidden_state[:,0] #Encode text def encode(texts): # Tokenize sentences encoded_input = tokenizer(texts, padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input, return_dict=True) # Perform pooling embeddings = cls_pooling(model_output) return embeddings # Sentences we want sentence embeddings for query = "How many people live in London?" docs = ["Around 9 Million people live in London", "London is known for its financial district"] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained("sentence-transformers/multi-qa-mpnet-base-dot-v1") model = AutoModel.from_pretrained("sentence-transformers/multi-qa-mpnet-base-dot-v1") #Encode query and docs query_emb = encode(query) doc_emb = encode(docs) #Compute dot score between query and all document embeddings scores = torch.mm(query_emb, doc_emb.transpose(0, 1))[0].cpu().tolist() #Combine docs & scores doc_score_pairs = list(zip(docs, scores)) #Sort by decreasing score doc_score_pairs = sorted(doc_score_pairs, key=lambda x: x[1], reverse=True) #Output passages & scores for doc, score in doc_score_pairs: print(score, doc) ``` ## Technical Details In the following some technical details how this model must be used: | Setting | Value | | --- | :---: | | Dimensions | 768 | | Produces normalized embeddings | No | | Pooling-Method | CLS pooling | | Suitable score functions | dot-product (e.g. `util.dot_score`) | ---- ## Background The project aims to train sentence embedding models on very large sentence level datasets using a self-supervised contrastive learning objective. We use a contrastive learning objective: given a sentence from the pair, the model should predict which out of a set of randomly sampled other sentences, was actually paired with it in our dataset. We developped this model during the [Community week using JAX/Flax for NLP & CV](https://discuss.huggingface.co/t/open-to-the-community-community-week-using-jax-flax-for-nlp-cv/7104), organized by Hugging Face. We developped this model as part of the project: [Train the Best Sentence Embedding Model Ever with 1B Training Pairs](https://discuss.huggingface.co/t/train-the-best-sentence-embedding-model-ever-with-1b-training-pairs/7354). We benefited from efficient hardware infrastructure to run the project: 7 TPUs v3-8, as well as intervention from Googles Flax, JAX, and Cloud team member about efficient deep learning frameworks. ## Intended uses Our model is intented to be used for semantic search: It encodes queries / questions and text paragraphs in a dense vector space. It finds relevant documents for the given passages. Note that there is a limit of 512 word pieces: Text longer than that will be truncated. Further note that the model was just trained on input text up to 250 word pieces. It might not work well for longer text. ## Training procedure The full training script is accessible in this current repository: `train_script.py`. ### Pre-training We use the pretrained [`mpnet-base`](https://huggingface.co/microsoft/mpnet-base) model. Please refer to the model card for more detailed information about the pre-training procedure. #### Training We use the concatenation from multiple datasets to fine-tune our model. In total we have about 215M (question, answer) pairs. We sampled each dataset given a weighted probability which configuration is detailed in the `data_config.json` file. The model was trained with [MultipleNegativesRankingLoss](https://www.sbert.net/docs/package_reference/losses.html#multiplenegativesrankingloss) using CLS-pooling, dot-product as similarity function, and a scale of 1. | Dataset | Number of training tuples | |--------------------------------------------------------|:--------------------------:| | [WikiAnswers](https://github.com/afader/oqa#wikianswers-corpus) Duplicate question pairs from WikiAnswers | 77,427,422 | | [PAQ](https://github.com/facebookresearch/PAQ) Automatically generated (Question, Paragraph) pairs for each paragraph in Wikipedia | 64,371,441 | | [Stack Exchange](https://huggingface.co/datasets/flax-sentence-embeddings/stackexchange_xml) (Title, Body) pairs from all StackExchanges | 25,316,456 | | [Stack Exchange](https://huggingface.co/datasets/flax-sentence-embeddings/stackexchange_xml) (Title, Answer) pairs from all StackExchanges | 21,396,559 | | [MS MARCO](https://microsoft.github.io/msmarco/) Triplets (query, answer, hard_negative) for 500k queries from Bing search engine | 17,579,773 | | [GOOAQ: Open Question Answering with Diverse Answer Types](https://github.com/allenai/gooaq) (query, answer) pairs for 3M Google queries and Google featured snippet | 3,012,496 | | [Amazon-QA](http://jmcauley.ucsd.edu/data/amazon/qa/) (Question, Answer) pairs from Amazon product pages | 2,448,839 | [Yahoo Answers](https://www.kaggle.com/soumikrakshit/yahoo-answers-dataset) (Title, Answer) pairs from Yahoo Answers | 1,198,260 | | [Yahoo Answers](https://www.kaggle.com/soumikrakshit/yahoo-answers-dataset) (Question, Answer) pairs from Yahoo Answers | 681,164 | | [Yahoo Answers](https://www.kaggle.com/soumikrakshit/yahoo-answers-dataset) (Title, Question) pairs from Yahoo Answers | 659,896 | | [SearchQA](https://huggingface.co/datasets/search_qa) (Question, Answer) pairs for 140k questions, each with Top5 Google snippets on that question | 582,261 | | [ELI5](https://huggingface.co/datasets/eli5) (Question, Answer) pairs from Reddit ELI5 (explainlikeimfive) | 325,475 | | [Stack Exchange](https://huggingface.co/datasets/flax-sentence-embeddings/stackexchange_xml) Duplicate questions pairs (titles) | 304,525 | | [Quora Question Triplets](https://quoradata.quora.com/First-Quora-Dataset-Release-Question-Pairs) (Question, Duplicate_Question, Hard_Negative) triplets for Quora Questions Pairs dataset | 103,663 | | [Natural Questions (NQ)](https://ai.google.com/research/NaturalQuestions) (Question, Paragraph) pairs for 100k real Google queries with relevant Wikipedia paragraph | 100,231 | | [SQuAD2.0](https://rajpurkar.github.io/SQuAD-explorer/) (Question, Paragraph) pairs from SQuAD2.0 dataset | 87,599 | | [TriviaQA](https://huggingface.co/datasets/trivia_qa) (Question, Evidence) pairs | 73,346 | | **Total** | **214,988,242** |

neuralmind/bert-base-portuguese-cased

neuralmind

transformers

fill-mask

--- language: pt license: mit tags: - bert - pytorch datasets: - brWaC --- # BERTimbau Base (aka "bert-base-portuguese-cased")  ## Introduction BERTimbau Base is a pretrained BERT model for Brazilian Portuguese that achieves state-of-the-art performances on three downstream NLP tasks: Named Entity Recognition, Sentence Textual Similarity and Recognizing Textual Entailment. It is available in two sizes: Base and Large. For further information or requests, please go to [BERTimbau repository](https://github.com/neuralmind-ai/portuguese-bert/). ## Available models | Model | Arch. | #Layers | #Params | | ---------------------------------------- | ---------- | ------- | ------- | | `neuralmind/bert-base-portuguese-cased` | BERT-Base | 12 | 110M | | `neuralmind/bert-large-portuguese-cased` | BERT-Large | 24 | 335M | ## Usage ```python from transformers import AutoTokenizer # Or BertTokenizer from transformers import AutoModelForPreTraining # Or BertForPreTraining for loading pretraining heads from transformers import AutoModel # or BertModel, for BERT without pretraining heads model = AutoModelForPreTraining.from_pretrained('neuralmind/bert-base-portuguese-cased') tokenizer = AutoTokenizer.from_pretrained('neuralmind/bert-base-portuguese-cased', do_lower_case=False) ``` ### Masked language modeling prediction example ```python from transformers import pipeline pipe = pipeline('fill-mask', model=model, tokenizer=tokenizer) pipe('Tinha uma [MASK] no meio do caminho.') # [{'score': 0.14287759363651276, # 'sequence': '[CLS] Tinha uma pedra no meio do caminho. [SEP]', # 'token': 5028, # 'token_str': 'pedra'}, # {'score': 0.06213393807411194, # 'sequence': '[CLS] Tinha uma árvore no meio do caminho. [SEP]', # 'token': 7411, # 'token_str': 'árvore'}, # {'score': 0.05515013635158539, # 'sequence': '[CLS] Tinha uma estrada no meio do caminho. [SEP]', # 'token': 5675, # 'token_str': 'estrada'}, # {'score': 0.0299188531935215, # 'sequence': '[CLS] Tinha uma casa no meio do caminho. [SEP]', # 'token': 1105, # 'token_str': 'casa'}, # {'score': 0.025660505518317223, # 'sequence': '[CLS] Tinha uma cruz no meio do caminho. [SEP]', # 'token': 3466, # 'token_str': 'cruz'}] ``` ### For BERT embeddings ```python import torch model = AutoModel.from_pretrained('neuralmind/bert-base-portuguese-cased') input_ids = tokenizer.encode('Tinha uma pedra no meio do caminho.', return_tensors='pt') with torch.no_grad(): outs = model(input_ids) encoded = outs[0][0, 1:-1] # Ignore [CLS] and [SEP] special tokens # encoded.shape: (8, 768) # tensor([[-0.0398, -0.3057, 0.2431, ..., -0.5420, 0.1857, -0.5775], # [-0.2926, -0.1957, 0.7020, ..., -0.2843, 0.0530, -0.4304], # [ 0.2463, -0.1467, 0.5496, ..., 0.3781, -0.2325, -0.5469], # ..., # [ 0.0662, 0.7817, 0.3486, ..., -0.4131, -0.2852, -0.2819], # [ 0.0662, 0.2845, 0.1871, ..., -0.2542, -0.2933, -0.0661], # [ 0.2761, -0.1657, 0.3288, ..., -0.2102, 0.0029, -0.2009]]) ``` ## Citation If you use our work, please cite: ```bibtex @inproceedings{souza2020bertimbau, author = {F{\'a}bio Souza and Rodrigo Nogueira and Roberto Lotufo}, title = {{BERT}imbau: pretrained {BERT} models for {B}razilian {P}ortuguese}, booktitle = {9th Brazilian Conference on Intelligent Systems, {BRACIS}, Rio Grande do Sul, Brazil, October 20-23 (to appear)}, year = {2020} } ```

liuhaotian/llava-v1.5-7b

liuhaotian

transformers

text-generation

--- inference: false --- <br> <br> # LLaVA Model Card ## Model details **Model type:** LLaVA is an open-source chatbot trained by fine-tuning LLaMA/Vicuna on GPT-generated multimodal instruction-following data. It is an auto-regressive language model, based on the transformer architecture. **Model date:** LLaVA-v1.5-7B was trained in September 2023. **Paper or resources for more information:** https://llava-vl.github.io/ ## License Llama 2 is licensed under the LLAMA 2 Community License, Copyright (c) Meta Platforms, Inc. All Rights Reserved. **Where to send questions or comments about the model:** https://github.com/haotian-liu/LLaVA/issues ## Intended use **Primary intended uses:** The primary use of LLaVA is research on large multimodal models and chatbots. **Primary intended users:** The primary intended users of the model are researchers and hobbyists in computer vision, natural language processing, machine learning, and artificial intelligence. ## Training dataset - 558K filtered image-text pairs from LAION/CC/SBU, captioned by BLIP. - 158K GPT-generated multimodal instruction-following data. - 450K academic-task-oriented VQA data mixture. - 40K ShareGPT data. ## Evaluation dataset A collection of 12 benchmarks, including 5 academic VQA benchmarks and 7 recent benchmarks specifically proposed for instruction-following LMMs.

lmsys/vicuna-7b-v1.5

lmsys

transformers

text-generation

--- inference: false license: llama2 --- # Vicuna Model Card ## Model Details Vicuna is a chat assistant trained by fine-tuning Llama 2 on user-shared conversations collected from ShareGPT. - **Developed by:** [LMSYS](https://lmsys.org/) - **Model type:** An auto-regressive language model based on the transformer architecture - **License:** Llama 2 Community License Agreement - **Finetuned from model:** [Llama 2](https://arxiv.org/abs/2307.09288) ### Model Sources - **Repository:** https://github.com/lm-sys/FastChat - **Blog:** https://lmsys.org/blog/2023-03-30-vicuna/ - **Paper:** https://arxiv.org/abs/2306.05685 - **Demo:** https://chat.lmsys.org/ ## Uses The primary use of Vicuna is research on large language models and chatbots. The primary intended users of the model are researchers and hobbyists in natural language processing, machine learning, and artificial intelligence. ## How to Get Started with the Model - Command line interface: https://github.com/lm-sys/FastChat#vicuna-weights - APIs (OpenAI API, Huggingface API): https://github.com/lm-sys/FastChat/tree/main#api ## Training Details Vicuna v1.5 is fine-tuned from Llama 2 with supervised instruction fine-tuning. The training data is around 125K conversations collected from ShareGPT.com. See more details in the "Training Details of Vicuna Models" section in the appendix of this [paper](https://arxiv.org/pdf/2306.05685.pdf). ## Evaluation  Vicuna is evaluated with standard benchmarks, human preference, and LLM-as-a-judge. See more details in this [paper](https://arxiv.org/pdf/2306.05685.pdf) and [leaderboard](https://huggingface.co/spaces/lmsys/chatbot-arena-leaderboard). ## Difference between different versions of Vicuna See [vicuna_weights_version.md](https://github.com/lm-sys/FastChat/blob/main/docs/vicuna_weights_version.md)

audeering/wav2vec2-large-robust-12-ft-emotion-msp-dim

audeering

transformers

audio-classification

--- language: en datasets: - msp-podcast inference: true tags: - speech - audio - wav2vec2 - audio-classification - emotion-recognition license: cc-by-nc-sa-4.0 pipeline_tag: audio-classification --- # Model for Dimensional Speech Emotion Recognition based on Wav2vec 2.0 The model expects a raw audio signal as input and outputs predictions for arousal, dominance and valence in a range of approximately 0...1. In addition, it also provides the pooled states of the last transformer layer. The model was created by fine-tuning [ Wav2Vec2-Large-Robust](https://huggingface.co/facebook/wav2vec2-large-robust) on [MSP-Podcast](https://ecs.utdallas.edu/research/researchlabs/msp-lab/MSP-Podcast.html) (v1.7). The model was pruned from 24 to 12 transformer layers before fine-tuning. An [ONNX](https://onnx.ai/") export of the model is available from [doi:10.5281/zenodo.6221127](https://zenodo.org/record/6221127). Further details are given in the associated [paper](https://arxiv.org/abs/2203.07378) and [tutorial](https://github.com/audeering/w2v2-how-to). # Usage ```python import numpy as np import torch import torch.nn as nn from transformers import Wav2Vec2Processor from transformers.models.wav2vec2.modeling_wav2vec2 import ( Wav2Vec2Model, Wav2Vec2PreTrainedModel, ) class RegressionHead(nn.Module): r"""Classification head.""" def __init__(self, config): super().__init__() self.dense = nn.Linear(config.hidden_size, config.hidden_size) self.dropout = nn.Dropout(config.final_dropout) self.out_proj = nn.Linear(config.hidden_size, config.num_labels) def forward(self, features, **kwargs): x = features x = self.dropout(x) x = self.dense(x) x = torch.tanh(x) x = self.dropout(x) x = self.out_proj(x) return x class EmotionModel(Wav2Vec2PreTrainedModel): r"""Speech emotion classifier.""" def __init__(self, config): super().__init__(config) self.config = config self.wav2vec2 = Wav2Vec2Model(config) self.classifier = RegressionHead(config) self.init_weights() def forward( self, input_values, ): outputs = self.wav2vec2(input_values) hidden_states = outputs[0] hidden_states = torch.mean(hidden_states, dim=1) logits = self.classifier(hidden_states) return hidden_states, logits # load model from hub device = 'cpu' model_name = 'audeering/wav2vec2-large-robust-12-ft-emotion-msp-dim' processor = Wav2Vec2Processor.from_pretrained(model_name) model = EmotionModel.from_pretrained(model_name) # dummy signal sampling_rate = 16000 signal = np.zeros((1, sampling_rate), dtype=np.float32) def process_func( x: np.ndarray, sampling_rate: int, embeddings: bool = False, ) -> np.ndarray: r"""Predict emotions or extract embeddings from raw audio signal.""" # run through processor to normalize signal # always returns a batch, so we just get the first entry # then we put it on the device y = processor(x, sampling_rate=sampling_rate) y = y['input_values'][0] y = y.reshape(1, -1) y = torch.from_numpy(y).to(device) # run through model with torch.no_grad(): y = model(y)[0 if embeddings else 1] # convert to numpy y = y.detach().cpu().numpy() return y print(process_func(signal, sampling_rate)) # Arousal dominance valence # [[0.5460754 0.6062266 0.40431657]] print(process_func(signal, sampling_rate, embeddings=True)) # Pooled hidden states of last transformer layer # [[-0.00752167 0.0065819 -0.00746342 ... 0.00663632 0.00848748 # 0.00599211]] ```

EK12317/Ekmix-Diffusion

EK12317

diffusers

text-to-image

--- language: - en license: creativeml-openrail-m tags: - stable-diffusion - stable-diffusion-diffusers - text-to-image - diffusers inference: true --- ## Example: ”Negative prompt: (worst quality, low quality:1.4)” is really useful in anywhere I think all models are great with correct Hires.fix ## Ekmix-Pastel pastel but lines(with Hires.fix) (Merging the loras into the model.) ~~~ python networks\merge_lora.py --sd_model .\models\model.safetensors --save_to .\lora\2.safetensors --models .\lora\MagicLORA.pt .\lora\Jordan_3.safetensors .\lora\sttabi_v1.4-04.safetensors .\lora\xlimo768.pt .\lora\dpep2.pt --ratios 0.3 1 0.5 0.6 0.35 ~~~  ~~~ masterpiece,best quality,best quality,Amazing,beautiful detailed eyes,1girl,finely detail,Depth offield,extremely detailed CG unity 8k wallpaper,masterpiece,upper body,(vtuber minato aqua),pink hair,blue streaked hair, palace,holy,white long split mop dress ,mature female,standing,medium_breasts,silver-tiara,smile,black high heels,very long hair, body towards aside,jewelry,hair blue flower,grey eyes,close-up, Negative prompt: (worst quality, low quality:1.3) Steps: 30, Sampler: Euler a, CFG scale: 6, Seed: 191289851, Size: 512x768, Model hash: 0526445f65, Denoising strength: 0.5, Eta: 0.5, Clip skip: 2, ENSD: 31337, Hires resize: 856x1280, Hires steps: 30, Hires upscaler: Latent ~~~ pastel but lines(without hires fix) (better!)  ~~~ {masterpiece},{best quality},{1girl,{{loli},black hair,blue eyes,very long hair,hair flower,hanfu,happy}},Amazing,beautiful detailed eyes,finely detail,Depth of field,extremely detailed CG,original,outdoors,beautiful detailed hand,beautiful detailed fingers,{{soaked},{wet through}},{body under water},standing,{beautiful detailed water,beautiful detailed sky,fluttered detailed splashs} Negative prompt: (worst quality, low quality:1.3) Steps: 30, Sampler: DPM++ 2M Karras, CFG scale: 6, Seed: 2035526620, Size: 768x512, Model hash: ca485b96f8, Eta: 0.5, Clip skip: 2, ENSD: 31337 ~~~ ## Ekmix-gen4 balance between anime and reality(Merging by block weighted merge.)  ~~~ masterpiece,best quality,best quality,Amazing,beautiful detailed eyes,1girl,finely detail,Depth offield,extremely detailed CG unity 8k wallpaper,masterpiece,upper body,(vtuber minato aqua),pink hair,blue streaked hair, palace,holy,white long split mop dress ,mature female,standing,medium_breasts,silver-tiara,smile,black high heels,very long hair, body towards aside,jewelry,hair blue flower,grey eyes,close-up, ~~~  ~~~ {masterpiece},{best quality},{1girl,{{loli},black hair,blue eyes,very long hair,hair flower,hanfu,happy}},Amazing,beautiful detailed eyes,finely detail,Depth of field,extremely detailed CG,original,outdoors,beautiful detailed hand,beautiful detailed fingers,{{soaked},{wet through}},{body under water},standing,{beautiful detailed water,beautiful detailed sky,fluttered detailed splashs},by Paul Hedley, ~~~ # Great hypernetworks style1 and 2 are my favourite. 3,4 may need retrain. 

microsoft/deberta-large-mnli

microsoft

transformers

text-classification

--- language: en tags: - deberta-v1 - deberta-mnli tasks: mnli thumbnail: https://huggingface.co/front/thumbnails/microsoft.png license: mit widget: - text: "[CLS] I love you. [SEP] I like you. [SEP]" --- ## DeBERTa: Decoding-enhanced BERT with Disentangled Attention [DeBERTa](https://arxiv.org/abs/2006.03654) improves the BERT and RoBERTa models using disentangled attention and enhanced mask decoder. It outperforms BERT and RoBERTa on majority of NLU tasks with 80GB training data. Please check the [official repository](https://github.com/microsoft/DeBERTa) for more details and updates. This is the DeBERTa large model fine-tuned with MNLI task. #### Fine-tuning on NLU tasks We present the dev results on SQuAD 1.1/2.0 and several GLUE benchmark tasks. | Model | SQuAD 1.1 | SQuAD 2.0 | MNLI-m/mm | SST-2 | QNLI | CoLA | RTE | MRPC | QQP |STS-B | |---------------------------|-----------|-----------|-------------|-------|------|------|--------|-------|-------|------| | | F1/EM | F1/EM | Acc | Acc | Acc | MCC | Acc |Acc/F1 |Acc/F1 |P/S | | BERT-Large | 90.9/84.1 | 81.8/79.0 | 86.6/- | 93.2 | 92.3 | 60.6 | 70.4 | 88.0/- | 91.3/- |90.0/- | | RoBERTa-Large | 94.6/88.9 | 89.4/86.5 | 90.2/- | 96.4 | 93.9 | 68.0 | 86.6 | 90.9/- | 92.2/- |92.4/- | | XLNet-Large | 95.1/89.7 | 90.6/87.9 | 90.8/- | 97.0 | 94.9 | 69.0 | 85.9 | 90.8/- | 92.3/- |92.5/- | | [DeBERTa-Large](https://huggingface.co/microsoft/deberta-large)¹ | 95.5/90.1 | 90.7/88.0 | 91.3/91.1| 96.5|95.3| 69.5| 91.0| 92.6/94.6| 92.3/- |92.8/92.5 | | [DeBERTa-XLarge](https://huggingface.co/microsoft/deberta-xlarge)¹ | -/- | -/- | 91.5/91.2| 97.0 | - | - | 93.1 | 92.1/94.3 | - |92.9/92.7| | [DeBERTa-V2-XLarge](https://huggingface.co/microsoft/deberta-v2-xlarge)¹|95.8/90.8| 91.4/88.9|91.7/91.6| **97.5**| 95.8|71.1|**93.9**|92.0/94.2|92.3/89.8|92.9/92.9| |**[DeBERTa-V2-XXLarge](https://huggingface.co/microsoft/deberta-v2-xxlarge)^1,2**|**96.1/91.4**|**92.2/89.7**|**91.7/91.9**|97.2|**96.0**|**72.0**| 93.5| **93.1/94.9**|**92.7/90.3** |**93.2/93.1** | -------- #### Notes. - ¹ Following RoBERTa, for RTE, MRPC, STS-B, we fine-tune the tasks based on [DeBERTa-Large-MNLI](https://huggingface.co/microsoft/deberta-large-mnli), [DeBERTa-XLarge-MNLI](https://huggingface.co/microsoft/deberta-xlarge-mnli), [DeBERTa-V2-XLarge-MNLI](https://huggingface.co/microsoft/deberta-v2-xlarge-mnli), [DeBERTa-V2-XXLarge-MNLI](https://huggingface.co/microsoft/deberta-v2-xxlarge-mnli). The results of SST-2/QQP/QNLI/SQuADv2 will also be slightly improved when start from MNLI fine-tuned models, however, we only report the numbers fine-tuned from pretrained base models for those 4 tasks. - ² To try the **XXLarge** model with **[HF transformers](https://huggingface.co/transformers/main_classes/trainer.html)**, you need to specify **--sharded_ddp** ```bash cd transformers/examples/text-classification/ export TASK_NAME=mrpc python -m torch.distributed.launch --nproc_per_node=8 run_glue.py --model_name_or_path microsoft/deberta-v2-xxlarge \\ --task_name $TASK_NAME --do_train --do_eval --max_seq_length 128 --per_device_train_batch_size 4 \\ --learning_rate 3e-6 --num_train_epochs 3 --output_dir /tmp/$TASK_NAME/ --overwrite_output_dir --sharded_ddp --fp16 ``` ### Citation If you find DeBERTa useful for your work, please cite the following paper: ``` latex @inproceedings{ he2021deberta, title={DEBERTA: DECODING-ENHANCED BERT WITH DISENTANGLED ATTENTION}, author={Pengcheng He and Xiaodong Liu and Jianfeng Gao and Weizhu Chen}, booktitle={International Conference on Learning Representations}, year={2021}, url={https://openreview.net/forum?id=XPZIaotutsD} } ```

amunchet/rorshark-vit-base

amunchet

transformers

image-classification

--- license: apache-2.0 base_model: google/vit-base-patch16-224-in21k tags: - image-classification - vision - generated_from_trainer datasets: - imagefolder metrics: - accuracy model-index: - name: rorshark-vit-base results: - task: name: Image Classification type: image-classification dataset: name: imagefolder type: imagefolder config: default split: train args: default metrics: - name: Accuracy type: accuracy value: 0.9922928709055877 --- <!-- This model card has been generated automatically according to the information the Trainer had access to. You should probably proofread and complete it, then remove this comment. --> # rorshark-vit-base This model is a fine-tuned version of [google/vit-base-patch16-224-in21k](https://huggingface.co/google/vit-base-patch16-224-in21k) on the imagefolder dataset. It achieves the following results on the evaluation set: - Loss: 0.0393 - Accuracy: 0.9923 ## Model description More information needed ## Intended uses & limitations More information needed ## Training and evaluation data More information needed ## Training procedure ### Training hyperparameters The following hyperparameters were used during training: - learning_rate: 2e-05 - train_batch_size: 8 - eval_batch_size: 8 - seed: 1337 - optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 - lr_scheduler_type: linear - num_epochs: 5.0 ### Training results | Training Loss | Epoch | Step | Validation Loss | Accuracy | |:-------------:|:-----:|:----:|:---------------:|:--------:| | 0.0597 | 1.0 | 368 | 0.0546 | 0.9865 | | 0.2009 | 2.0 | 736 | 0.0531 | 0.9865 | | 0.0114 | 3.0 | 1104 | 0.0418 | 0.9904 | | 0.0998 | 4.0 | 1472 | 0.0425 | 0.9904 | | 0.1244 | 5.0 | 1840 | 0.0393 | 0.9923 | ### Framework versions - Transformers 4.36.0.dev0 - Pytorch 2.1.1+cu118 - Datasets 2.15.0 - Tokenizers 0.15.0

sshleifer/tiny-gpt2

sshleifer

transformers

text-generation

Entry not found

intfloat/multilingual-e5-large

intfloat

sentence-transformers

feature-extraction

--- tags: - mteb - Sentence Transformers - sentence-similarity - feature-extraction - sentence-transformers model-index: - name: multilingual-e5-large results: - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en) config: en split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 79.05970149253731 - type: ap value: 43.486574390835635 - type: f1 value: 73.32700092140148 - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (de) config: de split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 71.22055674518201 - type: ap value: 81.55756710830498 - type: f1 value: 69.28271787752661 - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en-ext) config: en-ext split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 80.41979010494754 - type: ap value: 29.34879922376344 - type: f1 value: 67.62475449011278 - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (ja) config: ja split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 77.8372591006424 - type: ap value: 26.557560591210738 - type: f1 value: 64.96619417368707 - task: type: Classification dataset: type: mteb/amazon_polarity name: MTEB AmazonPolarityClassification config: default split: test revision: e2d317d38cd51312af73b3d32a06d1a08b442046 metrics: - type: accuracy value: 93.489875 - type: ap value: 90.98758636917603 - type: f1 value: 93.48554819717332 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (en) config: en split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 47.564 - type: f1 value: 46.75122173518047 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (de) config: de split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 45.400000000000006 - type: f1 value: 44.17195682400632 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (es) config: es split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 43.068 - type: f1 value: 42.38155696855596 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (fr) config: fr split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 41.89 - type: f1 value: 40.84407321682663 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (ja) config: ja split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 40.120000000000005 - type: f1 value: 39.522976223819114 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (zh) config: zh split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 38.832 - type: f1 value: 38.0392533394713 - task: type: Retrieval dataset: type: arguana name: MTEB ArguAna config: default split: test revision: None metrics: - type: map_at_1 value: 30.725 - type: map_at_10 value: 46.055 - type: map_at_100 value: 46.900999999999996 - type: map_at_1000 value: 46.911 - type: map_at_3 value: 41.548 - type: map_at_5 value: 44.297 - type: mrr_at_1 value: 31.152 - type: mrr_at_10 value: 46.231 - type: mrr_at_100 value: 47.07 - type: mrr_at_1000 value: 47.08 - type: mrr_at_3 value: 41.738 - type: mrr_at_5 value: 44.468999999999994 - type: ndcg_at_1 value: 30.725 - type: ndcg_at_10 value: 54.379999999999995 - type: ndcg_at_100 value: 58.138 - type: ndcg_at_1000 value: 58.389 - type: ndcg_at_3 value: 45.156 - type: ndcg_at_5 value: 50.123 - type: precision_at_1 value: 30.725 - type: precision_at_10 value: 8.087 - type: precision_at_100 value: 0.9769999999999999 - type: precision_at_1000 value: 0.1 - type: precision_at_3 value: 18.54 - type: precision_at_5 value: 13.542000000000002 - type: recall_at_1 value: 30.725 - type: recall_at_10 value: 80.868 - type: recall_at_100 value: 97.653 - type: recall_at_1000 value: 99.57300000000001 - type: recall_at_3 value: 55.619 - type: recall_at_5 value: 67.71000000000001 - task: type: Clustering dataset: type: mteb/arxiv-clustering-p2p name: MTEB ArxivClusteringP2P config: default split: test revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d metrics: - type: v_measure value: 44.30960650674069 - task: type: Clustering dataset: type: mteb/arxiv-clustering-s2s name: MTEB ArxivClusteringS2S config: default split: test revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 metrics: - type: v_measure value: 38.427074197498996 - task: type: Reranking dataset: type: mteb/askubuntudupquestions-reranking name: MTEB AskUbuntuDupQuestions config: default split: test revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 metrics: - type: map value: 60.28270056031872 - type: mrr value: 74.38332673789738 - task: type: STS dataset: type: mteb/biosses-sts name: MTEB BIOSSES config: default split: test revision: d3fb88f8f02e40887cd149695127462bbcf29b4a metrics: - type: cos_sim_pearson value: 84.05942144105269 - type: cos_sim_spearman value: 82.51212105850809 - type: euclidean_pearson value: 81.95639829909122 - type: euclidean_spearman value: 82.3717564144213 - type: manhattan_pearson value: 81.79273425468256 - type: manhattan_spearman value: 82.20066817871039 - task: type: BitextMining dataset: type: mteb/bucc-bitext-mining name: MTEB BUCC (de-en) config: de-en split: test revision: d51519689f32196a32af33b075a01d0e7c51e252 metrics: - type: accuracy value: 99.46764091858039 - type: f1 value: 99.37717466945023 - type: precision value: 99.33194154488518 - type: recall value: 99.46764091858039 - task: type: BitextMining dataset: type: mteb/bucc-bitext-mining name: MTEB BUCC (fr-en) config: fr-en split: test revision: d51519689f32196a32af33b075a01d0e7c51e252 metrics: - type: accuracy value: 98.29407880255337 - type: f1 value: 98.11248073959938 - type: precision value: 98.02443319392472 - type: recall value: 98.29407880255337 - task: type: BitextMining dataset: type: mteb/bucc-bitext-mining name: MTEB BUCC (ru-en) config: ru-en split: test revision: d51519689f32196a32af33b075a01d0e7c51e252 metrics: - type: accuracy value: 97.79009352268791 - type: f1 value: 97.5176076665512 - type: precision value: 97.38136473848286 - type: recall value: 97.79009352268791 - task: type: BitextMining dataset: type: mteb/bucc-bitext-mining name: MTEB BUCC (zh-en) config: zh-en split: test revision: d51519689f32196a32af33b075a01d0e7c51e252 metrics: - type: accuracy value: 99.26276987888363 - type: f1 value: 99.20133403545726 - type: precision value: 99.17500438827453 - type: recall value: 99.26276987888363 - task: type: Classification dataset: type: mteb/banking77 name: MTEB Banking77Classification config: default split: test revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 metrics: - type: accuracy value: 84.72727272727273 - type: f1 value: 84.67672206031433 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-p2p name: MTEB BiorxivClusteringP2P config: default split: test revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 metrics: - type: v_measure value: 35.34220182511161 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-s2s name: MTEB BiorxivClusteringS2S config: default split: test revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 metrics: - type: v_measure value: 33.4987096128766 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 25.558249999999997 - type: map_at_10 value: 34.44425000000001 - type: map_at_100 value: 35.59833333333333 - type: map_at_1000 value: 35.706916666666665 - type: map_at_3 value: 31.691749999999995 - type: map_at_5 value: 33.252916666666664 - type: mrr_at_1 value: 30.252666666666666 - type: mrr_at_10 value: 38.60675 - type: mrr_at_100 value: 39.42666666666666 - type: mrr_at_1000 value: 39.48408333333334 - type: mrr_at_3 value: 36.17441666666665 - type: mrr_at_5 value: 37.56275 - type: ndcg_at_1 value: 30.252666666666666 - type: ndcg_at_10 value: 39.683 - type: ndcg_at_100 value: 44.68541666666667 - type: ndcg_at_1000 value: 46.94316666666668 - type: ndcg_at_3 value: 34.961749999999995 - type: ndcg_at_5 value: 37.215666666666664 - type: precision_at_1 value: 30.252666666666666 - type: precision_at_10 value: 6.904166666666667 - type: precision_at_100 value: 1.0989999999999995 - type: precision_at_1000 value: 0.14733333333333334 - type: precision_at_3 value: 16.037666666666667 - type: precision_at_5 value: 11.413583333333333 - type: recall_at_1 value: 25.558249999999997 - type: recall_at_10 value: 51.13341666666666 - type: recall_at_100 value: 73.08366666666667 - type: recall_at_1000 value: 88.79483333333334 - type: recall_at_3 value: 37.989083333333326 - type: recall_at_5 value: 43.787833333333325 - task: type: Retrieval dataset: type: climate-fever name: MTEB ClimateFEVER config: default split: test revision: None metrics: - type: map_at_1 value: 10.338 - type: map_at_10 value: 18.360000000000003 - type: map_at_100 value: 19.942 - type: map_at_1000 value: 20.134 - type: map_at_3 value: 15.174000000000001 - type: map_at_5 value: 16.830000000000002 - type: mrr_at_1 value: 23.257 - type: mrr_at_10 value: 33.768 - type: mrr_at_100 value: 34.707 - type: mrr_at_1000 value: 34.766000000000005 - type: mrr_at_3 value: 30.977 - type: mrr_at_5 value: 32.528 - type: ndcg_at_1 value: 23.257 - type: ndcg_at_10 value: 25.733 - type: ndcg_at_100 value: 32.288 - type: ndcg_at_1000 value: 35.992000000000004 - type: ndcg_at_3 value: 20.866 - type: ndcg_at_5 value: 22.612 - type: precision_at_1 value: 23.257 - type: precision_at_10 value: 8.124 - type: precision_at_100 value: 1.518 - type: precision_at_1000 value: 0.219 - type: precision_at_3 value: 15.679000000000002 - type: precision_at_5 value: 12.117 - type: recall_at_1 value: 10.338 - type: recall_at_10 value: 31.154 - type: recall_at_100 value: 54.161 - type: recall_at_1000 value: 75.21900000000001 - type: recall_at_3 value: 19.427 - type: recall_at_5 value: 24.214 - task: type: Retrieval dataset: type: dbpedia-entity name: MTEB DBPedia config: default split: test revision: None metrics: - type: map_at_1 value: 8.498 - type: map_at_10 value: 19.103 - type: map_at_100 value: 27.375 - type: map_at_1000 value: 28.981 - type: map_at_3 value: 13.764999999999999 - type: map_at_5 value: 15.950000000000001 - type: mrr_at_1 value: 65.5 - type: mrr_at_10 value: 74.53800000000001 - type: mrr_at_100 value: 74.71799999999999 - type: mrr_at_1000 value: 74.725 - type: mrr_at_3 value: 72.792 - type: mrr_at_5 value: 73.554 - type: ndcg_at_1 value: 53.37499999999999 - type: ndcg_at_10 value: 41.286 - type: ndcg_at_100 value: 45.972 - type: ndcg_at_1000 value: 53.123 - type: ndcg_at_3 value: 46.172999999999995 - type: ndcg_at_5 value: 43.033 - type: precision_at_1 value: 65.5 - type: precision_at_10 value: 32.725 - type: precision_at_100 value: 10.683 - type: precision_at_1000 value: 1.978 - type: precision_at_3 value: 50 - type: precision_at_5 value: 41.349999999999994 - type: recall_at_1 value: 8.498 - type: recall_at_10 value: 25.070999999999998 - type: recall_at_100 value: 52.383 - type: recall_at_1000 value: 74.91499999999999 - type: recall_at_3 value: 15.207999999999998 - type: recall_at_5 value: 18.563 - task: type: Classification dataset: type: mteb/emotion name: MTEB EmotionClassification config: default split: test revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 metrics: - type: accuracy value: 46.5 - type: f1 value: 41.93833713984145 - task: type: Retrieval dataset: type: fever name: MTEB FEVER config: default split: test revision: None metrics: - type: map_at_1 value: 67.914 - type: map_at_10 value: 78.10000000000001 - type: map_at_100 value: 78.333 - type: map_at_1000 value: 78.346 - type: map_at_3 value: 76.626 - type: map_at_5 value: 77.627 - type: mrr_at_1 value: 72.74199999999999 - type: mrr_at_10 value: 82.414 - type: mrr_at_100 value: 82.511 - type: mrr_at_1000 value: 82.513 - type: mrr_at_3 value: 81.231 - type: mrr_at_5 value: 82.065 - type: ndcg_at_1 value: 72.74199999999999 - type: ndcg_at_10 value: 82.806 - type: ndcg_at_100 value: 83.677 - type: ndcg_at_1000 value: 83.917 - type: ndcg_at_3 value: 80.305 - type: ndcg_at_5 value: 81.843 - type: precision_at_1 value: 72.74199999999999 - type: precision_at_10 value: 10.24 - type: precision_at_100 value: 1.089 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 31.268 - type: precision_at_5 value: 19.706000000000003 - type: recall_at_1 value: 67.914 - type: recall_at_10 value: 92.889 - type: recall_at_100 value: 96.42699999999999 - type: recall_at_1000 value: 97.92 - type: recall_at_3 value: 86.21 - type: recall_at_5 value: 90.036 - task: type: Retrieval dataset: type: fiqa name: MTEB FiQA2018 config: default split: test revision: None metrics: - type: map_at_1 value: 22.166 - type: map_at_10 value: 35.57 - type: map_at_100 value: 37.405 - type: map_at_1000 value: 37.564 - type: map_at_3 value: 30.379 - type: map_at_5 value: 33.324 - type: mrr_at_1 value: 43.519000000000005 - type: mrr_at_10 value: 51.556000000000004 - type: mrr_at_100 value: 52.344 - type: mrr_at_1000 value: 52.373999999999995 - type: mrr_at_3 value: 48.868 - type: mrr_at_5 value: 50.319 - type: ndcg_at_1 value: 43.519000000000005 - type: ndcg_at_10 value: 43.803 - type: ndcg_at_100 value: 50.468999999999994 - type: ndcg_at_1000 value: 53.111 - type: ndcg_at_3 value: 38.893 - type: ndcg_at_5 value: 40.653 - type: precision_at_1 value: 43.519000000000005 - type: precision_at_10 value: 12.253 - type: precision_at_100 value: 1.931 - type: precision_at_1000 value: 0.242 - type: precision_at_3 value: 25.617 - type: precision_at_5 value: 19.383 - type: recall_at_1 value: 22.166 - type: recall_at_10 value: 51.6 - type: recall_at_100 value: 76.574 - type: recall_at_1000 value: 92.192 - type: recall_at_3 value: 34.477999999999994 - type: recall_at_5 value: 41.835 - task: type: Retrieval dataset: type: hotpotqa name: MTEB HotpotQA config: default split: test revision: None metrics: - type: map_at_1 value: 39.041 - type: map_at_10 value: 62.961999999999996 - type: map_at_100 value: 63.79899999999999 - type: map_at_1000 value: 63.854 - type: map_at_3 value: 59.399 - type: map_at_5 value: 61.669 - type: mrr_at_1 value: 78.082 - type: mrr_at_10 value: 84.321 - type: mrr_at_100 value: 84.49600000000001 - type: mrr_at_1000 value: 84.502 - type: mrr_at_3 value: 83.421 - type: mrr_at_5 value: 83.977 - type: ndcg_at_1 value: 78.082 - type: ndcg_at_10 value: 71.229 - type: ndcg_at_100 value: 74.10900000000001 - type: ndcg_at_1000 value: 75.169 - type: ndcg_at_3 value: 66.28699999999999 - type: ndcg_at_5 value: 69.084 - type: precision_at_1 value: 78.082 - type: precision_at_10 value: 14.993 - type: precision_at_100 value: 1.7239999999999998 - type: precision_at_1000 value: 0.186 - type: precision_at_3 value: 42.737 - type: precision_at_5 value: 27.843 - type: recall_at_1 value: 39.041 - type: recall_at_10 value: 74.96300000000001 - type: recall_at_100 value: 86.199 - type: recall_at_1000 value: 93.228 - type: recall_at_3 value: 64.105 - type: recall_at_5 value: 69.608 - task: type: Classification dataset: type: mteb/imdb name: MTEB ImdbClassification config: default split: test revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 metrics: - type: accuracy value: 90.23160000000001 - type: ap value: 85.5674856808308 - type: f1 value: 90.18033354786317 - task: type: Retrieval dataset: type: msmarco name: MTEB MSMARCO config: default split: dev revision: None metrics: - type: map_at_1 value: 24.091 - type: map_at_10 value: 36.753 - type: map_at_100 value: 37.913000000000004 - type: map_at_1000 value: 37.958999999999996 - type: map_at_3 value: 32.818999999999996 - type: map_at_5 value: 35.171 - type: mrr_at_1 value: 24.742 - type: mrr_at_10 value: 37.285000000000004 - type: mrr_at_100 value: 38.391999999999996 - type: mrr_at_1000 value: 38.431 - type: mrr_at_3 value: 33.440999999999995 - type: mrr_at_5 value: 35.75 - type: ndcg_at_1 value: 24.742 - type: ndcg_at_10 value: 43.698 - type: ndcg_at_100 value: 49.145 - type: ndcg_at_1000 value: 50.23800000000001 - type: ndcg_at_3 value: 35.769 - type: ndcg_at_5 value: 39.961999999999996 - type: precision_at_1 value: 24.742 - type: precision_at_10 value: 6.7989999999999995 - type: precision_at_100 value: 0.95 - type: precision_at_1000 value: 0.104 - type: precision_at_3 value: 15.096000000000002 - type: precision_at_5 value: 11.183 - type: recall_at_1 value: 24.091 - type: recall_at_10 value: 65.068 - type: recall_at_100 value: 89.899 - type: recall_at_1000 value: 98.16 - type: recall_at_3 value: 43.68 - type: recall_at_5 value: 53.754999999999995 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (en) config: en split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 93.66621067031465 - type: f1 value: 93.49622853272142 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (de) config: de split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 91.94702733164272 - type: f1 value: 91.17043441745282 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (es) config: es split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 92.20146764509674 - type: f1 value: 91.98359080555608 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (fr) config: fr split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 88.99780770435328 - type: f1 value: 89.19746342724068 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (hi) config: hi split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 89.78486912871998 - type: f1 value: 89.24578823628642 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (th) config: th split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 88.74502712477394 - type: f1 value: 89.00297573881542 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (en) config: en split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 77.9046967624259 - type: f1 value: 59.36787125785957 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (de) config: de split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 74.5280360664976 - type: f1 value: 57.17723440888718 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (es) config: es split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 75.44029352901934 - type: f1 value: 54.052855531072964 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (fr) config: fr split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 70.5606013153774 - type: f1 value: 52.62215934386531 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (hi) config: hi split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 73.11581211903908 - type: f1 value: 52.341291845645465 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (th) config: th split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 74.28933092224233 - type: f1 value: 57.07918745504911 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (af) config: af split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 62.38063214525892 - type: f1 value: 59.46463723443009 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (am) config: am split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 56.06926698049766 - type: f1 value: 52.49084283283562 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ar) config: ar split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 60.74983187626093 - type: f1 value: 56.960640620165904 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (az) config: az split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 64.86550100874243 - type: f1 value: 62.47370548140688 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (bn) config: bn split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 63.971082716879636 - type: f1 value: 61.03812421957381 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (cy) config: cy split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 54.98318762609282 - type: f1 value: 51.51207916008392 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (da) config: da split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.45527908540686 - type: f1 value: 66.16631905400318 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (de) config: de split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.32750504371216 - type: f1 value: 66.16755288646591 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (el) config: el split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.09213180901143 - type: f1 value: 66.95654394661507 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (en) config: en split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 73.75588433086752 - type: f1 value: 71.79973779656923 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (es) config: es split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.49428379287154 - type: f1 value: 68.37494379215734 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (fa) config: fa split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.90921318090115 - type: f1 value: 66.79517376481645 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (fi) config: fi split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.12104909213181 - type: f1 value: 67.29448842879584 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (fr) config: fr split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.34095494283793 - type: f1 value: 67.01134288992947 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (he) config: he split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 67.61264290517822 - type: f1 value: 64.68730512660757 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (hi) config: hi split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 67.79757901815738 - type: f1 value: 65.24938539425598 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (hu) config: hu split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.68728984532616 - type: f1 value: 67.0487169762553 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (hy) config: hy split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 62.07464694014795 - type: f1 value: 59.183532276789286 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (id) config: id split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.04707464694015 - type: f1 value: 67.66829629003848 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (is) config: is split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 62.42434431741762 - type: f1 value: 59.01617226544757 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (it) config: it split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.53127101546738 - type: f1 value: 68.10033760906255 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ja) config: ja split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 72.50504371217215 - type: f1 value: 69.74931103158923 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (jv) config: jv split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 57.91190316072628 - type: f1 value: 54.05551136648796 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ka) config: ka split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 51.78211163416275 - type: f1 value: 49.874888544058535 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (km) config: km split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 47.017484868863484 - type: f1 value: 44.53364263352014 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (kn) config: kn split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 62.16207128446537 - type: f1 value: 59.01185692320829 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ko) config: ko split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.42501681237391 - type: f1 value: 67.13169450166086 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (lv) config: lv split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 67.0780094149294 - type: f1 value: 64.41720167850707 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ml) config: ml split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 65.57162071284466 - type: f1 value: 62.414138683804424 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (mn) config: mn split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 61.71149966375252 - type: f1 value: 58.594805125087234 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ms) config: ms split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 66.03900470746471 - type: f1 value: 63.87937257883887 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (my) config: my split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 60.8776059179556 - type: f1 value: 57.48587618059131 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (nb) config: nb split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.87895090786819 - type: f1 value: 66.8141299430347 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (nl) config: nl split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.45057162071285 - type: f1 value: 67.46444039673516 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (pl) config: pl split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 71.546738399462 - type: f1 value: 68.63640876702655 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (pt) config: pt split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 70.72965702757229 - type: f1 value: 68.54119560379115 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ro) config: ro split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 68.35574983187625 - type: f1 value: 65.88844917691927 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ru) config: ru split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 71.70477471418964 - type: f1 value: 69.19665697061978 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (sl) config: sl split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 67.0880968392737 - type: f1 value: 64.76962317666086 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (sq) config: sq split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 65.18493611297916 - type: f1 value: 62.49984559035371 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (sv) config: sv split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 71.75857431069265 - type: f1 value: 69.20053687623418 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (sw) config: sw split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 58.500336247478145 - type: f1 value: 55.2972398687929 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ta) config: ta split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 62.68997982515132 - type: f1 value: 59.36848202755348 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (te) config: te split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 63.01950235373235 - type: f1 value: 60.09351954625423 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (th) config: th split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 68.29186281102892 - type: f1 value: 67.57860496703447 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (tl) config: tl split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 64.77471418964357 - type: f1 value: 61.913983147713836 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (tr) config: tr split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.87222595830532 - type: f1 value: 66.03679033708141 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (ur) config: ur split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 64.04505716207127 - type: f1 value: 61.28569169817908 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (vi) config: vi split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 69.38466711499663 - type: f1 value: 67.20532357036844 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (zh-CN) config: zh-CN split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 71.12306657700067 - type: f1 value: 68.91251226588182 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (zh-TW) config: zh-TW split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 66.20040349697378 - type: f1 value: 66.02657347714175 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (af) config: af split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 68.73907195696032 - type: f1 value: 66.98484521791418 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (am) config: am split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 60.58843308675185 - type: f1 value: 58.95591723092005 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ar) config: ar split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 66.22730329522528 - type: f1 value: 66.0894499712115 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (az) config: az split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 66.48285137861465 - type: f1 value: 65.21963176785157 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (bn) config: bn split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 67.74714189643578 - type: f1 value: 66.8212192745412 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (cy) config: cy split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 59.09213180901143 - type: f1 value: 56.70735546356339 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (da) config: da split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 75.05716207128448 - type: f1 value: 74.8413712365364 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (de) config: de split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.69737726967047 - type: f1 value: 74.7664341963 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (el) config: el split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.90383322125084 - type: f1 value: 73.59201554448323 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (en) config: en split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 77.51176866173503 - type: f1 value: 77.46104434577758 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (es) config: es split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.31069266980496 - type: f1 value: 74.61048660675635 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (fa) config: fa split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 72.95225285810356 - type: f1 value: 72.33160006574627 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (fi) config: fi split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.12373907195696 - type: f1 value: 73.20921012557481 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (fr) config: fr split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.86684599865501 - type: f1 value: 73.82348774610831 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (he) config: he split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 71.40215198386012 - type: f1 value: 71.11945183971858 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (hi) config: hi split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 72.12844653665098 - type: f1 value: 71.34450495911766 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (hu) config: hu split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.52252858103566 - type: f1 value: 73.98878711342999 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (hy) config: hy split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 64.93611297915265 - type: f1 value: 63.723200467653385 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (id) config: id split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.11903160726295 - type: f1 value: 73.82138439467096 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (is) config: is split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 67.15198386012105 - type: f1 value: 66.02172193802167 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (it) config: it split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.32414256893072 - type: f1 value: 74.30943421170574 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ja) config: ja split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 77.46805648957633 - type: f1 value: 77.62808409298209 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (jv) config: jv split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 63.318762609280434 - type: f1 value: 62.094284066075076 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ka) config: ka split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 58.34902488231338 - type: f1 value: 57.12893860987984 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (km) config: km split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 50.88433086751849 - type: f1 value: 48.2272350802058 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (kn) config: kn split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 66.4425016812374 - type: f1 value: 64.61463095996173 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ko) config: ko split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 75.04707464694015 - type: f1 value: 75.05099199098998 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (lv) config: lv split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 70.50437121721586 - type: f1 value: 69.83397721096314 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ml) config: ml split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 69.94283792871553 - type: f1 value: 68.8704663703913 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (mn) config: mn split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 64.79488903833222 - type: f1 value: 63.615424063345436 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ms) config: ms split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 69.88231338264963 - type: f1 value: 68.57892302593237 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (my) config: my split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 63.248150638870214 - type: f1 value: 61.06680605338809 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (nb) config: nb split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.84196368527236 - type: f1 value: 74.52566464968763 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (nl) config: nl split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.8285137861466 - type: f1 value: 74.8853197608802 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (pl) config: pl split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 74.13248150638869 - type: f1 value: 74.3982040999179 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (pt) config: pt split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.49024882313383 - type: f1 value: 73.82153848368573 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ro) config: ro split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 71.72158708809684 - type: f1 value: 71.85049433180541 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ru) config: ru split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 75.137861466039 - type: f1 value: 75.37628348188467 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (sl) config: sl split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 71.86953597848016 - type: f1 value: 71.87537624521661 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (sq) config: sq split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 70.27572293207801 - type: f1 value: 68.80017302344231 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (sv) config: sv split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 76.09952925353059 - type: f1 value: 76.07992707688408 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (sw) config: sw split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 63.140551445864155 - type: f1 value: 61.73855010331415 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ta) config: ta split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 66.27774041694687 - type: f1 value: 64.83664868894539 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (te) config: te split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 66.69468728984533 - type: f1 value: 64.76239666920868 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (th) config: th split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.44653665097512 - type: f1 value: 73.14646052013873 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (tl) config: tl split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 67.71351714862139 - type: f1 value: 66.67212180163382 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (tr) config: tr split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.9946200403497 - type: f1 value: 73.87348793725525 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (ur) config: ur split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 68.15400134498992 - type: f1 value: 67.09433241421094 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (vi) config: vi split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 73.11365164761264 - type: f1 value: 73.59502539433753 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (zh-CN) config: zh-CN split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 76.82582380632145 - type: f1 value: 76.89992945316313 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (zh-TW) config: zh-TW split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 71.81237390719569 - type: f1 value: 72.36499770986265 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-p2p name: MTEB MedrxivClusteringP2P config: default split: test revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 metrics: - type: v_measure value: 31.480506569594695 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-s2s name: MTEB MedrxivClusteringS2S config: default split: test revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 metrics: - type: v_measure value: 29.71252128004552 - task: type: Reranking dataset: type: mteb/mind_small name: MTEB MindSmallReranking config: default split: test revision: 3bdac13927fdc888b903db93b2ffdbd90b295a69 metrics: - type: map value: 31.421396787056548 - type: mrr value: 32.48155274872267 - task: type: Retrieval dataset: type: nfcorpus name: MTEB NFCorpus config: default split: test revision: None metrics: - type: map_at_1 value: 5.595 - type: map_at_10 value: 12.642000000000001 - type: map_at_100 value: 15.726 - type: map_at_1000 value: 17.061999999999998 - type: map_at_3 value: 9.125 - type: map_at_5 value: 10.866000000000001 - type: mrr_at_1 value: 43.344 - type: mrr_at_10 value: 52.227999999999994 - type: mrr_at_100 value: 52.898999999999994 - type: mrr_at_1000 value: 52.944 - type: mrr_at_3 value: 49.845 - type: mrr_at_5 value: 51.115 - type: ndcg_at_1 value: 41.949999999999996 - type: ndcg_at_10 value: 33.995 - type: ndcg_at_100 value: 30.869999999999997 - type: ndcg_at_1000 value: 39.487 - type: ndcg_at_3 value: 38.903999999999996 - type: ndcg_at_5 value: 37.236999999999995 - type: precision_at_1 value: 43.344 - type: precision_at_10 value: 25.480000000000004 - type: precision_at_100 value: 7.672 - type: precision_at_1000 value: 2.028 - type: precision_at_3 value: 36.636 - type: precision_at_5 value: 32.632 - type: recall_at_1 value: 5.595 - type: recall_at_10 value: 16.466 - type: recall_at_100 value: 31.226 - type: recall_at_1000 value: 62.778999999999996 - type: recall_at_3 value: 9.931 - type: recall_at_5 value: 12.884 - task: type: Retrieval dataset: type: nq name: MTEB NQ config: default split: test revision: None metrics: - type: map_at_1 value: 40.414 - type: map_at_10 value: 56.754000000000005 - type: map_at_100 value: 57.457 - type: map_at_1000 value: 57.477999999999994 - type: map_at_3 value: 52.873999999999995 - type: map_at_5 value: 55.175 - type: mrr_at_1 value: 45.278 - type: mrr_at_10 value: 59.192 - type: mrr_at_100 value: 59.650000000000006 - type: mrr_at_1000 value: 59.665 - type: mrr_at_3 value: 56.141 - type: mrr_at_5 value: 57.998000000000005 - type: ndcg_at_1 value: 45.278 - type: ndcg_at_10 value: 64.056 - type: ndcg_at_100 value: 66.89 - type: ndcg_at_1000 value: 67.364 - type: ndcg_at_3 value: 56.97 - type: ndcg_at_5 value: 60.719 - type: precision_at_1 value: 45.278 - type: precision_at_10 value: 9.994 - type: precision_at_100 value: 1.165 - type: precision_at_1000 value: 0.121 - type: precision_at_3 value: 25.512 - type: precision_at_5 value: 17.509 - type: recall_at_1 value: 40.414 - type: recall_at_10 value: 83.596 - type: recall_at_100 value: 95.72 - type: recall_at_1000 value: 99.24 - type: recall_at_3 value: 65.472 - type: recall_at_5 value: 74.039 - task: type: Retrieval dataset: type: quora name: MTEB QuoraRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 70.352 - type: map_at_10 value: 84.369 - type: map_at_100 value: 85.02499999999999 - type: map_at_1000 value: 85.04 - type: map_at_3 value: 81.42399999999999 - type: map_at_5 value: 83.279 - type: mrr_at_1 value: 81.05 - type: mrr_at_10 value: 87.401 - type: mrr_at_100 value: 87.504 - type: mrr_at_1000 value: 87.505 - type: mrr_at_3 value: 86.443 - type: mrr_at_5 value: 87.10799999999999 - type: ndcg_at_1 value: 81.04 - type: ndcg_at_10 value: 88.181 - type: ndcg_at_100 value: 89.411 - type: ndcg_at_1000 value: 89.507 - type: ndcg_at_3 value: 85.28099999999999 - type: ndcg_at_5 value: 86.888 - type: precision_at_1 value: 81.04 - type: precision_at_10 value: 13.406 - type: precision_at_100 value: 1.5350000000000001 - type: precision_at_1000 value: 0.157 - type: precision_at_3 value: 37.31 - type: precision_at_5 value: 24.54 - type: recall_at_1 value: 70.352 - type: recall_at_10 value: 95.358 - type: recall_at_100 value: 99.541 - type: recall_at_1000 value: 99.984 - type: recall_at_3 value: 87.111 - type: recall_at_5 value: 91.643 - task: type: Clustering dataset: type: mteb/reddit-clustering name: MTEB RedditClustering config: default split: test revision: 24640382cdbf8abc73003fb0fa6d111a705499eb metrics: - type: v_measure value: 46.54068723291946 - task: type: Clustering dataset: type: mteb/reddit-clustering-p2p name: MTEB RedditClusteringP2P config: default split: test revision: 282350215ef01743dc01b456c7f5241fa8937f16 metrics: - type: v_measure value: 63.216287629895994 - task: type: Retrieval dataset: type: scidocs name: MTEB SCIDOCS config: default split: test revision: None metrics: - type: map_at_1 value: 4.023000000000001 - type: map_at_10 value: 10.071 - type: map_at_100 value: 11.892 - type: map_at_1000 value: 12.196 - type: map_at_3 value: 7.234 - type: map_at_5 value: 8.613999999999999 - type: mrr_at_1 value: 19.900000000000002 - type: mrr_at_10 value: 30.516 - type: mrr_at_100 value: 31.656000000000002 - type: mrr_at_1000 value: 31.723000000000003 - type: mrr_at_3 value: 27.400000000000002 - type: mrr_at_5 value: 29.270000000000003 - type: ndcg_at_1 value: 19.900000000000002 - type: ndcg_at_10 value: 17.474 - type: ndcg_at_100 value: 25.020999999999997 - type: ndcg_at_1000 value: 30.728 - type: ndcg_at_3 value: 16.588 - type: ndcg_at_5 value: 14.498 - type: precision_at_1 value: 19.900000000000002 - type: precision_at_10 value: 9.139999999999999 - type: precision_at_100 value: 2.011 - type: precision_at_1000 value: 0.33899999999999997 - type: precision_at_3 value: 15.667 - type: precision_at_5 value: 12.839999999999998 - type: recall_at_1 value: 4.023000000000001 - type: recall_at_10 value: 18.497 - type: recall_at_100 value: 40.8 - type: recall_at_1000 value: 68.812 - type: recall_at_3 value: 9.508 - type: recall_at_5 value: 12.983 - task: type: STS dataset: type: mteb/sickr-sts name: MTEB SICK-R config: default split: test revision: a6ea5a8cab320b040a23452cc28066d9beae2cee metrics: - type: cos_sim_pearson value: 83.967008785134 - type: cos_sim_spearman value: 80.23142141101837 - type: euclidean_pearson value: 81.20166064704539 - type: euclidean_spearman value: 80.18961335654585 - type: manhattan_pearson value: 81.13925443187625 - type: manhattan_spearman value: 80.07948723044424 - task: type: STS dataset: type: mteb/sts12-sts name: MTEB STS12 config: default split: test revision: a0d554a64d88156834ff5ae9920b964011b16384 metrics: - type: cos_sim_pearson value: 86.94262461316023 - type: cos_sim_spearman value: 80.01596278563865 - type: euclidean_pearson value: 83.80799622922581 - type: euclidean_spearman value: 79.94984954947103 - type: manhattan_pearson value: 83.68473841756281 - type: manhattan_spearman value: 79.84990707951822 - task: type: STS dataset: type: mteb/sts13-sts name: MTEB STS13 config: default split: test revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca metrics: - type: cos_sim_pearson value: 80.57346443146068 - type: cos_sim_spearman value: 81.54689837570866 - type: euclidean_pearson value: 81.10909881516007 - type: euclidean_spearman value: 81.56746243261762 - type: manhattan_pearson value: 80.87076036186582 - type: manhattan_spearman value: 81.33074987964402 - task: type: STS dataset: type: mteb/sts14-sts name: MTEB STS14 config: default split: test revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 metrics: - type: cos_sim_pearson value: 79.54733787179849 - type: cos_sim_spearman value: 77.72202105610411 - type: euclidean_pearson value: 78.9043595478849 - type: euclidean_spearman value: 77.93422804309435 - type: manhattan_pearson value: 78.58115121621368 - type: manhattan_spearman value: 77.62508135122033 - task: type: STS dataset: type: mteb/sts15-sts name: MTEB STS15 config: default split: test revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 metrics: - type: cos_sim_pearson value: 88.59880017237558 - type: cos_sim_spearman value: 89.31088630824758 - type: euclidean_pearson value: 88.47069261564656 - type: euclidean_spearman value: 89.33581971465233 - type: manhattan_pearson value: 88.40774264100956 - type: manhattan_spearman value: 89.28657485627835 - task: type: STS dataset: type: mteb/sts16-sts name: MTEB STS16 config: default split: test revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 metrics: - type: cos_sim_pearson value: 84.08055117917084 - type: cos_sim_spearman value: 85.78491813080304 - type: euclidean_pearson value: 84.99329155500392 - type: euclidean_spearman value: 85.76728064677287 - type: manhattan_pearson value: 84.87947428989587 - type: manhattan_spearman value: 85.62429454917464 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (ko-ko) config: ko-ko split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 82.14190939287384 - type: cos_sim_spearman value: 82.27331573306041 - type: euclidean_pearson value: 81.891896953716 - type: euclidean_spearman value: 82.37695542955998 - type: manhattan_pearson value: 81.73123869460504 - type: manhattan_spearman value: 82.19989168441421 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (ar-ar) config: ar-ar split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 76.84695301843362 - type: cos_sim_spearman value: 77.87790986014461 - type: euclidean_pearson value: 76.91981583106315 - type: euclidean_spearman value: 77.88154772749589 - type: manhattan_pearson value: 76.94953277451093 - type: manhattan_spearman value: 77.80499230728604 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-ar) config: en-ar split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 75.44657840482016 - type: cos_sim_spearman value: 75.05531095119674 - type: euclidean_pearson value: 75.88161755829299 - type: euclidean_spearman value: 74.73176238219332 - type: manhattan_pearson value: 75.63984765635362 - type: manhattan_spearman value: 74.86476440770737 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-de) config: en-de split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 85.64700140524133 - type: cos_sim_spearman value: 86.16014210425672 - type: euclidean_pearson value: 86.49086860843221 - type: euclidean_spearman value: 86.09729326815614 - type: manhattan_pearson value: 86.43406265125513 - type: manhattan_spearman value: 86.17740150939994 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-en) config: en-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 87.91170098764921 - type: cos_sim_spearman value: 88.12437004058931 - type: euclidean_pearson value: 88.81828254494437 - type: euclidean_spearman value: 88.14831794572122 - type: manhattan_pearson value: 88.93442183448961 - type: manhattan_spearman value: 88.15254630778304 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-tr) config: en-tr split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 72.91390577997292 - type: cos_sim_spearman value: 71.22979457536074 - type: euclidean_pearson value: 74.40314008106749 - type: euclidean_spearman value: 72.54972136083246 - type: manhattan_pearson value: 73.85687539530218 - type: manhattan_spearman value: 72.09500771742637 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (es-en) config: es-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 80.9301067983089 - type: cos_sim_spearman value: 80.74989828346473 - type: euclidean_pearson value: 81.36781301814257 - type: euclidean_spearman value: 80.9448819964426 - type: manhattan_pearson value: 81.0351322685609 - type: manhattan_spearman value: 80.70192121844177 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (es-es) config: es-es split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 87.13820465980005 - type: cos_sim_spearman value: 86.73532498758757 - type: euclidean_pearson value: 87.21329451846637 - type: euclidean_spearman value: 86.57863198601002 - type: manhattan_pearson value: 87.06973713818554 - type: manhattan_spearman value: 86.47534918791499 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (fr-en) config: fr-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 85.48720108904415 - type: cos_sim_spearman value: 85.62221757068387 - type: euclidean_pearson value: 86.1010129512749 - type: euclidean_spearman value: 85.86580966509942 - type: manhattan_pearson value: 86.26800938808971 - type: manhattan_spearman value: 85.88902721678429 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (it-en) config: it-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 83.98021347333516 - type: cos_sim_spearman value: 84.53806553803501 - type: euclidean_pearson value: 84.61483347248364 - type: euclidean_spearman value: 85.14191408011702 - type: manhattan_pearson value: 84.75297588825967 - type: manhattan_spearman value: 85.33176753669242 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (nl-en) config: nl-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 84.51856644893233 - type: cos_sim_spearman value: 85.27510748506413 - type: euclidean_pearson value: 85.09886861540977 - type: euclidean_spearman value: 85.62579245860887 - type: manhattan_pearson value: 84.93017860464607 - type: manhattan_spearman value: 85.5063988898453 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (en) config: en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 62.581573200584195 - type: cos_sim_spearman value: 63.05503590247928 - type: euclidean_pearson value: 63.652564812602094 - type: euclidean_spearman value: 62.64811520876156 - type: manhattan_pearson value: 63.506842893061076 - type: manhattan_spearman value: 62.51289573046917 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (de) config: de split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 48.2248801729127 - type: cos_sim_spearman value: 56.5936604678561 - type: euclidean_pearson value: 43.98149464089 - type: euclidean_spearman value: 56.108561882423615 - type: manhattan_pearson value: 43.86880305903564 - type: manhattan_spearman value: 56.04671150510166 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (es) config: es split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 55.17564527009831 - type: cos_sim_spearman value: 64.57978560979488 - type: euclidean_pearson value: 58.8818330154583 - type: euclidean_spearman value: 64.99214839071281 - type: manhattan_pearson value: 58.72671436121381 - type: manhattan_spearman value: 65.10713416616109 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (pl) config: pl split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 26.772131864023297 - type: cos_sim_spearman value: 34.68200792408681 - type: euclidean_pearson value: 16.68082419005441 - type: euclidean_spearman value: 34.83099932652166 - type: manhattan_pearson value: 16.52605949659529 - type: manhattan_spearman value: 34.82075801399475 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (tr) config: tr split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 54.42415189043831 - type: cos_sim_spearman value: 63.54594264576758 - type: euclidean_pearson value: 57.36577498297745 - type: euclidean_spearman value: 63.111466379158074 - type: manhattan_pearson value: 57.584543715873885 - type: manhattan_spearman value: 63.22361054139183 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (ar) config: ar split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 47.55216762405518 - type: cos_sim_spearman value: 56.98670142896412 - type: euclidean_pearson value: 50.15318757562699 - type: euclidean_spearman value: 56.524941926541906 - type: manhattan_pearson value: 49.955618528674904 - type: manhattan_spearman value: 56.37102209240117 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (ru) config: ru split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 49.20540980338571 - type: cos_sim_spearman value: 59.9009453504406 - type: euclidean_pearson value: 49.557749853620535 - type: euclidean_spearman value: 59.76631621172456 - type: manhattan_pearson value: 49.62340591181147 - type: manhattan_spearman value: 59.94224880322436 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (zh) config: zh split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 51.508169956576985 - type: cos_sim_spearman value: 66.82461565306046 - type: euclidean_pearson value: 56.2274426480083 - type: euclidean_spearman value: 66.6775323848333 - type: manhattan_pearson value: 55.98277796300661 - type: manhattan_spearman value: 66.63669848497175 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (fr) config: fr split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 72.86478788045507 - type: cos_sim_spearman value: 76.7946552053193 - type: euclidean_pearson value: 75.01598530490269 - type: euclidean_spearman value: 76.83618917858281 - type: manhattan_pearson value: 74.68337628304332 - type: manhattan_spearman value: 76.57480204017773 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (de-en) config: de-en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 55.922619099401984 - type: cos_sim_spearman value: 56.599362477240774 - type: euclidean_pearson value: 56.68307052369783 - type: euclidean_spearman value: 54.28760436777401 - type: manhattan_pearson value: 56.67763566500681 - type: manhattan_spearman value: 53.94619541711359 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (es-en) config: es-en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 66.74357206710913 - type: cos_sim_spearman value: 72.5208244925311 - type: euclidean_pearson value: 67.49254562186032 - type: euclidean_spearman value: 72.02469076238683 - type: manhattan_pearson value: 67.45251772238085 - type: manhattan_spearman value: 72.05538819984538 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (it) config: it split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 71.25734330033191 - type: cos_sim_spearman value: 76.98349083946823 - type: euclidean_pearson value: 73.71642838667736 - type: euclidean_spearman value: 77.01715504651384 - type: manhattan_pearson value: 73.61712711868105 - type: manhattan_spearman value: 77.01392571153896 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (pl-en) config: pl-en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 63.18215462781212 - type: cos_sim_spearman value: 65.54373266117607 - type: euclidean_pearson value: 64.54126095439005 - type: euclidean_spearman value: 65.30410369102711 - type: manhattan_pearson value: 63.50332221148234 - type: manhattan_spearman value: 64.3455878104313 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (zh-en) config: zh-en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 62.30509221440029 - type: cos_sim_spearman value: 65.99582704642478 - type: euclidean_pearson value: 63.43818859884195 - type: euclidean_spearman value: 66.83172582815764 - type: manhattan_pearson value: 63.055779168508764 - type: manhattan_spearman value: 65.49585020501449 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (es-it) config: es-it split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 59.587830825340404 - type: cos_sim_spearman value: 68.93467614588089 - type: euclidean_pearson value: 62.3073527367404 - type: euclidean_spearman value: 69.69758171553175 - type: manhattan_pearson value: 61.9074580815789 - type: manhattan_spearman value: 69.57696375597865 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (de-fr) config: de-fr split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 57.143220125577066 - type: cos_sim_spearman value: 67.78857859159226 - type: euclidean_pearson value: 55.58225107923733 - type: euclidean_spearman value: 67.80662907184563 - type: manhattan_pearson value: 56.24953502726514 - type: manhattan_spearman value: 67.98262125431616 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (de-pl) config: de-pl split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 21.826928900322066 - type: cos_sim_spearman value: 49.578506634400405 - type: euclidean_pearson value: 27.939890138843214 - type: euclidean_spearman value: 52.71950519136242 - type: manhattan_pearson value: 26.39878683847546 - type: manhattan_spearman value: 47.54609580342499 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (fr-pl) config: fr-pl split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 57.27603854632001 - type: cos_sim_spearman value: 50.709255283710995 - type: euclidean_pearson value: 59.5419024445929 - type: euclidean_spearman value: 50.709255283710995 - type: manhattan_pearson value: 59.03256832438492 - type: manhattan_spearman value: 61.97797868009122 - task: type: STS dataset: type: mteb/stsbenchmark-sts name: MTEB STSBenchmark config: default split: test revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 metrics: - type: cos_sim_pearson value: 85.00757054859712 - type: cos_sim_spearman value: 87.29283629622222 - type: euclidean_pearson value: 86.54824171775536 - type: euclidean_spearman value: 87.24364730491402 - type: manhattan_pearson value: 86.5062156915074 - type: manhattan_spearman value: 87.15052170378574 - task: type: Reranking dataset: type: mteb/scidocs-reranking name: MTEB SciDocsRR config: default split: test revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab metrics: - type: map value: 82.03549357197389 - type: mrr value: 95.05437645143527 - task: type: Retrieval dataset: type: scifact name: MTEB SciFact config: default split: test revision: None metrics: - type: map_at_1 value: 57.260999999999996 - type: map_at_10 value: 66.259 - type: map_at_100 value: 66.884 - type: map_at_1000 value: 66.912 - type: map_at_3 value: 63.685 - type: map_at_5 value: 65.35499999999999 - type: mrr_at_1 value: 60.333000000000006 - type: mrr_at_10 value: 67.5 - type: mrr_at_100 value: 68.013 - type: mrr_at_1000 value: 68.038 - type: mrr_at_3 value: 65.61099999999999 - type: mrr_at_5 value: 66.861 - type: ndcg_at_1 value: 60.333000000000006 - type: ndcg_at_10 value: 70.41 - type: ndcg_at_100 value: 73.10600000000001 - type: ndcg_at_1000 value: 73.846 - type: ndcg_at_3 value: 66.133 - type: ndcg_at_5 value: 68.499 - type: precision_at_1 value: 60.333000000000006 - type: precision_at_10 value: 9.232999999999999 - type: precision_at_100 value: 1.0630000000000002 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 25.667 - type: precision_at_5 value: 17.067 - type: recall_at_1 value: 57.260999999999996 - type: recall_at_10 value: 81.94399999999999 - type: recall_at_100 value: 93.867 - type: recall_at_1000 value: 99.667 - type: recall_at_3 value: 70.339 - type: recall_at_5 value: 76.25 - task: type: PairClassification dataset: type: mteb/sprintduplicatequestions-pairclassification name: MTEB SprintDuplicateQuestions config: default split: test revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 metrics: - type: cos_sim_accuracy value: 99.74356435643564 - type: cos_sim_ap value: 93.13411948212683 - type: cos_sim_f1 value: 86.80521991300147 - type: cos_sim_precision value: 84.00374181478017 - type: cos_sim_recall value: 89.8 - type: dot_accuracy value: 99.67920792079208 - type: dot_ap value: 89.27277565444479 - type: dot_f1 value: 83.9276990718124 - type: dot_precision value: 82.04393505253104 - type: dot_recall value: 85.9 - type: euclidean_accuracy value: 99.74257425742574 - type: euclidean_ap value: 93.17993008259062 - type: euclidean_f1 value: 86.69396110542476 - type: euclidean_precision value: 88.78406708595388 - type: euclidean_recall value: 84.7 - type: manhattan_accuracy value: 99.74257425742574 - type: manhattan_ap value: 93.14413755550099 - type: manhattan_f1 value: 86.82483594144371 - type: manhattan_precision value: 87.66564729867483 - type: manhattan_recall value: 86 - type: max_accuracy value: 99.74356435643564 - type: max_ap value: 93.17993008259062 - type: max_f1 value: 86.82483594144371 - task: type: Clustering dataset: type: mteb/stackexchange-clustering name: MTEB StackExchangeClustering config: default split: test revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 metrics: - type: v_measure value: 57.525863806168566 - task: type: Clustering dataset: type: mteb/stackexchange-clustering-p2p name: MTEB StackExchangeClusteringP2P config: default split: test revision: 815ca46b2622cec33ccafc3735d572c266efdb44 metrics: - type: v_measure value: 32.68850574423839 - task: type: Reranking dataset: type: mteb/stackoverflowdupquestions-reranking name: MTEB StackOverflowDupQuestions config: default split: test revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 metrics: - type: map value: 49.71580650644033 - type: mrr value: 50.50971903913081 - task: type: Summarization dataset: type: mteb/summeval name: MTEB SummEval config: default split: test revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c metrics: - type: cos_sim_pearson value: 29.152190498799484 - type: cos_sim_spearman value: 29.686180371952727 - type: dot_pearson value: 27.248664793816342 - type: dot_spearman value: 28.37748983721745 - task: type: Retrieval dataset: type: trec-covid name: MTEB TRECCOVID config: default split: test revision: None metrics: - type: map_at_1 value: 0.20400000000000001 - type: map_at_10 value: 1.6209999999999998 - type: map_at_100 value: 9.690999999999999 - type: map_at_1000 value: 23.733 - type: map_at_3 value: 0.575 - type: map_at_5 value: 0.885 - type: mrr_at_1 value: 78 - type: mrr_at_10 value: 86.56700000000001 - type: mrr_at_100 value: 86.56700000000001 - type: mrr_at_1000 value: 86.56700000000001 - type: mrr_at_3 value: 85.667 - type: mrr_at_5 value: 86.56700000000001 - type: ndcg_at_1 value: 76 - type: ndcg_at_10 value: 71.326 - type: ndcg_at_100 value: 54.208999999999996 - type: ndcg_at_1000 value: 49.252 - type: ndcg_at_3 value: 74.235 - type: ndcg_at_5 value: 73.833 - type: precision_at_1 value: 78 - type: precision_at_10 value: 74.8 - type: precision_at_100 value: 55.50000000000001 - type: precision_at_1000 value: 21.836 - type: precision_at_3 value: 78 - type: precision_at_5 value: 78 - type: recall_at_1 value: 0.20400000000000001 - type: recall_at_10 value: 1.894 - type: recall_at_100 value: 13.245999999999999 - type: recall_at_1000 value: 46.373 - type: recall_at_3 value: 0.613 - type: recall_at_5 value: 0.991 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (sqi-eng) config: sqi-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95.89999999999999 - type: f1 value: 94.69999999999999 - type: precision value: 94.11666666666667 - type: recall value: 95.89999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (fry-eng) config: fry-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 68.20809248554913 - type: f1 value: 63.431048720066066 - type: precision value: 61.69143958161298 - type: recall value: 68.20809248554913 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kur-eng) config: kur-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 71.21951219512195 - type: f1 value: 66.82926829268293 - type: precision value: 65.1260162601626 - type: recall value: 71.21951219512195 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tur-eng) config: tur-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.2 - type: f1 value: 96.26666666666667 - type: precision value: 95.8 - type: recall value: 97.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (deu-eng) config: deu-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 99.3 - type: f1 value: 99.06666666666666 - type: precision value: 98.95 - type: recall value: 99.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (nld-eng) config: nld-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.39999999999999 - type: f1 value: 96.63333333333333 - type: precision value: 96.26666666666668 - type: recall value: 97.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ron-eng) config: ron-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96 - type: f1 value: 94.86666666666666 - type: precision value: 94.31666666666668 - type: recall value: 96 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ang-eng) config: ang-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 47.01492537313433 - type: f1 value: 40.178867566927266 - type: precision value: 38.179295828549556 - type: recall value: 47.01492537313433 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ido-eng) config: ido-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 86.5 - type: f1 value: 83.62537480063796 - type: precision value: 82.44555555555554 - type: recall value: 86.5 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (jav-eng) config: jav-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 80.48780487804879 - type: f1 value: 75.45644599303138 - type: precision value: 73.37398373983739 - type: recall value: 80.48780487804879 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (isl-eng) config: isl-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.7 - type: f1 value: 91.95666666666666 - type: precision value: 91.125 - type: recall value: 93.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (slv-eng) config: slv-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 91.73754556500607 - type: f1 value: 89.65168084244632 - type: precision value: 88.73025516403402 - type: recall value: 91.73754556500607 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cym-eng) config: cym-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 81.04347826086956 - type: f1 value: 76.2128364389234 - type: precision value: 74.2 - type: recall value: 81.04347826086956 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kaz-eng) config: kaz-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 83.65217391304348 - type: f1 value: 79.4376811594203 - type: precision value: 77.65797101449274 - type: recall value: 83.65217391304348 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (est-eng) config: est-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 87.5 - type: f1 value: 85.02690476190476 - type: precision value: 83.96261904761904 - type: recall value: 87.5 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (heb-eng) config: heb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 89.3 - type: f1 value: 86.52333333333333 - type: precision value: 85.22833333333332 - type: recall value: 89.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (gla-eng) config: gla-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 65.01809408926418 - type: f1 value: 59.00594446432805 - type: precision value: 56.827215807915444 - type: recall value: 65.01809408926418 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (mar-eng) config: mar-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 91.2 - type: f1 value: 88.58 - type: precision value: 87.33333333333334 - type: recall value: 91.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (lat-eng) config: lat-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 59.199999999999996 - type: f1 value: 53.299166276284915 - type: precision value: 51.3383908045977 - type: recall value: 59.199999999999996 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (bel-eng) config: bel-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.2 - type: f1 value: 91.2 - type: precision value: 90.25 - type: recall value: 93.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (pms-eng) config: pms-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 64.76190476190476 - type: f1 value: 59.867110667110666 - type: precision value: 58.07390192653351 - type: recall value: 64.76190476190476 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (gle-eng) config: gle-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 76.2 - type: f1 value: 71.48147546897547 - type: precision value: 69.65409090909091 - type: recall value: 76.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (pes-eng) config: pes-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.8 - type: f1 value: 92.14 - type: precision value: 91.35833333333333 - type: recall value: 93.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (nob-eng) config: nob-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.89999999999999 - type: f1 value: 97.2 - type: precision value: 96.85000000000001 - type: recall value: 97.89999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (bul-eng) config: bul-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.6 - type: f1 value: 92.93333333333334 - type: precision value: 92.13333333333333 - type: recall value: 94.6 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cbk-eng) config: cbk-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 74.1 - type: f1 value: 69.14817460317461 - type: precision value: 67.2515873015873 - type: recall value: 74.1 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (hun-eng) config: hun-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95.19999999999999 - type: f1 value: 94.01333333333335 - type: precision value: 93.46666666666667 - type: recall value: 95.19999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (uig-eng) config: uig-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 76.9 - type: f1 value: 72.07523809523809 - type: precision value: 70.19777777777779 - type: recall value: 76.9 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (rus-eng) config: rus-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.1 - type: f1 value: 92.31666666666666 - type: precision value: 91.43333333333332 - type: recall value: 94.1 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (spa-eng) config: spa-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.8 - type: f1 value: 97.1 - type: precision value: 96.76666666666668 - type: recall value: 97.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (hye-eng) config: hye-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 92.85714285714286 - type: f1 value: 90.92093441150045 - type: precision value: 90.00449236298293 - type: recall value: 92.85714285714286 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tel-eng) config: tel-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.16239316239316 - type: f1 value: 91.33903133903132 - type: precision value: 90.56267806267806 - type: recall value: 93.16239316239316 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (afr-eng) config: afr-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 92.4 - type: f1 value: 90.25666666666666 - type: precision value: 89.25833333333334 - type: recall value: 92.4 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (mon-eng) config: mon-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 90.22727272727272 - type: f1 value: 87.53030303030303 - type: precision value: 86.37121212121211 - type: recall value: 90.22727272727272 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (arz-eng) config: arz-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 79.03563941299791 - type: f1 value: 74.7349505840072 - type: precision value: 72.9035639412998 - type: recall value: 79.03563941299791 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (hrv-eng) config: hrv-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97 - type: f1 value: 96.15 - type: precision value: 95.76666666666668 - type: recall value: 97 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (nov-eng) config: nov-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 76.26459143968872 - type: f1 value: 71.55642023346303 - type: precision value: 69.7544932369835 - type: recall value: 76.26459143968872 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (gsw-eng) config: gsw-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 58.119658119658126 - type: f1 value: 51.65242165242165 - type: precision value: 49.41768108434775 - type: recall value: 58.119658119658126 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (nds-eng) config: nds-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 74.3 - type: f1 value: 69.52055555555555 - type: precision value: 67.7574938949939 - type: recall value: 74.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ukr-eng) config: ukr-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.8 - type: f1 value: 93.31666666666666 - type: precision value: 92.60000000000001 - type: recall value: 94.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (uzb-eng) config: uzb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 76.63551401869158 - type: f1 value: 72.35202492211837 - type: precision value: 70.60358255451713 - type: recall value: 76.63551401869158 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (lit-eng) config: lit-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 90.4 - type: f1 value: 88.4811111111111 - type: precision value: 87.7452380952381 - type: recall value: 90.4 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ina-eng) config: ina-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95 - type: f1 value: 93.60666666666667 - type: precision value: 92.975 - type: recall value: 95 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (lfn-eng) config: lfn-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 67.2 - type: f1 value: 63.01595782872099 - type: precision value: 61.596587301587306 - type: recall value: 67.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (zsm-eng) config: zsm-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95.7 - type: f1 value: 94.52999999999999 - type: precision value: 94 - type: recall value: 95.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ita-eng) config: ita-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.6 - type: f1 value: 93.28999999999999 - type: precision value: 92.675 - type: recall value: 94.6 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cmn-eng) config: cmn-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.39999999999999 - type: f1 value: 95.28333333333333 - type: precision value: 94.75 - type: recall value: 96.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (lvs-eng) config: lvs-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 91.9 - type: f1 value: 89.83 - type: precision value: 88.92 - type: recall value: 91.9 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (glg-eng) config: glg-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.69999999999999 - type: f1 value: 93.34222222222223 - type: precision value: 92.75416666666668 - type: recall value: 94.69999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ceb-eng) config: ceb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 60.333333333333336 - type: f1 value: 55.31203703703703 - type: precision value: 53.39971108326371 - type: recall value: 60.333333333333336 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (bre-eng) config: bre-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 12.9 - type: f1 value: 11.099861903031458 - type: precision value: 10.589187932631877 - type: recall value: 12.9 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ben-eng) config: ben-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 86.7 - type: f1 value: 83.0152380952381 - type: precision value: 81.37833333333333 - type: recall value: 86.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (swg-eng) config: swg-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 63.39285714285714 - type: f1 value: 56.832482993197274 - type: precision value: 54.56845238095237 - type: recall value: 63.39285714285714 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (arq-eng) config: arq-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 48.73765093304062 - type: f1 value: 41.555736920720456 - type: precision value: 39.06874531737319 - type: recall value: 48.73765093304062 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kab-eng) config: kab-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 41.099999999999994 - type: f1 value: 36.540165945165946 - type: precision value: 35.05175685425686 - type: recall value: 41.099999999999994 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (fra-eng) config: fra-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.89999999999999 - type: f1 value: 93.42333333333333 - type: precision value: 92.75833333333333 - type: recall value: 94.89999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (por-eng) config: por-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.89999999999999 - type: f1 value: 93.63333333333334 - type: precision value: 93.01666666666665 - type: recall value: 94.89999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tat-eng) config: tat-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 77.9 - type: f1 value: 73.64833333333334 - type: precision value: 71.90282106782105 - type: recall value: 77.9 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (oci-eng) config: oci-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 59.4 - type: f1 value: 54.90521367521367 - type: precision value: 53.432840025471606 - type: recall value: 59.4 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (pol-eng) config: pol-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.39999999999999 - type: f1 value: 96.6 - type: precision value: 96.2 - type: recall value: 97.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (war-eng) config: war-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 67.2 - type: f1 value: 62.25926129426129 - type: precision value: 60.408376623376626 - type: recall value: 67.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (aze-eng) config: aze-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 90.2 - type: f1 value: 87.60666666666667 - type: precision value: 86.45277777777778 - type: recall value: 90.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (vie-eng) config: vie-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 97.7 - type: f1 value: 97 - type: precision value: 96.65 - type: recall value: 97.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (nno-eng) config: nno-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.2 - type: f1 value: 91.39746031746031 - type: precision value: 90.6125 - type: recall value: 93.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cha-eng) config: cha-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 32.11678832116788 - type: f1 value: 27.210415386260234 - type: precision value: 26.20408990846947 - type: recall value: 32.11678832116788 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (mhr-eng) config: mhr-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 8.5 - type: f1 value: 6.787319277832475 - type: precision value: 6.3452094433344435 - type: recall value: 8.5 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (dan-eng) config: dan-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.1 - type: f1 value: 95.08 - type: precision value: 94.61666666666667 - type: recall value: 96.1 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ell-eng) config: ell-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95.3 - type: f1 value: 93.88333333333333 - type: precision value: 93.18333333333332 - type: recall value: 95.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (amh-eng) config: amh-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 85.11904761904762 - type: f1 value: 80.69444444444444 - type: precision value: 78.72023809523809 - type: recall value: 85.11904761904762 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (pam-eng) config: pam-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 11.1 - type: f1 value: 9.276381801735853 - type: precision value: 8.798174603174601 - type: recall value: 11.1 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (hsb-eng) config: hsb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 63.56107660455487 - type: f1 value: 58.70433569191332 - type: precision value: 56.896926581464015 - type: recall value: 63.56107660455487 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (srp-eng) config: srp-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.69999999999999 - type: f1 value: 93.10000000000001 - type: precision value: 92.35 - type: recall value: 94.69999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (epo-eng) config: epo-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.8 - type: f1 value: 96.01222222222222 - type: precision value: 95.67083333333332 - type: recall value: 96.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kzj-eng) config: kzj-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 9.2 - type: f1 value: 7.911555250305249 - type: precision value: 7.631246556216846 - type: recall value: 9.2 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (awa-eng) config: awa-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 77.48917748917748 - type: f1 value: 72.27375798804371 - type: precision value: 70.14430014430013 - type: recall value: 77.48917748917748 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (fao-eng) config: fao-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 77.09923664122137 - type: f1 value: 72.61541257724463 - type: precision value: 70.8998380754106 - type: recall value: 77.09923664122137 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (mal-eng) config: mal-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 98.2532751091703 - type: f1 value: 97.69529354682193 - type: precision value: 97.42843279961184 - type: recall value: 98.2532751091703 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ile-eng) config: ile-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 82.8 - type: f1 value: 79.14672619047619 - type: precision value: 77.59489247311828 - type: recall value: 82.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (bos-eng) config: bos-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.35028248587571 - type: f1 value: 92.86252354048965 - type: precision value: 92.2080979284369 - type: recall value: 94.35028248587571 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cor-eng) config: cor-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 8.5 - type: f1 value: 6.282429263935621 - type: precision value: 5.783274240739785 - type: recall value: 8.5 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (cat-eng) config: cat-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 92.7 - type: f1 value: 91.025 - type: precision value: 90.30428571428571 - type: recall value: 92.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (eus-eng) config: eus-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 81 - type: f1 value: 77.8232380952381 - type: precision value: 76.60194444444444 - type: recall value: 81 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (yue-eng) config: yue-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 91 - type: f1 value: 88.70857142857142 - type: precision value: 87.7 - type: recall value: 91 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (swe-eng) config: swe-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.39999999999999 - type: f1 value: 95.3 - type: precision value: 94.76666666666667 - type: recall value: 96.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (dtp-eng) config: dtp-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 8.1 - type: f1 value: 7.001008218834307 - type: precision value: 6.708329562594269 - type: recall value: 8.1 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kat-eng) config: kat-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 87.1313672922252 - type: f1 value: 84.09070598748882 - type: precision value: 82.79171454104429 - type: recall value: 87.1313672922252 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (jpn-eng) config: jpn-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.39999999999999 - type: f1 value: 95.28333333333333 - type: precision value: 94.73333333333332 - type: recall value: 96.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (csb-eng) config: csb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 42.29249011857708 - type: f1 value: 36.981018542283365 - type: precision value: 35.415877813576024 - type: recall value: 42.29249011857708 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (xho-eng) config: xho-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 83.80281690140845 - type: f1 value: 80.86854460093896 - type: precision value: 79.60093896713614 - type: recall value: 83.80281690140845 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (orv-eng) config: orv-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 45.26946107784431 - type: f1 value: 39.80235464678088 - type: precision value: 38.14342660001342 - type: recall value: 45.26946107784431 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ind-eng) config: ind-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.3 - type: f1 value: 92.9 - type: precision value: 92.26666666666668 - type: recall value: 94.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tuk-eng) config: tuk-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 37.93103448275862 - type: f1 value: 33.15192743764172 - type: precision value: 31.57456528146183 - type: recall value: 37.93103448275862 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (max-eng) config: max-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 69.01408450704226 - type: f1 value: 63.41549295774648 - type: precision value: 61.342778895595806 - type: recall value: 69.01408450704226 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (swh-eng) config: swh-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 76.66666666666667 - type: f1 value: 71.60705960705961 - type: precision value: 69.60683760683762 - type: recall value: 76.66666666666667 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (hin-eng) config: hin-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 95.8 - type: f1 value: 94.48333333333333 - type: precision value: 93.83333333333333 - type: recall value: 95.8 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (dsb-eng) config: dsb-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 52.81837160751566 - type: f1 value: 48.435977731384824 - type: precision value: 47.11291973845539 - type: recall value: 52.81837160751566 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ber-eng) config: ber-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 44.9 - type: f1 value: 38.88962621607783 - type: precision value: 36.95936507936508 - type: recall value: 44.9 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tam-eng) config: tam-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 90.55374592833876 - type: f1 value: 88.22553125484721 - type: precision value: 87.26927252985884 - type: recall value: 90.55374592833876 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (slk-eng) config: slk-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 94.6 - type: f1 value: 93.13333333333333 - type: precision value: 92.45333333333333 - type: recall value: 94.6 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tgl-eng) config: tgl-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 93.7 - type: f1 value: 91.99666666666667 - type: precision value: 91.26666666666668 - type: recall value: 93.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ast-eng) config: ast-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 85.03937007874016 - type: f1 value: 81.75853018372703 - type: precision value: 80.34120734908137 - type: recall value: 85.03937007874016 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (mkd-eng) config: mkd-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 88.3 - type: f1 value: 85.5 - type: precision value: 84.25833333333334 - type: recall value: 88.3 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (khm-eng) config: khm-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 65.51246537396122 - type: f1 value: 60.02297410192148 - type: precision value: 58.133467727289236 - type: recall value: 65.51246537396122 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ces-eng) config: ces-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96 - type: f1 value: 94.89 - type: precision value: 94.39166666666667 - type: recall value: 96 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tzl-eng) config: tzl-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 57.692307692307686 - type: f1 value: 53.162393162393165 - type: precision value: 51.70673076923077 - type: recall value: 57.692307692307686 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (urd-eng) config: urd-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 91.60000000000001 - type: f1 value: 89.21190476190475 - type: precision value: 88.08666666666667 - type: recall value: 91.60000000000001 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (ara-eng) config: ara-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 88 - type: f1 value: 85.47 - type: precision value: 84.43266233766234 - type: recall value: 88 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (kor-eng) config: kor-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 92.7 - type: f1 value: 90.64999999999999 - type: precision value: 89.68333333333332 - type: recall value: 92.7 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (yid-eng) config: yid-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 80.30660377358491 - type: f1 value: 76.33044137466307 - type: precision value: 74.78970125786164 - type: recall value: 80.30660377358491 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (fin-eng) config: fin-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.39999999999999 - type: f1 value: 95.44 - type: precision value: 94.99166666666666 - type: recall value: 96.39999999999999 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (tha-eng) config: tha-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 96.53284671532847 - type: f1 value: 95.37712895377129 - type: precision value: 94.7992700729927 - type: recall value: 96.53284671532847 - task: type: BitextMining dataset: type: mteb/tatoeba-bitext-mining name: MTEB Tatoeba (wuu-eng) config: wuu-eng split: test revision: 9080400076fbadbb4c4dcb136ff4eddc40b42553 metrics: - type: accuracy value: 89 - type: f1 value: 86.23190476190476 - type: precision value: 85.035 - type: recall value: 89 - task: type: Retrieval dataset: type: webis-touche2020 name: MTEB Touche2020 config: default split: test revision: None metrics: - type: map_at_1 value: 2.585 - type: map_at_10 value: 9.012 - type: map_at_100 value: 14.027000000000001 - type: map_at_1000 value: 15.565000000000001 - type: map_at_3 value: 5.032 - type: map_at_5 value: 6.657 - type: mrr_at_1 value: 28.571 - type: mrr_at_10 value: 45.377 - type: mrr_at_100 value: 46.119 - type: mrr_at_1000 value: 46.127 - type: mrr_at_3 value: 41.156 - type: mrr_at_5 value: 42.585 - type: ndcg_at_1 value: 27.551 - type: ndcg_at_10 value: 23.395 - type: ndcg_at_100 value: 33.342 - type: ndcg_at_1000 value: 45.523 - type: ndcg_at_3 value: 25.158 - type: ndcg_at_5 value: 23.427 - type: precision_at_1 value: 28.571 - type: precision_at_10 value: 21.429000000000002 - type: precision_at_100 value: 6.714 - type: precision_at_1000 value: 1.473 - type: precision_at_3 value: 27.211000000000002 - type: precision_at_5 value: 24.490000000000002 - type: recall_at_1 value: 2.585 - type: recall_at_10 value: 15.418999999999999 - type: recall_at_100 value: 42.485 - type: recall_at_1000 value: 79.536 - type: recall_at_3 value: 6.239999999999999 - type: recall_at_5 value: 8.996 - task: type: Classification dataset: type: mteb/toxic_conversations_50k name: MTEB ToxicConversationsClassification config: default split: test revision: d7c0de2777da35d6aae2200a62c6e0e5af397c4c metrics: - type: accuracy value: 71.3234 - type: ap value: 14.361688653847423 - type: f1 value: 54.819068624319044 - task: type: Classification dataset: type: mteb/tweet_sentiment_extraction name: MTEB TweetSentimentExtractionClassification config: default split: test revision: d604517c81ca91fe16a244d1248fc021f9ecee7a metrics: - type: accuracy value: 61.97792869269949 - type: f1 value: 62.28965628513728 - task: type: Clustering dataset: type: mteb/twentynewsgroups-clustering name: MTEB TwentyNewsgroupsClustering config: default split: test revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 metrics: - type: v_measure value: 38.90540145385218 - task: type: PairClassification dataset: type: mteb/twittersemeval2015-pairclassification name: MTEB TwitterSemEval2015 config: default split: test revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 metrics: - type: cos_sim_accuracy value: 86.53513739047506 - type: cos_sim_ap value: 75.27741586677557 - type: cos_sim_f1 value: 69.18792902473774 - type: cos_sim_precision value: 67.94708725515136 - type: cos_sim_recall value: 70.47493403693932 - type: dot_accuracy value: 84.7052512368123 - type: dot_ap value: 69.36075482849378 - type: dot_f1 value: 64.44688376631296 - type: dot_precision value: 59.92288500793831 - type: dot_recall value: 69.70976253298153 - type: euclidean_accuracy value: 86.60666388508076 - type: euclidean_ap value: 75.47512772621097 - type: euclidean_f1 value: 69.413872536473 - type: euclidean_precision value: 67.39562624254472 - type: euclidean_recall value: 71.55672823218997 - type: manhattan_accuracy value: 86.52917684925792 - type: manhattan_ap value: 75.34000110496703 - type: manhattan_f1 value: 69.28489190226429 - type: manhattan_precision value: 67.24608889992551 - type: manhattan_recall value: 71.45118733509234 - type: max_accuracy value: 86.60666388508076 - type: max_ap value: 75.47512772621097 - type: max_f1 value: 69.413872536473 - task: type: PairClassification dataset: type: mteb/twitterurlcorpus-pairclassification name: MTEB TwitterURLCorpus config: default split: test revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf metrics: - type: cos_sim_accuracy value: 89.01695967710637 - type: cos_sim_ap value: 85.8298270742901 - type: cos_sim_f1 value: 78.46988128389272 - type: cos_sim_precision value: 74.86017897091722 - type: cos_sim_recall value: 82.44533415460425 - type: dot_accuracy value: 88.19420188613343 - type: dot_ap value: 83.82679165901324 - type: dot_f1 value: 76.55833777304208 - type: dot_precision value: 75.6884875846501 - type: dot_recall value: 77.44841392054204 - type: euclidean_accuracy value: 89.03054294252338 - type: euclidean_ap value: 85.89089555185325 - type: euclidean_f1 value: 78.62997658079624 - type: euclidean_precision value: 74.92329149232914 - type: euclidean_recall value: 82.72251308900523 - type: manhattan_accuracy value: 89.0266620095471 - type: manhattan_ap value: 85.86458997929147 - type: manhattan_f1 value: 78.50685331000291 - type: manhattan_precision value: 74.5499861534201 - type: manhattan_recall value: 82.90729904527257 - type: max_accuracy value: 89.03054294252338 - type: max_ap value: 85.89089555185325 - type: max_f1 value: 78.62997658079624 language: - multilingual - af - am - ar - as - az - be - bg - bn - br - bs - ca - cs - cy - da - de - el - en - eo - es - et - eu - fa - fi - fr - fy - ga - gd - gl - gu - ha - he - hi - hr - hu - hy - id - is - it - ja - jv - ka - kk - km - kn - ko - ku - ky - la - lo - lt - lv - mg - mk - ml - mn - mr - ms - my - ne - nl - 'no' - om - or - pa - pl - ps - pt - ro - ru - sa - sd - si - sk - sl - so - sq - sr - su - sv - sw - ta - te - th - tl - tr - ug - uk - ur - uz - vi - xh - yi - zh license: mit --- ## Multilingual-E5-large [Multilingual E5 Text Embeddings: A Technical Report](https://arxiv.org/pdf/2402.05672). Liang Wang, Nan Yang, Xiaolong Huang, Linjun Yang, Rangan Majumder, Furu Wei, arXiv 2024 This model has 24 layers and the embedding size is 1024. ## Usage Below is an example to encode queries and passages from the MS-MARCO passage ranking dataset. ```python import torch.nn.functional as F from torch import Tensor from transformers import AutoTokenizer, AutoModel def average_pool(last_hidden_states: Tensor, attention_mask: Tensor) -> Tensor: last_hidden = last_hidden_states.masked_fill(~attention_mask[..., None].bool(), 0.0) return last_hidden.sum(dim=1) / attention_mask.sum(dim=1)[..., None] # Each input text should start with "query: " or "passage: ", even for non-English texts. # For tasks other than retrieval, you can simply use the "query: " prefix. input_texts = ['query: how much protein should a female eat', 'query: 南瓜的家常做法', "passage: As a general guideline, the CDC's average requirement of protein for women ages 19 to 70 is 46 grams per day. But, as you can see from this chart, you'll need to increase that if you're expecting or training for a marathon. Check out the chart below to see how much protein you should be eating each day.", "passage: 1.清炒南瓜丝 原料:嫩南瓜半个 调料:葱、盐、白糖、鸡精 做法: 1、南瓜用刀薄薄的削去表面一层皮,用勺子刮去瓤 2、擦成细丝(没有擦菜板就用刀慢慢切成细丝) 3、锅烧热放油,入葱花煸出香味 4、入南瓜丝快速翻炒一分钟左右,放盐、一点白糖和鸡精调味出锅 2.香葱炒南瓜 原料:南瓜1只 调料:香葱、蒜末、橄榄油、盐 做法: 1、将南瓜去皮,切成片 2、油锅8成热后,将蒜末放入爆香 3、爆香后,将南瓜片放入,翻炒 4、在翻炒的同时,可以不时地往锅里加水,但不要太多 5、放入盐,炒匀 6、南瓜差不多软和绵了之后,就可以关火 7、撒入香葱,即可出锅"] tokenizer = AutoTokenizer.from_pretrained('intfloat/multilingual-e5-large') model = AutoModel.from_pretrained('intfloat/multilingual-e5-large') # Tokenize the input texts batch_dict = tokenizer(input_texts, max_length=512, padding=True, truncation=True, return_tensors='pt') outputs = model(**batch_dict) embeddings = average_pool(outputs.last_hidden_state, batch_dict['attention_mask']) # normalize embeddings embeddings = F.normalize(embeddings, p=2, dim=1) scores = (embeddings[:2] @ embeddings[2:].T) * 100 print(scores.tolist()) ``` ## Supported Languages This model is initialized from [xlm-roberta-large](https://huggingface.co/xlm-roberta-large) and continually trained on a mixture of multilingual datasets. It supports 100 languages from xlm-roberta, but low-resource languages may see performance degradation. ## Training Details **Initialization**: [xlm-roberta-large](https://huggingface.co/xlm-roberta-large) **First stage**: contrastive pre-training with weak supervision | Dataset | Weak supervision | # of text pairs | |--------------------------------------------------------------------------------------------------------|---------------------------------------|-----------------| | Filtered [mC4](https://huggingface.co/datasets/mc4) | (title, page content) | 1B | | [CC News](https://huggingface.co/datasets/intfloat/multilingual_cc_news) | (title, news content) | 400M | | [NLLB](https://huggingface.co/datasets/allenai/nllb) | translation pairs | 2.4B | | [Wikipedia](https://huggingface.co/datasets/intfloat/wikipedia) | (hierarchical section title, passage) | 150M | | Filtered [Reddit](https://www.reddit.com/) | (comment, response) | 800M | | [S2ORC](https://github.com/allenai/s2orc) | (title, abstract) and citation pairs | 100M | | [Stackexchange](https://stackexchange.com/) | (question, answer) | 50M | | [xP3](https://huggingface.co/datasets/bigscience/xP3) | (input prompt, response) | 80M | | [Miscellaneous unsupervised SBERT data](https://huggingface.co/sentence-transformers/all-MiniLM-L6-v2) | - | 10M | **Second stage**: supervised fine-tuning | Dataset | Language | # of text pairs | |----------------------------------------------------------------------------------------|--------------|-----------------| | [MS MARCO](https://microsoft.github.io/msmarco/) | English | 500k | | [NQ](https://github.com/facebookresearch/DPR) | English | 70k | | [Trivia QA](https://github.com/facebookresearch/DPR) | English | 60k | | [NLI from SimCSE](https://github.com/princeton-nlp/SimCSE) | English | <300k | | [ELI5](https://huggingface.co/datasets/eli5) | English | 500k | | [DuReader Retrieval](https://github.com/baidu/DuReader/tree/master/DuReader-Retrieval) | Chinese | 86k | | [KILT Fever](https://huggingface.co/datasets/kilt_tasks) | English | 70k | | [KILT HotpotQA](https://huggingface.co/datasets/kilt_tasks) | English | 70k | | [SQuAD](https://huggingface.co/datasets/squad) | English | 87k | | [Quora](https://huggingface.co/datasets/quora) | English | 150k | | [Mr. TyDi](https://huggingface.co/datasets/castorini/mr-tydi) | 11 languages | 50k | | [MIRACL](https://huggingface.co/datasets/miracl/miracl) | 16 languages | 40k | For all labeled datasets, we only use its training set for fine-tuning. For other training details, please refer to our paper at [https://arxiv.org/pdf/2402.05672](https://arxiv.org/pdf/2402.05672). ## Benchmark Results on [Mr. TyDi](https://arxiv.org/abs/2108.08787) | Model | Avg MRR@10 | | ar | bn | en | fi | id | ja | ko | ru | sw | te | th | |-----------------------|------------|-------|------| --- | --- | --- | --- | --- | --- | --- |------| --- | --- | | BM25 | 33.3 | | 36.7 | 41.3 | 15.1 | 28.8 | 38.2 | 21.7 | 28.1 | 32.9 | 39.6 | 42.4 | 41.7 | | mDPR | 16.7 | | 26.0 | 25.8 | 16.2 | 11.3 | 14.6 | 18.1 | 21.9 | 18.5 | 7.3 | 10.6 | 13.5 | | BM25 + mDPR | 41.7 | | 49.1 | 53.5 | 28.4 | 36.5 | 45.5 | 35.5 | 36.2 | 42.7 | 40.5 | 42.0 | 49.2 | | | | | multilingual-e5-small | 64.4 | | 71.5 | 66.3 | 54.5 | 57.7 | 63.2 | 55.4 | 54.3 | 60.8 | 65.4 | 89.1 | 70.1 | | multilingual-e5-base | 65.9 | | 72.3 | 65.0 | 58.5 | 60.8 | 64.9 | 56.6 | 55.8 | 62.7 | 69.0 | 86.6 | 72.7 | | multilingual-e5-large | **70.5** | | 77.5 | 73.2 | 60.8 | 66.8 | 68.5 | 62.5 | 61.6 | 65.8 | 72.7 | 90.2 | 76.2 | ## MTEB Benchmark Evaluation Check out [unilm/e5](https://github.com/microsoft/unilm/tree/master/e5) to reproduce evaluation results on the [BEIR](https://arxiv.org/abs/2104.08663) and [MTEB benchmark](https://arxiv.org/abs/2210.07316). ## Support for Sentence Transformers Below is an example for usage with sentence_transformers. ```python from sentence_transformers import SentenceTransformer model = SentenceTransformer('intfloat/multilingual-e5-large') input_texts = [ 'query: how much protein should a female eat', 'query: 南瓜的家常做法', "passage: As a general guideline, the CDC's average requirement of protein for women ages 19 to 70 i s 46 grams per day. But, as you can see from this chart, you'll need to increase that if you're expecting or traini ng for a marathon. Check out the chart below to see how much protein you should be eating each day.", "passage: 1.清炒南瓜丝 原料:嫩南瓜半个 调料:葱、盐、白糖、鸡精 做法: 1、南瓜用刀薄薄的削去表面一层皮 ,用勺子刮去瓤 2、擦成细丝(没有擦菜板就用刀慢慢切成细丝) 3、锅烧热放油,入葱花煸出香味 4、入南瓜丝快速翻炒一分钟左右, 放盐、一点白糖和鸡精调味出锅 2.香葱炒南瓜 原料:南瓜1只 调料:香葱、蒜末、橄榄油、盐 做法: 1、将南瓜去皮,切成片 2、油 锅8成热后,将蒜末放入爆香 3、爆香后,将南瓜片放入,翻炒 4、在翻炒的同时,可以不时地往锅里加水,但不要太多 5、放入盐,炒匀 6、南瓜差不多软和绵了之后,就可以关火 7、撒入香葱,即可出锅" ] embeddings = model.encode(input_texts, normalize_embeddings=True) ``` Package requirements `pip install sentence_transformers~=2.2.2` Contributors: [michaelfeil](https://huggingface.co/michaelfeil) ## FAQ **1. Do I need to add the prefix "query: " and "passage: " to input texts?** Yes, this is how the model is trained, otherwise you will see a performance degradation. Here are some rules of thumb: - Use "query: " and "passage: " correspondingly for asymmetric tasks such as passage retrieval in open QA, ad-hoc information retrieval. - Use "query: " prefix for symmetric tasks such as semantic similarity, bitext mining, paraphrase retrieval. - Use "query: " prefix if you want to use embeddings as features, such as linear probing classification, clustering. **2. Why are my reproduced results slightly different from reported in the model card?** Different versions of `transformers` and `pytorch` could cause negligible but non-zero performance differences. **3. Why does the cosine similarity scores distribute around 0.7 to 1.0?** This is a known and expected behavior as we use a low temperature 0.01 for InfoNCE contrastive loss. For text embedding tasks like text retrieval or semantic similarity, what matters is the relative order of the scores instead of the absolute values, so this should not be an issue. ## Citation If you find our paper or models helpful, please consider cite as follows: ``` @article{wang2024multilingual, title={Multilingual E5 Text Embeddings: A Technical Report}, author={Wang, Liang and Yang, Nan and Huang, Xiaolong and Yang, Linjun and Majumder, Rangan and Wei, Furu}, journal={arXiv preprint arXiv:2402.05672}, year={2024} } ``` ## Limitations Long texts will be truncated to at most 512 tokens.

Salesforce/blip-vqa-capfilt-large

Salesforce

transformers

visual-question-answering

--- pipeline_tag: visual-question-answering tags: - visual-question-answering inference: false languages: - en license: bsd-3-clause --- # BLIP: Bootstrapping Language-Image Pre-training for Unified Vision-Language Understanding and Generation Model card for BLIP trained on visual question answering - large architecture (with ViT large backbone). |  | |:--:| | <b> Pull figure from BLIP official repo | Image source: https://github.com/salesforce/BLIP </b>| ## TL;DR Authors from the [paper](https://arxiv.org/abs/2201.12086) write in the abstract: *Vision-Language Pre-training (VLP) has advanced the performance for many vision-language tasks. However, most existing pre-trained models only excel in either understanding-based tasks or generation-based tasks. Furthermore, performance improvement has been largely achieved by scaling up the dataset with noisy image-text pairs collected from the web, which is a suboptimal source of supervision. In this paper, we propose BLIP, a new VLP framework which transfers flexibly to both vision-language understanding and generation tasks. BLIP effectively utilizes the noisy web data by bootstrapping the captions, where a captioner generates synthetic captions and a filter removes the noisy ones. We achieve state-of-the-art results on a wide range of vision-language tasks, such as image-text retrieval (+2.7% in average recall@1), image captioning (+2.8% in CIDEr), and VQA (+1.6% in VQA score). BLIP also demonstrates strong generalization ability when directly transferred to videolanguage tasks in a zero-shot manner. Code, models, and datasets are released.* ## Usage You can use this model for conditional and un-conditional image captioning ### Using the Pytorch model #### Running the model on CPU <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import BlipProcessor, BlipForQuestionAnswering processor = BlipProcessor.from_pretrained("Salesforce/blip-vqa-capfilt-large") model = BlipForQuestionAnswering.from_pretrained("Salesforce/blip-vqa-capfilt-large") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') question = "how many dogs are in the picture?" inputs = processor(raw_image, question, return_tensors="pt") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) >>> 1 ``` </details> #### Running the model on GPU ##### In full precision <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import BlipProcessor, BlipForQuestionAnswering processor = BlipProcessor.from_pretrained("Salesforce/blip-vqa-capfilt-large") model = BlipForQuestionAnswering.from_pretrained("Salesforce/blip-vqa-capfilt-large").to("cuda") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') question = "how many dogs are in the picture?" inputs = processor(raw_image, question, return_tensors="pt").to("cuda") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) >>> 1 ``` </details> ##### In half precision (`float16`) <details> <summary> Click to expand </summary> ```python import torch import requests from PIL import Image from transformers import BlipProcessor, BlipForQuestionAnswering processor = BlipProcessor.from_pretrained("ybelkada/blip-vqa-capfilt-large") model = BlipForQuestionAnswering.from_pretrained("ybelkada/blip-vqa-capfilt-large", torch_dtype=torch.float16).to("cuda") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') question = "how many dogs are in the picture?" inputs = processor(raw_image, question, return_tensors="pt").to("cuda", torch.float16) out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) >>> 1 ``` </details> ## BibTex and citation info ``` @misc{https://doi.org/10.48550/arxiv.2201.12086, doi = {10.48550/ARXIV.2201.12086}, url = {https://arxiv.org/abs/2201.12086}, author = {Li, Junnan and Li, Dongxu and Xiong, Caiming and Hoi, Steven}, keywords = {Computer Vision and Pattern Recognition (cs.CV), FOS: Computer and information sciences, FOS: Computer and information sciences}, title = {BLIP: Bootstrapping Language-Image Pre-training for Unified Vision-Language Understanding and Generation}, publisher = {arXiv}, year = {2022}, copyright = {Creative Commons Attribution 4.0 International} } ```

Helsinki-NLP/opus-mt-es-en

Helsinki-NLP

transformers

translation

--- language: - es - en tags: - translation license: apache-2.0 --- ### spa-eng * source group: Spanish * target group: English * OPUS readme: [spa-eng](https://github.com/Helsinki-NLP/Tatoeba-Challenge/tree/master/models/spa-eng/README.md) * model: transformer * source language(s): spa * target language(s): eng * model: transformer * pre-processing: normalization + SentencePiece (spm32k,spm32k) * download original weights: [opus-2020-08-18.zip](https://object.pouta.csc.fi/Tatoeba-MT-models/spa-eng/opus-2020-08-18.zip) * test set translations: [opus-2020-08-18.test.txt](https://object.pouta.csc.fi/Tatoeba-MT-models/spa-eng/opus-2020-08-18.test.txt) * test set scores: [opus-2020-08-18.eval.txt](https://object.pouta.csc.fi/Tatoeba-MT-models/spa-eng/opus-2020-08-18.eval.txt) ## Benchmarks | testset | BLEU | chr-F | |-----------------------|-------|-------| | newssyscomb2009-spaeng.spa.eng | 30.6 | 0.570 | | news-test2008-spaeng.spa.eng | 27.9 | 0.553 | | newstest2009-spaeng.spa.eng | 30.4 | 0.572 | | newstest2010-spaeng.spa.eng | 36.1 | 0.614 | | newstest2011-spaeng.spa.eng | 34.2 | 0.599 | | newstest2012-spaeng.spa.eng | 37.9 | 0.624 | | newstest2013-spaeng.spa.eng | 35.3 | 0.609 | | Tatoeba-test.spa.eng | 59.6 | 0.739 | ### System Info: - hf_name: spa-eng - source_languages: spa - target_languages: eng - opus_readme_url: https://github.com/Helsinki-NLP/Tatoeba-Challenge/tree/master/models/spa-eng/README.md - original_repo: Tatoeba-Challenge - tags: ['translation'] - languages: ['es', 'en'] - src_constituents: {'spa'} - tgt_constituents: {'eng'} - src_multilingual: False - tgt_multilingual: False - prepro: normalization + SentencePiece (spm32k,spm32k) - url_model: https://object.pouta.csc.fi/Tatoeba-MT-models/spa-eng/opus-2020-08-18.zip - url_test_set: https://object.pouta.csc.fi/Tatoeba-MT-models/spa-eng/opus-2020-08-18.test.txt - src_alpha3: spa - tgt_alpha3: eng - short_pair: es-en - chrF2_score: 0.7390000000000001 - bleu: 59.6 - brevity_penalty: 0.9740000000000001 - ref_len: 79376.0 - src_name: Spanish - tgt_name: English - train_date: 2020-08-18 00:00:00 - src_alpha2: es - tgt_alpha2: en - prefer_old: False - long_pair: spa-eng - helsinki_git_sha: d2f0910c89026c34a44e331e785dec1e0faa7b82 - transformers_git_sha: f7af09b4524b784d67ae8526f0e2fcc6f5ed0de9 - port_machine: brutasse - port_time: 2020-08-24-18:20

ntu-spml/distilhubert

ntu-spml

transformers

feature-extraction

--- language: en datasets: - librispeech_asr tags: - speech license: apache-2.0 --- # DistilHuBERT [DistilHuBERT by NTU Speech Processing & Machine Learning Lab](https://github.com/s3prl/s3prl/tree/master/s3prl/upstream/distiller) The base model pretrained on 16kHz sampled speech audio. When using the model make sure that your speech input is also sampled at 16Khz. **Note**: This model does not have a tokenizer as it was pretrained on audio alone. In order to use this model **speech recognition**, a tokenizer should be created and the model should be fine-tuned on labeled text data. Check out [this blog](https://huggingface.co/blog/fine-tune-wav2vec2-english) for more in-detail explanation of how to fine-tune the model. Paper: [DistilHuBERT: Speech Representation Learning by Layer-wise Distillation of Hidden-unit BERT](https://arxiv.org/abs/2110.01900) Authors: Heng-Jui Chang, Shu-wen Yang, Hung-yi Lee **Abstract** Self-supervised speech representation learning methods like wav2vec 2.0 and Hidden-unit BERT (HuBERT) leverage unlabeled speech data for pre-training and offer good representations for numerous speech processing tasks. Despite the success of these methods, they require large memory and high pre-training costs, making them inaccessible for researchers in academia and small companies. Therefore, this paper introduces DistilHuBERT, a novel multi-task learning framework to distill hidden representations from a HuBERT model directly. This method reduces HuBERT's size by 75% and 73% faster while retaining most performance in ten different tasks. Moreover, DistilHuBERT required little training time and data, opening the possibilities of pre-training personal and on-device SSL models for speech. The original model can be found under https://github.com/s3prl/s3prl/tree/master/s3prl/upstream/distiller . # Usage See [this blog](https://huggingface.co/blog/fine-tune-wav2vec2-english) for more information on how to fine-tune the model. Note that the class `Wav2Vec2ForCTC` has to be replaced by `HubertForCTC`.

intfloat/e5-large-v2

intfloat

sentence-transformers

sentence-similarity

--- tags: - mteb - Sentence Transformers - sentence-similarity - sentence-transformers model-index: - name: e5-large-v2 results: - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en) config: en split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 79.22388059701493 - type: ap value: 43.20816505595132 - type: f1 value: 73.27811303522058 - task: type: Classification dataset: type: mteb/amazon_polarity name: MTEB AmazonPolarityClassification config: default split: test revision: e2d317d38cd51312af73b3d32a06d1a08b442046 metrics: - type: accuracy value: 93.748325 - type: ap value: 90.72534979701297 - type: f1 value: 93.73895874282185 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (en) config: en split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 48.612 - type: f1 value: 47.61157345898393 - task: type: Retrieval dataset: type: arguana name: MTEB ArguAna config: default split: test revision: None metrics: - type: map_at_1 value: 23.541999999999998 - type: map_at_10 value: 38.208 - type: map_at_100 value: 39.417 - type: map_at_1000 value: 39.428999999999995 - type: map_at_3 value: 33.95 - type: map_at_5 value: 36.329 - type: mrr_at_1 value: 23.755000000000003 - type: mrr_at_10 value: 38.288 - type: mrr_at_100 value: 39.511 - type: mrr_at_1000 value: 39.523 - type: mrr_at_3 value: 34.009 - type: mrr_at_5 value: 36.434 - type: ndcg_at_1 value: 23.541999999999998 - type: ndcg_at_10 value: 46.417 - type: ndcg_at_100 value: 51.812000000000005 - type: ndcg_at_1000 value: 52.137 - type: ndcg_at_3 value: 37.528 - type: ndcg_at_5 value: 41.81 - type: precision_at_1 value: 23.541999999999998 - type: precision_at_10 value: 7.269 - type: precision_at_100 value: 0.9690000000000001 - type: precision_at_1000 value: 0.099 - type: precision_at_3 value: 15.979 - type: precision_at_5 value: 11.664 - type: recall_at_1 value: 23.541999999999998 - type: recall_at_10 value: 72.688 - type: recall_at_100 value: 96.871 - type: recall_at_1000 value: 99.431 - type: recall_at_3 value: 47.937000000000005 - type: recall_at_5 value: 58.321 - task: type: Clustering dataset: type: mteb/arxiv-clustering-p2p name: MTEB ArxivClusteringP2P config: default split: test revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d metrics: - type: v_measure value: 45.546499570522094 - task: type: Clustering dataset: type: mteb/arxiv-clustering-s2s name: MTEB ArxivClusteringS2S config: default split: test revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 metrics: - type: v_measure value: 41.01607489943561 - task: type: Reranking dataset: type: mteb/askubuntudupquestions-reranking name: MTEB AskUbuntuDupQuestions config: default split: test revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 metrics: - type: map value: 59.616107510107774 - type: mrr value: 72.75106626214661 - task: type: STS dataset: type: mteb/biosses-sts name: MTEB BIOSSES config: default split: test revision: d3fb88f8f02e40887cd149695127462bbcf29b4a metrics: - type: cos_sim_pearson value: 84.33018094733868 - type: cos_sim_spearman value: 83.60190492611737 - type: euclidean_pearson value: 82.1492450218961 - type: euclidean_spearman value: 82.70308926526991 - type: manhattan_pearson value: 81.93959600076842 - type: manhattan_spearman value: 82.73260801016369 - task: type: Classification dataset: type: mteb/banking77 name: MTEB Banking77Classification config: default split: test revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 metrics: - type: accuracy value: 84.54545454545455 - type: f1 value: 84.49582530928923 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-p2p name: MTEB BiorxivClusteringP2P config: default split: test revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 metrics: - type: v_measure value: 37.362725540120096 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-s2s name: MTEB BiorxivClusteringS2S config: default split: test revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 metrics: - type: v_measure value: 34.849509608178145 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackAndroidRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 31.502999999999997 - type: map_at_10 value: 43.323 - type: map_at_100 value: 44.708999999999996 - type: map_at_1000 value: 44.838 - type: map_at_3 value: 38.987 - type: map_at_5 value: 41.516999999999996 - type: mrr_at_1 value: 38.769999999999996 - type: mrr_at_10 value: 49.13 - type: mrr_at_100 value: 49.697 - type: mrr_at_1000 value: 49.741 - type: mrr_at_3 value: 45.804 - type: mrr_at_5 value: 47.842 - type: ndcg_at_1 value: 38.769999999999996 - type: ndcg_at_10 value: 50.266999999999996 - type: ndcg_at_100 value: 54.967 - type: ndcg_at_1000 value: 56.976000000000006 - type: ndcg_at_3 value: 43.823 - type: ndcg_at_5 value: 47.12 - type: precision_at_1 value: 38.769999999999996 - type: precision_at_10 value: 10.057 - type: precision_at_100 value: 1.554 - type: precision_at_1000 value: 0.202 - type: precision_at_3 value: 21.125 - type: precision_at_5 value: 15.851 - type: recall_at_1 value: 31.502999999999997 - type: recall_at_10 value: 63.715999999999994 - type: recall_at_100 value: 83.61800000000001 - type: recall_at_1000 value: 96.63199999999999 - type: recall_at_3 value: 45.403 - type: recall_at_5 value: 54.481 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackEnglishRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 27.833000000000002 - type: map_at_10 value: 37.330999999999996 - type: map_at_100 value: 38.580999999999996 - type: map_at_1000 value: 38.708 - type: map_at_3 value: 34.713 - type: map_at_5 value: 36.104 - type: mrr_at_1 value: 35.223 - type: mrr_at_10 value: 43.419000000000004 - type: mrr_at_100 value: 44.198 - type: mrr_at_1000 value: 44.249 - type: mrr_at_3 value: 41.614000000000004 - type: mrr_at_5 value: 42.553000000000004 - type: ndcg_at_1 value: 35.223 - type: ndcg_at_10 value: 42.687999999999995 - type: ndcg_at_100 value: 47.447 - type: ndcg_at_1000 value: 49.701 - type: ndcg_at_3 value: 39.162 - type: ndcg_at_5 value: 40.557 - type: precision_at_1 value: 35.223 - type: precision_at_10 value: 7.962 - type: precision_at_100 value: 1.304 - type: precision_at_1000 value: 0.18 - type: precision_at_3 value: 19.023 - type: precision_at_5 value: 13.184999999999999 - type: recall_at_1 value: 27.833000000000002 - type: recall_at_10 value: 51.881 - type: recall_at_100 value: 72.04 - type: recall_at_1000 value: 86.644 - type: recall_at_3 value: 40.778 - type: recall_at_5 value: 45.176 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGamingRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 38.175 - type: map_at_10 value: 51.174 - type: map_at_100 value: 52.26499999999999 - type: map_at_1000 value: 52.315999999999995 - type: map_at_3 value: 47.897 - type: map_at_5 value: 49.703 - type: mrr_at_1 value: 43.448 - type: mrr_at_10 value: 54.505 - type: mrr_at_100 value: 55.216 - type: mrr_at_1000 value: 55.242000000000004 - type: mrr_at_3 value: 51.98500000000001 - type: mrr_at_5 value: 53.434000000000005 - type: ndcg_at_1 value: 43.448 - type: ndcg_at_10 value: 57.282 - type: ndcg_at_100 value: 61.537 - type: ndcg_at_1000 value: 62.546 - type: ndcg_at_3 value: 51.73799999999999 - type: ndcg_at_5 value: 54.324 - type: precision_at_1 value: 43.448 - type: precision_at_10 value: 9.292 - type: precision_at_100 value: 1.233 - type: precision_at_1000 value: 0.136 - type: precision_at_3 value: 23.218 - type: precision_at_5 value: 15.887 - type: recall_at_1 value: 38.175 - type: recall_at_10 value: 72.00999999999999 - type: recall_at_100 value: 90.155 - type: recall_at_1000 value: 97.257 - type: recall_at_3 value: 57.133 - type: recall_at_5 value: 63.424 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGisRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 22.405 - type: map_at_10 value: 30.043 - type: map_at_100 value: 31.191000000000003 - type: map_at_1000 value: 31.275 - type: map_at_3 value: 27.034000000000002 - type: map_at_5 value: 28.688000000000002 - type: mrr_at_1 value: 24.068 - type: mrr_at_10 value: 31.993 - type: mrr_at_100 value: 32.992 - type: mrr_at_1000 value: 33.050000000000004 - type: mrr_at_3 value: 28.964000000000002 - type: mrr_at_5 value: 30.653000000000002 - type: ndcg_at_1 value: 24.068 - type: ndcg_at_10 value: 35.198 - type: ndcg_at_100 value: 40.709 - type: ndcg_at_1000 value: 42.855 - type: ndcg_at_3 value: 29.139 - type: ndcg_at_5 value: 32.045 - type: precision_at_1 value: 24.068 - type: precision_at_10 value: 5.65 - type: precision_at_100 value: 0.885 - type: precision_at_1000 value: 0.11199999999999999 - type: precision_at_3 value: 12.279 - type: precision_at_5 value: 8.994 - type: recall_at_1 value: 22.405 - type: recall_at_10 value: 49.391 - type: recall_at_100 value: 74.53699999999999 - type: recall_at_1000 value: 90.605 - type: recall_at_3 value: 33.126 - type: recall_at_5 value: 40.073 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackMathematicaRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 13.309999999999999 - type: map_at_10 value: 20.688000000000002 - type: map_at_100 value: 22.022 - type: map_at_1000 value: 22.152 - type: map_at_3 value: 17.954 - type: map_at_5 value: 19.439 - type: mrr_at_1 value: 16.294 - type: mrr_at_10 value: 24.479 - type: mrr_at_100 value: 25.515 - type: mrr_at_1000 value: 25.593 - type: mrr_at_3 value: 21.642 - type: mrr_at_5 value: 23.189999999999998 - type: ndcg_at_1 value: 16.294 - type: ndcg_at_10 value: 25.833000000000002 - type: ndcg_at_100 value: 32.074999999999996 - type: ndcg_at_1000 value: 35.083 - type: ndcg_at_3 value: 20.493 - type: ndcg_at_5 value: 22.949 - type: precision_at_1 value: 16.294 - type: precision_at_10 value: 5.112 - type: precision_at_100 value: 0.96 - type: precision_at_1000 value: 0.134 - type: precision_at_3 value: 9.908999999999999 - type: precision_at_5 value: 7.587000000000001 - type: recall_at_1 value: 13.309999999999999 - type: recall_at_10 value: 37.851 - type: recall_at_100 value: 64.835 - type: recall_at_1000 value: 86.334 - type: recall_at_3 value: 23.493 - type: recall_at_5 value: 29.528 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackPhysicsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 25.857999999999997 - type: map_at_10 value: 35.503 - type: map_at_100 value: 36.957 - type: map_at_1000 value: 37.065 - type: map_at_3 value: 32.275999999999996 - type: map_at_5 value: 34.119 - type: mrr_at_1 value: 31.954 - type: mrr_at_10 value: 40.851 - type: mrr_at_100 value: 41.863 - type: mrr_at_1000 value: 41.900999999999996 - type: mrr_at_3 value: 38.129999999999995 - type: mrr_at_5 value: 39.737 - type: ndcg_at_1 value: 31.954 - type: ndcg_at_10 value: 41.343999999999994 - type: ndcg_at_100 value: 47.397 - type: ndcg_at_1000 value: 49.501 - type: ndcg_at_3 value: 36.047000000000004 - type: ndcg_at_5 value: 38.639 - type: precision_at_1 value: 31.954 - type: precision_at_10 value: 7.68 - type: precision_at_100 value: 1.247 - type: precision_at_1000 value: 0.16199999999999998 - type: precision_at_3 value: 17.132 - type: precision_at_5 value: 12.589 - type: recall_at_1 value: 25.857999999999997 - type: recall_at_10 value: 53.43599999999999 - type: recall_at_100 value: 78.82400000000001 - type: recall_at_1000 value: 92.78999999999999 - type: recall_at_3 value: 38.655 - type: recall_at_5 value: 45.216 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackProgrammersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 24.709 - type: map_at_10 value: 34.318 - type: map_at_100 value: 35.657 - type: map_at_1000 value: 35.783 - type: map_at_3 value: 31.326999999999998 - type: map_at_5 value: 33.021 - type: mrr_at_1 value: 30.137000000000004 - type: mrr_at_10 value: 39.093 - type: mrr_at_100 value: 39.992 - type: mrr_at_1000 value: 40.056999999999995 - type: mrr_at_3 value: 36.606 - type: mrr_at_5 value: 37.861 - type: ndcg_at_1 value: 30.137000000000004 - type: ndcg_at_10 value: 39.974 - type: ndcg_at_100 value: 45.647999999999996 - type: ndcg_at_1000 value: 48.259 - type: ndcg_at_3 value: 35.028 - type: ndcg_at_5 value: 37.175999999999995 - type: precision_at_1 value: 30.137000000000004 - type: precision_at_10 value: 7.363 - type: precision_at_100 value: 1.184 - type: precision_at_1000 value: 0.161 - type: precision_at_3 value: 16.857 - type: precision_at_5 value: 11.963 - type: recall_at_1 value: 24.709 - type: recall_at_10 value: 52.087 - type: recall_at_100 value: 76.125 - type: recall_at_1000 value: 93.82300000000001 - type: recall_at_3 value: 38.149 - type: recall_at_5 value: 43.984 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 23.40791666666667 - type: map_at_10 value: 32.458083333333335 - type: map_at_100 value: 33.691916666666664 - type: map_at_1000 value: 33.81191666666666 - type: map_at_3 value: 29.51625 - type: map_at_5 value: 31.168083333333335 - type: mrr_at_1 value: 27.96591666666666 - type: mrr_at_10 value: 36.528583333333344 - type: mrr_at_100 value: 37.404 - type: mrr_at_1000 value: 37.464333333333336 - type: mrr_at_3 value: 33.92883333333333 - type: mrr_at_5 value: 35.41933333333333 - type: ndcg_at_1 value: 27.96591666666666 - type: ndcg_at_10 value: 37.89141666666666 - type: ndcg_at_100 value: 43.23066666666666 - type: ndcg_at_1000 value: 45.63258333333333 - type: ndcg_at_3 value: 32.811249999999994 - type: ndcg_at_5 value: 35.22566666666667 - type: precision_at_1 value: 27.96591666666666 - type: precision_at_10 value: 6.834083333333332 - type: precision_at_100 value: 1.12225 - type: precision_at_1000 value: 0.15241666666666667 - type: precision_at_3 value: 15.264333333333335 - type: precision_at_5 value: 11.039416666666666 - type: recall_at_1 value: 23.40791666666667 - type: recall_at_10 value: 49.927083333333336 - type: recall_at_100 value: 73.44641666666668 - type: recall_at_1000 value: 90.19950000000001 - type: recall_at_3 value: 35.88341666666667 - type: recall_at_5 value: 42.061249999999994 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackStatsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 19.592000000000002 - type: map_at_10 value: 26.895999999999997 - type: map_at_100 value: 27.921000000000003 - type: map_at_1000 value: 28.02 - type: map_at_3 value: 24.883 - type: map_at_5 value: 25.812 - type: mrr_at_1 value: 22.698999999999998 - type: mrr_at_10 value: 29.520999999999997 - type: mrr_at_100 value: 30.458000000000002 - type: mrr_at_1000 value: 30.526999999999997 - type: mrr_at_3 value: 27.633000000000003 - type: mrr_at_5 value: 28.483999999999998 - type: ndcg_at_1 value: 22.698999999999998 - type: ndcg_at_10 value: 31.061 - type: ndcg_at_100 value: 36.398 - type: ndcg_at_1000 value: 38.89 - type: ndcg_at_3 value: 27.149 - type: ndcg_at_5 value: 28.627000000000002 - type: precision_at_1 value: 22.698999999999998 - type: precision_at_10 value: 5.106999999999999 - type: precision_at_100 value: 0.857 - type: precision_at_1000 value: 0.11499999999999999 - type: precision_at_3 value: 11.963 - type: precision_at_5 value: 8.221 - type: recall_at_1 value: 19.592000000000002 - type: recall_at_10 value: 41.329 - type: recall_at_100 value: 66.094 - type: recall_at_1000 value: 84.511 - type: recall_at_3 value: 30.61 - type: recall_at_5 value: 34.213 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackTexRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 14.71 - type: map_at_10 value: 20.965 - type: map_at_100 value: 21.994 - type: map_at_1000 value: 22.133 - type: map_at_3 value: 18.741 - type: map_at_5 value: 19.951 - type: mrr_at_1 value: 18.307000000000002 - type: mrr_at_10 value: 24.66 - type: mrr_at_100 value: 25.540000000000003 - type: mrr_at_1000 value: 25.629 - type: mrr_at_3 value: 22.511 - type: mrr_at_5 value: 23.72 - type: ndcg_at_1 value: 18.307000000000002 - type: ndcg_at_10 value: 25.153 - type: ndcg_at_100 value: 30.229 - type: ndcg_at_1000 value: 33.623 - type: ndcg_at_3 value: 21.203 - type: ndcg_at_5 value: 23.006999999999998 - type: precision_at_1 value: 18.307000000000002 - type: precision_at_10 value: 4.725 - type: precision_at_100 value: 0.8659999999999999 - type: precision_at_1000 value: 0.133 - type: precision_at_3 value: 10.14 - type: precision_at_5 value: 7.481 - type: recall_at_1 value: 14.71 - type: recall_at_10 value: 34.087 - type: recall_at_100 value: 57.147999999999996 - type: recall_at_1000 value: 81.777 - type: recall_at_3 value: 22.996 - type: recall_at_5 value: 27.73 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackUnixRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 23.472 - type: map_at_10 value: 32.699 - type: map_at_100 value: 33.867000000000004 - type: map_at_1000 value: 33.967000000000006 - type: map_at_3 value: 29.718 - type: map_at_5 value: 31.345 - type: mrr_at_1 value: 28.265 - type: mrr_at_10 value: 36.945 - type: mrr_at_100 value: 37.794 - type: mrr_at_1000 value: 37.857 - type: mrr_at_3 value: 34.266000000000005 - type: mrr_at_5 value: 35.768 - type: ndcg_at_1 value: 28.265 - type: ndcg_at_10 value: 38.35 - type: ndcg_at_100 value: 43.739 - type: ndcg_at_1000 value: 46.087 - type: ndcg_at_3 value: 33.004 - type: ndcg_at_5 value: 35.411 - type: precision_at_1 value: 28.265 - type: precision_at_10 value: 6.715999999999999 - type: precision_at_100 value: 1.059 - type: precision_at_1000 value: 0.13799999999999998 - type: precision_at_3 value: 15.299 - type: precision_at_5 value: 10.951 - type: recall_at_1 value: 23.472 - type: recall_at_10 value: 51.413 - type: recall_at_100 value: 75.17 - type: recall_at_1000 value: 91.577 - type: recall_at_3 value: 36.651 - type: recall_at_5 value: 42.814 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWebmastersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 23.666 - type: map_at_10 value: 32.963 - type: map_at_100 value: 34.544999999999995 - type: map_at_1000 value: 34.792 - type: map_at_3 value: 29.74 - type: map_at_5 value: 31.5 - type: mrr_at_1 value: 29.051 - type: mrr_at_10 value: 38.013000000000005 - type: mrr_at_100 value: 38.997 - type: mrr_at_1000 value: 39.055 - type: mrr_at_3 value: 34.947 - type: mrr_at_5 value: 36.815 - type: ndcg_at_1 value: 29.051 - type: ndcg_at_10 value: 39.361000000000004 - type: ndcg_at_100 value: 45.186 - type: ndcg_at_1000 value: 47.867 - type: ndcg_at_3 value: 33.797 - type: ndcg_at_5 value: 36.456 - type: precision_at_1 value: 29.051 - type: precision_at_10 value: 7.668 - type: precision_at_100 value: 1.532 - type: precision_at_1000 value: 0.247 - type: precision_at_3 value: 15.876000000000001 - type: precision_at_5 value: 11.779 - type: recall_at_1 value: 23.666 - type: recall_at_10 value: 51.858000000000004 - type: recall_at_100 value: 77.805 - type: recall_at_1000 value: 94.504 - type: recall_at_3 value: 36.207 - type: recall_at_5 value: 43.094 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWordpressRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 15.662 - type: map_at_10 value: 23.594 - type: map_at_100 value: 24.593999999999998 - type: map_at_1000 value: 24.694 - type: map_at_3 value: 20.925 - type: map_at_5 value: 22.817999999999998 - type: mrr_at_1 value: 17.375 - type: mrr_at_10 value: 25.734 - type: mrr_at_100 value: 26.586 - type: mrr_at_1000 value: 26.671 - type: mrr_at_3 value: 23.044 - type: mrr_at_5 value: 24.975 - type: ndcg_at_1 value: 17.375 - type: ndcg_at_10 value: 28.186 - type: ndcg_at_100 value: 33.436 - type: ndcg_at_1000 value: 36.203 - type: ndcg_at_3 value: 23.152 - type: ndcg_at_5 value: 26.397 - type: precision_at_1 value: 17.375 - type: precision_at_10 value: 4.677 - type: precision_at_100 value: 0.786 - type: precision_at_1000 value: 0.109 - type: precision_at_3 value: 10.351 - type: precision_at_5 value: 7.985 - type: recall_at_1 value: 15.662 - type: recall_at_10 value: 40.066 - type: recall_at_100 value: 65.006 - type: recall_at_1000 value: 85.94000000000001 - type: recall_at_3 value: 27.400000000000002 - type: recall_at_5 value: 35.002 - task: type: Retrieval dataset: type: climate-fever name: MTEB ClimateFEVER config: default split: test revision: None metrics: - type: map_at_1 value: 8.853 - type: map_at_10 value: 15.568000000000001 - type: map_at_100 value: 17.383000000000003 - type: map_at_1000 value: 17.584 - type: map_at_3 value: 12.561 - type: map_at_5 value: 14.056 - type: mrr_at_1 value: 18.958 - type: mrr_at_10 value: 28.288000000000004 - type: mrr_at_100 value: 29.432000000000002 - type: mrr_at_1000 value: 29.498 - type: mrr_at_3 value: 25.049 - type: mrr_at_5 value: 26.857 - type: ndcg_at_1 value: 18.958 - type: ndcg_at_10 value: 22.21 - type: ndcg_at_100 value: 29.596 - type: ndcg_at_1000 value: 33.583 - type: ndcg_at_3 value: 16.994999999999997 - type: ndcg_at_5 value: 18.95 - type: precision_at_1 value: 18.958 - type: precision_at_10 value: 7.192 - type: precision_at_100 value: 1.5 - type: precision_at_1000 value: 0.22399999999999998 - type: precision_at_3 value: 12.573 - type: precision_at_5 value: 10.202 - type: recall_at_1 value: 8.853 - type: recall_at_10 value: 28.087 - type: recall_at_100 value: 53.701 - type: recall_at_1000 value: 76.29899999999999 - type: recall_at_3 value: 15.913 - type: recall_at_5 value: 20.658 - task: type: Retrieval dataset: type: dbpedia-entity name: MTEB DBPedia config: default split: test revision: None metrics: - type: map_at_1 value: 9.077 - type: map_at_10 value: 20.788999999999998 - type: map_at_100 value: 30.429000000000002 - type: map_at_1000 value: 32.143 - type: map_at_3 value: 14.692 - type: map_at_5 value: 17.139 - type: mrr_at_1 value: 70.75 - type: mrr_at_10 value: 78.036 - type: mrr_at_100 value: 78.401 - type: mrr_at_1000 value: 78.404 - type: mrr_at_3 value: 76.75 - type: mrr_at_5 value: 77.47500000000001 - type: ndcg_at_1 value: 58.12500000000001 - type: ndcg_at_10 value: 44.015 - type: ndcg_at_100 value: 49.247 - type: ndcg_at_1000 value: 56.211999999999996 - type: ndcg_at_3 value: 49.151 - type: ndcg_at_5 value: 46.195 - type: precision_at_1 value: 70.75 - type: precision_at_10 value: 35.5 - type: precision_at_100 value: 11.355 - type: precision_at_1000 value: 2.1950000000000003 - type: precision_at_3 value: 53.083000000000006 - type: precision_at_5 value: 44.800000000000004 - type: recall_at_1 value: 9.077 - type: recall_at_10 value: 26.259 - type: recall_at_100 value: 56.547000000000004 - type: recall_at_1000 value: 78.551 - type: recall_at_3 value: 16.162000000000003 - type: recall_at_5 value: 19.753999999999998 - task: type: Classification dataset: type: mteb/emotion name: MTEB EmotionClassification config: default split: test revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 metrics: - type: accuracy value: 49.44500000000001 - type: f1 value: 44.67067691783401 - task: type: Retrieval dataset: type: fever name: MTEB FEVER config: default split: test revision: None metrics: - type: map_at_1 value: 68.182 - type: map_at_10 value: 78.223 - type: map_at_100 value: 78.498 - type: map_at_1000 value: 78.512 - type: map_at_3 value: 76.71 - type: map_at_5 value: 77.725 - type: mrr_at_1 value: 73.177 - type: mrr_at_10 value: 82.513 - type: mrr_at_100 value: 82.633 - type: mrr_at_1000 value: 82.635 - type: mrr_at_3 value: 81.376 - type: mrr_at_5 value: 82.182 - type: ndcg_at_1 value: 73.177 - type: ndcg_at_10 value: 82.829 - type: ndcg_at_100 value: 83.84 - type: ndcg_at_1000 value: 84.07900000000001 - type: ndcg_at_3 value: 80.303 - type: ndcg_at_5 value: 81.846 - type: precision_at_1 value: 73.177 - type: precision_at_10 value: 10.241999999999999 - type: precision_at_100 value: 1.099 - type: precision_at_1000 value: 0.11399999999999999 - type: precision_at_3 value: 31.247999999999998 - type: precision_at_5 value: 19.697 - type: recall_at_1 value: 68.182 - type: recall_at_10 value: 92.657 - type: recall_at_100 value: 96.709 - type: recall_at_1000 value: 98.184 - type: recall_at_3 value: 85.9 - type: recall_at_5 value: 89.755 - task: type: Retrieval dataset: type: fiqa name: MTEB FiQA2018 config: default split: test revision: None metrics: - type: map_at_1 value: 21.108 - type: map_at_10 value: 33.342 - type: map_at_100 value: 35.281 - type: map_at_1000 value: 35.478 - type: map_at_3 value: 29.067 - type: map_at_5 value: 31.563000000000002 - type: mrr_at_1 value: 41.667 - type: mrr_at_10 value: 49.913000000000004 - type: mrr_at_100 value: 50.724000000000004 - type: mrr_at_1000 value: 50.766 - type: mrr_at_3 value: 47.504999999999995 - type: mrr_at_5 value: 49.033 - type: ndcg_at_1 value: 41.667 - type: ndcg_at_10 value: 41.144 - type: ndcg_at_100 value: 48.326 - type: ndcg_at_1000 value: 51.486 - type: ndcg_at_3 value: 37.486999999999995 - type: ndcg_at_5 value: 38.78 - type: precision_at_1 value: 41.667 - type: precision_at_10 value: 11.358 - type: precision_at_100 value: 1.873 - type: precision_at_1000 value: 0.244 - type: precision_at_3 value: 25 - type: precision_at_5 value: 18.519 - type: recall_at_1 value: 21.108 - type: recall_at_10 value: 47.249 - type: recall_at_100 value: 74.52 - type: recall_at_1000 value: 93.31 - type: recall_at_3 value: 33.271 - type: recall_at_5 value: 39.723000000000006 - task: type: Retrieval dataset: type: hotpotqa name: MTEB HotpotQA config: default split: test revision: None metrics: - type: map_at_1 value: 40.317 - type: map_at_10 value: 64.861 - type: map_at_100 value: 65.697 - type: map_at_1000 value: 65.755 - type: map_at_3 value: 61.258 - type: map_at_5 value: 63.590999999999994 - type: mrr_at_1 value: 80.635 - type: mrr_at_10 value: 86.528 - type: mrr_at_100 value: 86.66199999999999 - type: mrr_at_1000 value: 86.666 - type: mrr_at_3 value: 85.744 - type: mrr_at_5 value: 86.24300000000001 - type: ndcg_at_1 value: 80.635 - type: ndcg_at_10 value: 73.13199999999999 - type: ndcg_at_100 value: 75.927 - type: ndcg_at_1000 value: 76.976 - type: ndcg_at_3 value: 68.241 - type: ndcg_at_5 value: 71.071 - type: precision_at_1 value: 80.635 - type: precision_at_10 value: 15.326 - type: precision_at_100 value: 1.7500000000000002 - type: precision_at_1000 value: 0.189 - type: precision_at_3 value: 43.961 - type: precision_at_5 value: 28.599999999999998 - type: recall_at_1 value: 40.317 - type: recall_at_10 value: 76.631 - type: recall_at_100 value: 87.495 - type: recall_at_1000 value: 94.362 - type: recall_at_3 value: 65.94200000000001 - type: recall_at_5 value: 71.499 - task: type: Classification dataset: type: mteb/imdb name: MTEB ImdbClassification config: default split: test revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 metrics: - type: accuracy value: 91.686 - type: ap value: 87.5577120393173 - type: f1 value: 91.6629447355139 - task: type: Retrieval dataset: type: msmarco name: MTEB MSMARCO config: default split: dev revision: None metrics: - type: map_at_1 value: 23.702 - type: map_at_10 value: 36.414 - type: map_at_100 value: 37.561 - type: map_at_1000 value: 37.605 - type: map_at_3 value: 32.456 - type: map_at_5 value: 34.827000000000005 - type: mrr_at_1 value: 24.355 - type: mrr_at_10 value: 37.01 - type: mrr_at_100 value: 38.085 - type: mrr_at_1000 value: 38.123000000000005 - type: mrr_at_3 value: 33.117999999999995 - type: mrr_at_5 value: 35.452 - type: ndcg_at_1 value: 24.384 - type: ndcg_at_10 value: 43.456 - type: ndcg_at_100 value: 48.892 - type: ndcg_at_1000 value: 49.964 - type: ndcg_at_3 value: 35.475 - type: ndcg_at_5 value: 39.711 - type: precision_at_1 value: 24.384 - type: precision_at_10 value: 6.7940000000000005 - type: precision_at_100 value: 0.951 - type: precision_at_1000 value: 0.104 - type: precision_at_3 value: 15.052999999999999 - type: precision_at_5 value: 11.189 - type: recall_at_1 value: 23.702 - type: recall_at_10 value: 65.057 - type: recall_at_100 value: 90.021 - type: recall_at_1000 value: 98.142 - type: recall_at_3 value: 43.551 - type: recall_at_5 value: 53.738 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (en) config: en split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 94.62380300957591 - type: f1 value: 94.49871222100734 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (en) config: en split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 77.14090287277702 - type: f1 value: 60.32101258220515 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (en) config: en split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 73.84330867518494 - type: f1 value: 71.92248688515255 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (en) config: en split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 78.10692669804976 - type: f1 value: 77.9904839122866 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-p2p name: MTEB MedrxivClusteringP2P config: default split: test revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 metrics: - type: v_measure value: 31.822988923078444 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-s2s name: MTEB MedrxivClusteringS2S config: default split: test revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 metrics: - type: v_measure value: 30.38394880253403 - task: type: Reranking dataset: type: mteb/mind_small name: MTEB MindSmallReranking config: default split: test revision: 3bdac13927fdc888b903db93b2ffdbd90b295a69 metrics: - type: map value: 31.82504612539082 - type: mrr value: 32.84462298174977 - task: type: Retrieval dataset: type: nfcorpus name: MTEB NFCorpus config: default split: test revision: None metrics: - type: map_at_1 value: 6.029 - type: map_at_10 value: 14.088999999999999 - type: map_at_100 value: 17.601 - type: map_at_1000 value: 19.144 - type: map_at_3 value: 10.156 - type: map_at_5 value: 11.892 - type: mrr_at_1 value: 46.44 - type: mrr_at_10 value: 56.596999999999994 - type: mrr_at_100 value: 57.11000000000001 - type: mrr_at_1000 value: 57.14 - type: mrr_at_3 value: 54.334 - type: mrr_at_5 value: 55.774 - type: ndcg_at_1 value: 44.891999999999996 - type: ndcg_at_10 value: 37.134 - type: ndcg_at_100 value: 33.652 - type: ndcg_at_1000 value: 42.548 - type: ndcg_at_3 value: 41.851 - type: ndcg_at_5 value: 39.842 - type: precision_at_1 value: 46.44 - type: precision_at_10 value: 27.647 - type: precision_at_100 value: 8.309999999999999 - type: precision_at_1000 value: 2.146 - type: precision_at_3 value: 39.422000000000004 - type: precision_at_5 value: 34.675 - type: recall_at_1 value: 6.029 - type: recall_at_10 value: 18.907 - type: recall_at_100 value: 33.76 - type: recall_at_1000 value: 65.14999999999999 - type: recall_at_3 value: 11.584999999999999 - type: recall_at_5 value: 14.626 - task: type: Retrieval dataset: type: nq name: MTEB NQ config: default split: test revision: None metrics: - type: map_at_1 value: 39.373000000000005 - type: map_at_10 value: 55.836 - type: map_at_100 value: 56.611999999999995 - type: map_at_1000 value: 56.63 - type: map_at_3 value: 51.747 - type: map_at_5 value: 54.337999999999994 - type: mrr_at_1 value: 44.147999999999996 - type: mrr_at_10 value: 58.42699999999999 - type: mrr_at_100 value: 58.902 - type: mrr_at_1000 value: 58.914 - type: mrr_at_3 value: 55.156000000000006 - type: mrr_at_5 value: 57.291000000000004 - type: ndcg_at_1 value: 44.119 - type: ndcg_at_10 value: 63.444 - type: ndcg_at_100 value: 66.40599999999999 - type: ndcg_at_1000 value: 66.822 - type: ndcg_at_3 value: 55.962 - type: ndcg_at_5 value: 60.228 - type: precision_at_1 value: 44.119 - type: precision_at_10 value: 10.006 - type: precision_at_100 value: 1.17 - type: precision_at_1000 value: 0.121 - type: precision_at_3 value: 25.135 - type: precision_at_5 value: 17.59 - type: recall_at_1 value: 39.373000000000005 - type: recall_at_10 value: 83.78999999999999 - type: recall_at_100 value: 96.246 - type: recall_at_1000 value: 99.324 - type: recall_at_3 value: 64.71900000000001 - type: recall_at_5 value: 74.508 - task: type: Retrieval dataset: type: quora name: MTEB QuoraRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 69.199 - type: map_at_10 value: 82.892 - type: map_at_100 value: 83.578 - type: map_at_1000 value: 83.598 - type: map_at_3 value: 79.948 - type: map_at_5 value: 81.779 - type: mrr_at_1 value: 79.67 - type: mrr_at_10 value: 86.115 - type: mrr_at_100 value: 86.249 - type: mrr_at_1000 value: 86.251 - type: mrr_at_3 value: 85.08200000000001 - type: mrr_at_5 value: 85.783 - type: ndcg_at_1 value: 79.67 - type: ndcg_at_10 value: 86.839 - type: ndcg_at_100 value: 88.252 - type: ndcg_at_1000 value: 88.401 - type: ndcg_at_3 value: 83.86200000000001 - type: ndcg_at_5 value: 85.473 - type: precision_at_1 value: 79.67 - type: precision_at_10 value: 13.19 - type: precision_at_100 value: 1.521 - type: precision_at_1000 value: 0.157 - type: precision_at_3 value: 36.677 - type: precision_at_5 value: 24.118000000000002 - type: recall_at_1 value: 69.199 - type: recall_at_10 value: 94.321 - type: recall_at_100 value: 99.20400000000001 - type: recall_at_1000 value: 99.947 - type: recall_at_3 value: 85.787 - type: recall_at_5 value: 90.365 - task: type: Clustering dataset: type: mteb/reddit-clustering name: MTEB RedditClustering config: default split: test revision: 24640382cdbf8abc73003fb0fa6d111a705499eb metrics: - type: v_measure value: 55.82810046856353 - task: type: Clustering dataset: type: mteb/reddit-clustering-p2p name: MTEB RedditClusteringP2P config: default split: test revision: 282350215ef01743dc01b456c7f5241fa8937f16 metrics: - type: v_measure value: 63.38132611783628 - task: type: Retrieval dataset: type: scidocs name: MTEB SCIDOCS config: default split: test revision: None metrics: - type: map_at_1 value: 5.127000000000001 - type: map_at_10 value: 12.235 - type: map_at_100 value: 14.417 - type: map_at_1000 value: 14.75 - type: map_at_3 value: 8.906 - type: map_at_5 value: 10.591000000000001 - type: mrr_at_1 value: 25.2 - type: mrr_at_10 value: 35.879 - type: mrr_at_100 value: 36.935 - type: mrr_at_1000 value: 36.997 - type: mrr_at_3 value: 32.783 - type: mrr_at_5 value: 34.367999999999995 - type: ndcg_at_1 value: 25.2 - type: ndcg_at_10 value: 20.509 - type: ndcg_at_100 value: 28.67 - type: ndcg_at_1000 value: 34.42 - type: ndcg_at_3 value: 19.948 - type: ndcg_at_5 value: 17.166 - type: precision_at_1 value: 25.2 - type: precision_at_10 value: 10.440000000000001 - type: precision_at_100 value: 2.214 - type: precision_at_1000 value: 0.359 - type: precision_at_3 value: 18.533 - type: precision_at_5 value: 14.860000000000001 - type: recall_at_1 value: 5.127000000000001 - type: recall_at_10 value: 21.147 - type: recall_at_100 value: 44.946999999999996 - type: recall_at_1000 value: 72.89 - type: recall_at_3 value: 11.277 - type: recall_at_5 value: 15.042 - task: type: STS dataset: type: mteb/sickr-sts name: MTEB SICK-R config: default split: test revision: a6ea5a8cab320b040a23452cc28066d9beae2cee metrics: - type: cos_sim_pearson value: 83.0373011786213 - type: cos_sim_spearman value: 79.27889560856613 - type: euclidean_pearson value: 80.31186315495655 - type: euclidean_spearman value: 79.41630415280811 - type: manhattan_pearson value: 80.31755140442013 - type: manhattan_spearman value: 79.43069870027611 - task: type: STS dataset: type: mteb/sts12-sts name: MTEB STS12 config: default split: test revision: a0d554a64d88156834ff5ae9920b964011b16384 metrics: - type: cos_sim_pearson value: 84.8659751342045 - type: cos_sim_spearman value: 76.95377612997667 - type: euclidean_pearson value: 81.24552945497848 - type: euclidean_spearman value: 77.18236963555253 - type: manhattan_pearson value: 81.26477607759037 - type: manhattan_spearman value: 77.13821753062756 - task: type: STS dataset: type: mteb/sts13-sts name: MTEB STS13 config: default split: test revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca metrics: - type: cos_sim_pearson value: 83.34597139044875 - type: cos_sim_spearman value: 84.124169425592 - type: euclidean_pearson value: 83.68590721511401 - type: euclidean_spearman value: 84.18846190846398 - type: manhattan_pearson value: 83.57630235061498 - type: manhattan_spearman value: 84.10244043726902 - task: type: STS dataset: type: mteb/sts14-sts name: MTEB STS14 config: default split: test revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 metrics: - type: cos_sim_pearson value: 82.67641885599572 - type: cos_sim_spearman value: 80.46450725650428 - type: euclidean_pearson value: 81.61645042715865 - type: euclidean_spearman value: 80.61418394236874 - type: manhattan_pearson value: 81.55712034928871 - type: manhattan_spearman value: 80.57905670523951 - task: type: STS dataset: type: mteb/sts15-sts name: MTEB STS15 config: default split: test revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 metrics: - type: cos_sim_pearson value: 88.86650310886782 - type: cos_sim_spearman value: 89.76081629222328 - type: euclidean_pearson value: 89.1530747029954 - type: euclidean_spearman value: 89.80990657280248 - type: manhattan_pearson value: 89.10640563278132 - type: manhattan_spearman value: 89.76282108434047 - task: type: STS dataset: type: mteb/sts16-sts name: MTEB STS16 config: default split: test revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 metrics: - type: cos_sim_pearson value: 83.93864027911118 - type: cos_sim_spearman value: 85.47096193999023 - type: euclidean_pearson value: 85.03141840870533 - type: euclidean_spearman value: 85.43124029598181 - type: manhattan_pearson value: 84.99002664393512 - type: manhattan_spearman value: 85.39169195120834 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-en) config: en-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 88.7045343749832 - type: cos_sim_spearman value: 89.03262221146677 - type: euclidean_pearson value: 89.56078218264365 - type: euclidean_spearman value: 89.17827006466868 - type: manhattan_pearson value: 89.52717595468582 - type: manhattan_spearman value: 89.15878115952923 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (en) config: en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 64.20191302875551 - type: cos_sim_spearman value: 64.11446552557646 - type: euclidean_pearson value: 64.6918197393619 - type: euclidean_spearman value: 63.440182631197764 - type: manhattan_pearson value: 64.55692904121835 - type: manhattan_spearman value: 63.424877742756266 - task: type: STS dataset: type: mteb/stsbenchmark-sts name: MTEB STSBenchmark config: default split: test revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 metrics: - type: cos_sim_pearson value: 86.37793104662344 - type: cos_sim_spearman value: 87.7357802629067 - type: euclidean_pearson value: 87.4286301545109 - type: euclidean_spearman value: 87.78452920777421 - type: manhattan_pearson value: 87.42445169331255 - type: manhattan_spearman value: 87.78537677249598 - task: type: Reranking dataset: type: mteb/scidocs-reranking name: MTEB SciDocsRR config: default split: test revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab metrics: - type: map value: 84.31465405081792 - type: mrr value: 95.7173781193389 - task: type: Retrieval dataset: type: scifact name: MTEB SciFact config: default split: test revision: None metrics: - type: map_at_1 value: 57.760999999999996 - type: map_at_10 value: 67.904 - type: map_at_100 value: 68.539 - type: map_at_1000 value: 68.562 - type: map_at_3 value: 65.415 - type: map_at_5 value: 66.788 - type: mrr_at_1 value: 60.333000000000006 - type: mrr_at_10 value: 68.797 - type: mrr_at_100 value: 69.236 - type: mrr_at_1000 value: 69.257 - type: mrr_at_3 value: 66.667 - type: mrr_at_5 value: 67.967 - type: ndcg_at_1 value: 60.333000000000006 - type: ndcg_at_10 value: 72.24199999999999 - type: ndcg_at_100 value: 74.86 - type: ndcg_at_1000 value: 75.354 - type: ndcg_at_3 value: 67.93400000000001 - type: ndcg_at_5 value: 70.02199999999999 - type: precision_at_1 value: 60.333000000000006 - type: precision_at_10 value: 9.533 - type: precision_at_100 value: 1.09 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 26.778000000000002 - type: precision_at_5 value: 17.467 - type: recall_at_1 value: 57.760999999999996 - type: recall_at_10 value: 84.383 - type: recall_at_100 value: 96.267 - type: recall_at_1000 value: 100 - type: recall_at_3 value: 72.628 - type: recall_at_5 value: 78.094 - task: type: PairClassification dataset: type: mteb/sprintduplicatequestions-pairclassification name: MTEB SprintDuplicateQuestions config: default split: test revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 metrics: - type: cos_sim_accuracy value: 99.8029702970297 - type: cos_sim_ap value: 94.9210324173411 - type: cos_sim_f1 value: 89.8521162672106 - type: cos_sim_precision value: 91.67533818938605 - type: cos_sim_recall value: 88.1 - type: dot_accuracy value: 99.69504950495049 - type: dot_ap value: 90.4919719146181 - type: dot_f1 value: 84.72289156626506 - type: dot_precision value: 81.76744186046511 - type: dot_recall value: 87.9 - type: euclidean_accuracy value: 99.79702970297029 - type: euclidean_ap value: 94.87827463795753 - type: euclidean_f1 value: 89.55680081507896 - type: euclidean_precision value: 91.27725856697819 - type: euclidean_recall value: 87.9 - type: manhattan_accuracy value: 99.7990099009901 - type: manhattan_ap value: 94.87587025149682 - type: manhattan_f1 value: 89.76298537569339 - type: manhattan_precision value: 90.53916581892166 - type: manhattan_recall value: 89 - type: max_accuracy value: 99.8029702970297 - type: max_ap value: 94.9210324173411 - type: max_f1 value: 89.8521162672106 - task: type: Clustering dataset: type: mteb/stackexchange-clustering name: MTEB StackExchangeClustering config: default split: test revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 metrics: - type: v_measure value: 65.92385753948724 - task: type: Clustering dataset: type: mteb/stackexchange-clustering-p2p name: MTEB StackExchangeClusteringP2P config: default split: test revision: 815ca46b2622cec33ccafc3735d572c266efdb44 metrics: - type: v_measure value: 33.671756975431144 - task: type: Reranking dataset: type: mteb/stackoverflowdupquestions-reranking name: MTEB StackOverflowDupQuestions config: default split: test revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 metrics: - type: map value: 50.677928036739004 - type: mrr value: 51.56413133435193 - task: type: Summarization dataset: type: mteb/summeval name: MTEB SummEval config: default split: test revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c metrics: - type: cos_sim_pearson value: 30.523589340819683 - type: cos_sim_spearman value: 30.187407518823235 - type: dot_pearson value: 29.039713969699015 - type: dot_spearman value: 29.114740651155508 - task: type: Retrieval dataset: type: trec-covid name: MTEB TRECCOVID config: default split: test revision: None metrics: - type: map_at_1 value: 0.211 - type: map_at_10 value: 1.6199999999999999 - type: map_at_100 value: 8.658000000000001 - type: map_at_1000 value: 21.538 - type: map_at_3 value: 0.575 - type: map_at_5 value: 0.919 - type: mrr_at_1 value: 78 - type: mrr_at_10 value: 86.18599999999999 - type: mrr_at_100 value: 86.18599999999999 - type: mrr_at_1000 value: 86.18599999999999 - type: mrr_at_3 value: 85 - type: mrr_at_5 value: 85.9 - type: ndcg_at_1 value: 74 - type: ndcg_at_10 value: 66.542 - type: ndcg_at_100 value: 50.163999999999994 - type: ndcg_at_1000 value: 45.696999999999996 - type: ndcg_at_3 value: 71.531 - type: ndcg_at_5 value: 70.45 - type: precision_at_1 value: 78 - type: precision_at_10 value: 69.39999999999999 - type: precision_at_100 value: 51.06 - type: precision_at_1000 value: 20.022000000000002 - type: precision_at_3 value: 76 - type: precision_at_5 value: 74.8 - type: recall_at_1 value: 0.211 - type: recall_at_10 value: 1.813 - type: recall_at_100 value: 12.098 - type: recall_at_1000 value: 42.618 - type: recall_at_3 value: 0.603 - type: recall_at_5 value: 0.987 - task: type: Retrieval dataset: type: webis-touche2020 name: MTEB Touche2020 config: default split: test revision: None metrics: - type: map_at_1 value: 2.2079999999999997 - type: map_at_10 value: 7.777000000000001 - type: map_at_100 value: 12.825000000000001 - type: map_at_1000 value: 14.196 - type: map_at_3 value: 4.285 - type: map_at_5 value: 6.177 - type: mrr_at_1 value: 30.612000000000002 - type: mrr_at_10 value: 42.635 - type: mrr_at_100 value: 43.955 - type: mrr_at_1000 value: 43.955 - type: mrr_at_3 value: 38.435 - type: mrr_at_5 value: 41.088 - type: ndcg_at_1 value: 28.571 - type: ndcg_at_10 value: 20.666999999999998 - type: ndcg_at_100 value: 31.840000000000003 - type: ndcg_at_1000 value: 43.191 - type: ndcg_at_3 value: 23.45 - type: ndcg_at_5 value: 22.994 - type: precision_at_1 value: 30.612000000000002 - type: precision_at_10 value: 17.959 - type: precision_at_100 value: 6.755 - type: precision_at_1000 value: 1.4200000000000002 - type: precision_at_3 value: 23.810000000000002 - type: precision_at_5 value: 23.673 - type: recall_at_1 value: 2.2079999999999997 - type: recall_at_10 value: 13.144 - type: recall_at_100 value: 42.491 - type: recall_at_1000 value: 77.04299999999999 - type: recall_at_3 value: 5.3469999999999995 - type: recall_at_5 value: 9.139 - task: type: Classification dataset: type: mteb/toxic_conversations_50k name: MTEB ToxicConversationsClassification config: default split: test revision: d7c0de2777da35d6aae2200a62c6e0e5af397c4c metrics: - type: accuracy value: 70.9044 - type: ap value: 14.625783489340755 - type: f1 value: 54.814936562590546 - task: type: Classification dataset: type: mteb/tweet_sentiment_extraction name: MTEB TweetSentimentExtractionClassification config: default split: test revision: d604517c81ca91fe16a244d1248fc021f9ecee7a metrics: - type: accuracy value: 60.94227504244483 - type: f1 value: 61.22516038508854 - task: type: Clustering dataset: type: mteb/twentynewsgroups-clustering name: MTEB TwentyNewsgroupsClustering config: default split: test revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 metrics: - type: v_measure value: 49.602409155145864 - task: type: PairClassification dataset: type: mteb/twittersemeval2015-pairclassification name: MTEB TwitterSemEval2015 config: default split: test revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 metrics: - type: cos_sim_accuracy value: 86.94641473445789 - type: cos_sim_ap value: 76.91572747061197 - type: cos_sim_f1 value: 70.14348097317529 - type: cos_sim_precision value: 66.53254437869822 - type: cos_sim_recall value: 74.1688654353562 - type: dot_accuracy value: 84.80061989628658 - type: dot_ap value: 70.7952548895177 - type: dot_f1 value: 65.44780728844965 - type: dot_precision value: 61.53310104529617 - type: dot_recall value: 69.89445910290237 - type: euclidean_accuracy value: 86.94641473445789 - type: euclidean_ap value: 76.80774009393652 - type: euclidean_f1 value: 70.30522503879979 - type: euclidean_precision value: 68.94977168949772 - type: euclidean_recall value: 71.71503957783642 - type: manhattan_accuracy value: 86.8629671574179 - type: manhattan_ap value: 76.76518632600317 - type: manhattan_f1 value: 70.16056518946692 - type: manhattan_precision value: 68.360450563204 - type: manhattan_recall value: 72.0580474934037 - type: max_accuracy value: 86.94641473445789 - type: max_ap value: 76.91572747061197 - type: max_f1 value: 70.30522503879979 - task: type: PairClassification dataset: type: mteb/twitterurlcorpus-pairclassification name: MTEB TwitterURLCorpus config: default split: test revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf metrics: - type: cos_sim_accuracy value: 89.10428066907285 - type: cos_sim_ap value: 86.25114759921435 - type: cos_sim_f1 value: 78.37857884586856 - type: cos_sim_precision value: 75.60818546078993 - type: cos_sim_recall value: 81.35971666153372 - type: dot_accuracy value: 87.41995575736406 - type: dot_ap value: 81.51838010086782 - type: dot_f1 value: 74.77398015435503 - type: dot_precision value: 71.53002390662354 - type: dot_recall value: 78.32614721281182 - type: euclidean_accuracy value: 89.12368533395428 - type: euclidean_ap value: 86.33456799874504 - type: euclidean_f1 value: 78.45496750232127 - type: euclidean_precision value: 75.78388462366364 - type: euclidean_recall value: 81.32121958731136 - type: manhattan_accuracy value: 89.10622113556099 - type: manhattan_ap value: 86.31215061745333 - type: manhattan_f1 value: 78.40684906011539 - type: manhattan_precision value: 75.89536643366722 - type: manhattan_recall value: 81.09023714197721 - type: max_accuracy value: 89.12368533395428 - type: max_ap value: 86.33456799874504 - type: max_f1 value: 78.45496750232127 language: - en license: mit --- # E5-large-v2 [Text Embeddings by Weakly-Supervised Contrastive Pre-training](https://arxiv.org/pdf/2212.03533.pdf). Liang Wang, Nan Yang, Xiaolong Huang, Binxing Jiao, Linjun Yang, Daxin Jiang, Rangan Majumder, Furu Wei, arXiv 2022 This model has 24 layers and the embedding size is 1024. ## Usage Below is an example to encode queries and passages from the MS-MARCO passage ranking dataset. ```python import torch.nn.functional as F from torch import Tensor from transformers import AutoTokenizer, AutoModel def average_pool(last_hidden_states: Tensor, attention_mask: Tensor) -> Tensor: last_hidden = last_hidden_states.masked_fill(~attention_mask[..., None].bool(), 0.0) return last_hidden.sum(dim=1) / attention_mask.sum(dim=1)[..., None] # Each input text should start with "query: " or "passage: ". # For tasks other than retrieval, you can simply use the "query: " prefix. input_texts = ['query: how much protein should a female eat', 'query: summit define', "passage: As a general guideline, the CDC's average requirement of protein for women ages 19 to 70 is 46 grams per day. But, as you can see from this chart, you'll need to increase that if you're expecting or training for a marathon. Check out the chart below to see how much protein you should be eating each day.", "passage: Definition of summit for English Language Learners. : 1 the highest point of a mountain : the top of a mountain. : 2 the highest level. : 3 a meeting or series of meetings between the leaders of two or more governments."] tokenizer = AutoTokenizer.from_pretrained('intfloat/e5-large-v2') model = AutoModel.from_pretrained('intfloat/e5-large-v2') # Tokenize the input texts batch_dict = tokenizer(input_texts, max_length=512, padding=True, truncation=True, return_tensors='pt') outputs = model(**batch_dict) embeddings = average_pool(outputs.last_hidden_state, batch_dict['attention_mask']) # normalize embeddings embeddings = F.normalize(embeddings, p=2, dim=1) scores = (embeddings[:2] @ embeddings[2:].T) * 100 print(scores.tolist()) ``` ## Training Details Please refer to our paper at [https://arxiv.org/pdf/2212.03533.pdf](https://arxiv.org/pdf/2212.03533.pdf). ## Benchmark Evaluation Check out [unilm/e5](https://github.com/microsoft/unilm/tree/master/e5) to reproduce evaluation results on the [BEIR](https://arxiv.org/abs/2104.08663) and [MTEB benchmark](https://arxiv.org/abs/2210.07316). ## Support for Sentence Transformers Below is an example for usage with sentence_transformers. ```python from sentence_transformers import SentenceTransformer model = SentenceTransformer('intfloat/e5-large-v2') input_texts = [ 'query: how much protein should a female eat', 'query: summit define', "passage: As a general guideline, the CDC's average requirement of protein for women ages 19 to 70 is 46 grams per day. But, as you can see from this chart, you'll need to increase that if you're expecting or training for a marathon. Check out the chart below to see how much protein you should be eating each day.", "passage: Definition of summit for English Language Learners. : 1 the highest point of a mountain : the top of a mountain. : 2 the highest level. : 3 a meeting or series of meetings between the leaders of two or more governments." ] embeddings = model.encode(input_texts, normalize_embeddings=True) ``` Package requirements `pip install sentence_transformers~=2.2.2` Contributors: [michaelfeil](https://huggingface.co/michaelfeil) ## FAQ **1. Do I need to add the prefix "query: " and "passage: " to input texts?** Yes, this is how the model is trained, otherwise you will see a performance degradation. Here are some rules of thumb: - Use "query: " and "passage: " correspondingly for asymmetric tasks such as passage retrieval in open QA, ad-hoc information retrieval. - Use "query: " prefix for symmetric tasks such as semantic similarity, paraphrase retrieval. - Use "query: " prefix if you want to use embeddings as features, such as linear probing classification, clustering. **2. Why are my reproduced results slightly different from reported in the model card?** Different versions of `transformers` and `pytorch` could cause negligible but non-zero performance differences. **3. Why does the cosine similarity scores distribute around 0.7 to 1.0?** This is a known and expected behavior as we use a low temperature 0.01 for InfoNCE contrastive loss. For text embedding tasks like text retrieval or semantic similarity, what matters is the relative order of the scores instead of the absolute values, so this should not be an issue. ## Citation If you find our paper or models helpful, please consider cite as follows: ``` @article{wang2022text, title={Text Embeddings by Weakly-Supervised Contrastive Pre-training}, author={Wang, Liang and Yang, Nan and Huang, Xiaolong and Jiao, Binxing and Yang, Linjun and Jiang, Daxin and Majumder, Rangan and Wei, Furu}, journal={arXiv preprint arXiv:2212.03533}, year={2022} } ``` ## Limitations This model only works for English texts. Long texts will be truncated to at most 512 tokens.

stabilityai/stable-diffusion-2-1-base

stabilityai

diffusers

text-to-image

--- license: openrail++ tags: - stable-diffusion - text-to-image --- # Stable Diffusion v2-1-base Model Card This model card focuses on the model associated with the Stable Diffusion v2-1-base model. This `stable-diffusion-2-1-base` model fine-tunes [stable-diffusion-2-base](https://huggingface.co/stabilityai/stable-diffusion-2-base) (`512-base-ema.ckpt`) with 220k extra steps taken, with `punsafe=0.98` on the same dataset. - Use it with the [`stablediffusion`](https://github.com/Stability-AI/stablediffusion) repository: download the `v2-1_512-ema-pruned.ckpt` [here](https://huggingface.co/stabilityai/stable-diffusion-2-1-base/resolve/main/v2-1_512-ema-pruned.ckpt). - Use it with 🧨 [`diffusers`](#examples) ## Model Details - **Developed by:** Robin Rombach, Patrick Esser - **Model type:** Diffusion-based text-to-image generation model - **Language(s):** English - **License:** [CreativeML Open RAIL++-M License](https://huggingface.co/stabilityai/stable-diffusion-2/blob/main/LICENSE-MODEL) - **Model Description:** This is a model that can be used to generate and modify images based on text prompts. It is a [Latent Diffusion Model](https://arxiv.org/abs/2112.10752) that uses a fixed, pretrained text encoder ([OpenCLIP-ViT/H](https://github.com/mlfoundations/open_clip)). - **Resources for more information:** [GitHub Repository](https://github.com/Stability-AI/). - **Cite as:** @InProceedings{Rombach_2022_CVPR, author = {Rombach, Robin and Blattmann, Andreas and Lorenz, Dominik and Esser, Patrick and Ommer, Bj\"orn}, title = {High-Resolution Image Synthesis With Latent Diffusion Models}, booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition (CVPR)}, month = {June}, year = {2022}, pages = {10684-10695} } ## Examples Using the [🤗's Diffusers library](https://github.com/huggingface/diffusers) to run Stable Diffusion 2 in a simple and efficient manner. ```bash pip install diffusers transformers accelerate scipy safetensors ``` Running the pipeline (if you don't swap the scheduler it will run with the default PNDM/PLMS scheduler, in this example we are swapping it to EulerDiscreteScheduler): ```python from diffusers import StableDiffusionPipeline, EulerDiscreteScheduler import torch model_id = "stabilityai/stable-diffusion-2-1-base" scheduler = EulerDiscreteScheduler.from_pretrained(model_id, subfolder="scheduler") pipe = StableDiffusionPipeline.from_pretrained(model_id, scheduler=scheduler, torch_dtype=torch.float16) pipe = pipe.to("cuda") prompt = "a photo of an astronaut riding a horse on mars" image = pipe(prompt).images[0] image.save("astronaut_rides_horse.png") ``` **Notes**: - Despite not being a dependency, we highly recommend you to install [xformers](https://github.com/facebookresearch/xformers) for memory efficient attention (better performance) - If you have low GPU RAM available, make sure to add a `pipe.enable_attention_slicing()` after sending it to `cuda` for less VRAM usage (to the cost of speed) # Uses ## Direct Use The model is intended for research purposes only. Possible research areas and tasks include - Safe deployment of models which have the potential to generate harmful content. - Probing and understanding the limitations and biases of generative models. - Generation of artworks and use in design and other artistic processes. - Applications in educational or creative tools. - Research on generative models. Excluded uses are described below. ### Misuse, Malicious Use, and Out-of-Scope Use _Note: This section is originally taken from the [DALLE-MINI model card](https://huggingface.co/dalle-mini/dalle-mini), was used for Stable Diffusion v1, but applies in the same way to Stable Diffusion v2_. The model should not be used to intentionally create or disseminate images that create hostile or alienating environments for people. This includes generating images that people would foreseeably find disturbing, distressing, or offensive; or content that propagates historical or current stereotypes. #### Out-of-Scope Use The model was not trained to be factual or true representations of people or events, and therefore using the model to generate such content is out-of-scope for the abilities of this model. #### Misuse and Malicious Use Using the model to generate content that is cruel to individuals is a misuse of this model. This includes, but is not limited to: - Generating demeaning, dehumanizing, or otherwise harmful representations of people or their environments, cultures, religions, etc. - Intentionally promoting or propagating discriminatory content or harmful stereotypes. - Impersonating individuals without their consent. - Sexual content without consent of the people who might see it. - Mis- and disinformation - Representations of egregious violence and gore - Sharing of copyrighted or licensed material in violation of its terms of use. - Sharing content that is an alteration of copyrighted or licensed material in violation of its terms of use. ## Limitations and Bias ### Limitations - The model does not achieve perfect photorealism - The model cannot render legible text - The model does not perform well on more difficult tasks which involve compositionality, such as rendering an image corresponding to “A red cube on top of a blue sphere” - Faces and people in general may not be generated properly. - The model was trained mainly with English captions and will not work as well in other languages. - The autoencoding part of the model is lossy - The model was trained on a subset of the large-scale dataset [LAION-5B](https://laion.ai/blog/laion-5b/), which contains adult, violent and sexual content. To partially mitigate this, we have filtered the dataset using LAION's NFSW detector (see Training section). ### Bias While the capabilities of image generation models are impressive, they can also reinforce or exacerbate social biases. Stable Diffusion vw was primarily trained on subsets of [LAION-2B(en)](https://laion.ai/blog/laion-5b/), which consists of images that are limited to English descriptions. Texts and images from communities and cultures that use other languages are likely to be insufficiently accounted for. This affects the overall output of the model, as white and western cultures are often set as the default. Further, the ability of the model to generate content with non-English prompts is significantly worse than with English-language prompts. Stable Diffusion v2 mirrors and exacerbates biases to such a degree that viewer discretion must be advised irrespective of the input or its intent. ## Training **Training Data** The model developers used the following dataset for training the model: - LAION-5B and subsets (details below). The training data is further filtered using LAION's NSFW detector, with a "p_unsafe" score of 0.1 (conservative). For more details, please refer to LAION-5B's [NeurIPS 2022](https://openreview.net/forum?id=M3Y74vmsMcY) paper and reviewer discussions on the topic. **Training Procedure** Stable Diffusion v2 is a latent diffusion model which combines an autoencoder with a diffusion model that is trained in the latent space of the autoencoder. During training, - Images are encoded through an encoder, which turns images into latent representations. The autoencoder uses a relative downsampling factor of 8 and maps images of shape H x W x 3 to latents of shape H/f x W/f x 4 - Text prompts are encoded through the OpenCLIP-ViT/H text-encoder. - The output of the text encoder is fed into the UNet backbone of the latent diffusion model via cross-attention. - The loss is a reconstruction objective between the noise that was added to the latent and the prediction made by the UNet. We also use the so-called _v-objective_, see https://arxiv.org/abs/2202.00512. We currently provide the following checkpoints, for various versions: ### Version 2.1 - `512-base-ema.ckpt`: Fine-tuned on `512-base-ema.ckpt` 2.0 with 220k extra steps taken, with `punsafe=0.98` on the same dataset. - `768-v-ema.ckpt`: Resumed from `768-v-ema.ckpt` 2.0 with an additional 55k steps on the same dataset (`punsafe=0.1`), and then fine-tuned for another 155k extra steps with `punsafe=0.98`. ### Version 2.0 - `512-base-ema.ckpt`: 550k steps at resolution `256x256` on a subset of [LAION-5B](https://laion.ai/blog/laion-5b/) filtered for explicit pornographic material, using the [LAION-NSFW classifier](https://github.com/LAION-AI/CLIP-based-NSFW-Detector) with `punsafe=0.1` and an [aesthetic score](https://github.com/christophschuhmann/improved-aesthetic-predictor) >= `4.5`. 850k steps at resolution `512x512` on the same dataset with resolution `>= 512x512`. - `768-v-ema.ckpt`: Resumed from `512-base-ema.ckpt` and trained for 150k steps using a [v-objective](https://arxiv.org/abs/2202.00512) on the same dataset. Resumed for another 140k steps on a `768x768` subset of our dataset. - `512-depth-ema.ckpt`: Resumed from `512-base-ema.ckpt` and finetuned for 200k steps. Added an extra input channel to process the (relative) depth prediction produced by [MiDaS](https://github.com/isl-org/MiDaS) (`dpt_hybrid`) which is used as an additional conditioning. The additional input channels of the U-Net which process this extra information were zero-initialized. - `512-inpainting-ema.ckpt`: Resumed from `512-base-ema.ckpt` and trained for another 200k steps. Follows the mask-generation strategy presented in [LAMA](https://github.com/saic-mdal/lama) which, in combination with the latent VAE representations of the masked image, are used as an additional conditioning. The additional input channels of the U-Net which process this extra information were zero-initialized. The same strategy was used to train the [1.5-inpainting checkpoint](https://github.com/saic-mdal/lama). - `x4-upscaling-ema.ckpt`: Trained for 1.25M steps on a 10M subset of LAION containing images `>2048x2048`. The model was trained on crops of size `512x512` and is a text-guided [latent upscaling diffusion model](https://arxiv.org/abs/2112.10752). In addition to the textual input, it receives a `noise_level` as an input parameter, which can be used to add noise to the low-resolution input according to a [predefined diffusion schedule](configs/stable-diffusion/x4-upscaling.yaml). - **Hardware:** 32 x 8 x A100 GPUs - **Optimizer:** AdamW - **Gradient Accumulations**: 1 - **Batch:** 32 x 8 x 2 x 4 = 2048 - **Learning rate:** warmup to 0.0001 for 10,000 steps and then kept constant ## Evaluation Results Evaluations with different classifier-free guidance scales (1.5, 2.0, 3.0, 4.0, 5.0, 6.0, 7.0, 8.0) and 50 steps DDIM sampling steps show the relative improvements of the checkpoints:  Evaluated using 50 DDIM steps and 10000 random prompts from the COCO2017 validation set, evaluated at 512x512 resolution. Not optimized for FID scores. ## Environmental Impact **Stable Diffusion v1** **Estimated Emissions** Based on that information, we estimate the following CO2 emissions using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). The hardware, runtime, cloud provider, and compute region were utilized to estimate the carbon impact. - **Hardware Type:** A100 PCIe 40GB - **Hours used:** 200000 - **Cloud Provider:** AWS - **Compute Region:** US-east - **Carbon Emitted (Power consumption x Time x Carbon produced based on location of power grid):** 15000 kg CO2 eq. ## Citation @InProceedings{Rombach_2022_CVPR, author = {Rombach, Robin and Blattmann, Andreas and Lorenz, Dominik and Esser, Patrick and Ommer, Bj\"orn}, title = {High-Resolution Image Synthesis With Latent Diffusion Models}, booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition (CVPR)}, month = {June}, year = {2022}, pages = {10684-10695} } *This model card was written by: Robin Rombach, Patrick Esser and David Ha and is based on the [Stable Diffusion v1](https://github.com/CompVis/stable-diffusion/blob/main/Stable_Diffusion_v1_Model_Card.md) and [DALL-E Mini model card](https://huggingface.co/dalle-mini/dalle-mini).*

sentence-transformers/paraphrase-multilingual-mpnet-base-v2

sentence-transformers

sentence-transformers

sentence-similarity

--- language: - multilingual - ar - bg - ca - cs - da - de - el - en - es - et - fa - fi - fr - gl - gu - he - hi - hr - hu - hy - id - it - ja - ka - ko - ku - lt - lv - mk - mn - mr - ms - my - nb - nl - pl - pt - ro - ru - sk - sl - sq - sr - sv - th - tr - uk - ur - vi license: apache-2.0 library_name: sentence-transformers tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers language_bcp47: - fr-ca - pt-br - zh-cn - zh-tw pipeline_tag: sentence-similarity --- # sentence-transformers/paraphrase-multilingual-mpnet-base-v2 This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 768 dimensional dense vector space and can be used for tasks like clustering or semantic search. ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer sentences = ["This is an example sentence", "Each sentence is converted"] model = SentenceTransformer('sentence-transformers/paraphrase-multilingual-mpnet-base-v2') embeddings = model.encode(sentences) print(embeddings) ``` ## Usage (HuggingFace Transformers) Without [sentence-transformers](https://www.SBERT.net), you can use the model like this: First, you pass your input through the transformer model, then you have to apply the right pooling-operation on-top of the contextualized word embeddings. ```python from transformers import AutoTokenizer, AutoModel import torch #Mean Pooling - Take attention mask into account for correct averaging def mean_pooling(model_output, attention_mask): token_embeddings = model_output[0] #First element of model_output contains all token embeddings input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) # Sentences we want sentence embeddings for sentences = ['This is an example sentence', 'Each sentence is converted'] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('sentence-transformers/paraphrase-multilingual-mpnet-base-v2') model = AutoModel.from_pretrained('sentence-transformers/paraphrase-multilingual-mpnet-base-v2') # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, average pooling sentence_embeddings = mean_pooling(model_output, encoded_input['attention_mask']) print("Sentence embeddings:") print(sentence_embeddings) ``` ## Evaluation Results For an automated evaluation of this model, see the *Sentence Embeddings Benchmark*: [https://seb.sbert.net](https://seb.sbert.net?model_name=sentence-transformers/paraphrase-multilingual-mpnet-base-v2) ## Full Model Architecture ``` SentenceTransformer( (0): Transformer({'max_seq_length': 128, 'do_lower_case': False}) with Transformer model: XLMRobertaModel (1): Pooling({'word_embedding_dimension': 768, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False}) ) ``` ## Citing & Authors This model was trained by [sentence-transformers](https://www.sbert.net/). If you find this model helpful, feel free to cite our publication [Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks](https://arxiv.org/abs/1908.10084): ```bibtex @inproceedings{reimers-2019-sentence-bert, title = "Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks", author = "Reimers, Nils and Gurevych, Iryna", booktitle = "Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing", month = "11", year = "2019", publisher = "Association for Computational Linguistics", url = "http://arxiv.org/abs/1908.10084", } ```

microsoft/deberta-xlarge-mnli

microsoft

transformers

text-classification

--- language: en tags: - deberta-v1 - deberta-mnli tasks: mnli thumbnail: https://huggingface.co/front/thumbnails/microsoft.png license: mit widget: - text: "[CLS] I love you. [SEP] I like you. [SEP]" --- ## DeBERTa: Decoding-enhanced BERT with Disentangled Attention [DeBERTa](https://arxiv.org/abs/2006.03654) improves the BERT and RoBERTa models using disentangled attention and enhanced mask decoder. It outperforms BERT and RoBERTa on majority of NLU tasks with 80GB training data. Please check the [official repository](https://github.com/microsoft/DeBERTa) for more details and updates. This the DeBERTa xlarge model(750M) fine-tuned with mnli task. ### Fine-tuning on NLU tasks We present the dev results on SQuAD 1.1/2.0 and several GLUE benchmark tasks. | Model | SQuAD 1.1 | SQuAD 2.0 | MNLI-m/mm | SST-2 | QNLI | CoLA | RTE | MRPC | QQP |STS-B | |---------------------------|-----------|-----------|-------------|-------|------|------|--------|-------|-------|------| | | F1/EM | F1/EM | Acc | Acc | Acc | MCC | Acc |Acc/F1 |Acc/F1 |P/S | | BERT-Large | 90.9/84.1 | 81.8/79.0 | 86.6/- | 93.2 | 92.3 | 60.6 | 70.4 | 88.0/- | 91.3/- |90.0/- | | RoBERTa-Large | 94.6/88.9 | 89.4/86.5 | 90.2/- | 96.4 | 93.9 | 68.0 | 86.6 | 90.9/- | 92.2/- |92.4/- | | XLNet-Large | 95.1/89.7 | 90.6/87.9 | 90.8/- | 97.0 | 94.9 | 69.0 | 85.9 | 90.8/- | 92.3/- |92.5/- | | [DeBERTa-Large](https://huggingface.co/microsoft/deberta-large)¹ | 95.5/90.1 | 90.7/88.0 | 91.3/91.1| 96.5|95.3| 69.5| 91.0| 92.6/94.6| 92.3/- |92.8/92.5 | | [DeBERTa-XLarge](https://huggingface.co/microsoft/deberta-xlarge)¹ | -/- | -/- | 91.5/91.2| 97.0 | - | - | 93.1 | 92.1/94.3 | - |92.9/92.7| | [DeBERTa-V2-XLarge](https://huggingface.co/microsoft/deberta-v2-xlarge)¹|95.8/90.8| 91.4/88.9|91.7/91.6| **97.5**| 95.8|71.1|**93.9**|92.0/94.2|92.3/89.8|92.9/92.9| |**[DeBERTa-V2-XXLarge](https://huggingface.co/microsoft/deberta-v2-xxlarge)^1,2**|**96.1/91.4**|**92.2/89.7**|**91.7/91.9**|97.2|**96.0**|**72.0**| 93.5| **93.1/94.9**|**92.7/90.3** |**93.2/93.1** | -------- #### Notes. - ¹ Following RoBERTa, for RTE, MRPC, STS-B, we fine-tune the tasks based on [DeBERTa-Large-MNLI](https://huggingface.co/microsoft/deberta-large-mnli), [DeBERTa-XLarge-MNLI](https://huggingface.co/microsoft/deberta-xlarge-mnli), [DeBERTa-V2-XLarge-MNLI](https://huggingface.co/microsoft/deberta-v2-xlarge-mnli), [DeBERTa-V2-XXLarge-MNLI](https://huggingface.co/microsoft/deberta-v2-xxlarge-mnli). The results of SST-2/QQP/QNLI/SQuADv2 will also be slightly improved when start from MNLI fine-tuned models, however, we only report the numbers fine-tuned from pretrained base models for those 4 tasks. - ² To try the **XXLarge** model with **[HF transformers](https://huggingface.co/transformers/main_classes/trainer.html)**, you need to specify **--sharded_ddp** ```bash cd transformers/examples/text-classification/ export TASK_NAME=mrpc python -m torch.distributed.launch --nproc_per_node=8 run_glue.py --model_name_or_path microsoft/deberta-v2-xxlarge \\ --task_name $TASK_NAME --do_train --do_eval --max_seq_length 128 --per_device_train_batch_size 4 \\ --learning_rate 3e-6 --num_train_epochs 3 --output_dir /tmp/$TASK_NAME/ --overwrite_output_dir --sharded_ddp --fp16 ``` ### Citation If you find DeBERTa useful for your work, please cite the following paper: ``` latex @inproceedings{ he2021deberta, title={DEBERTA: DECODING-ENHANCED BERT WITH DISENTANGLED ATTENTION}, author={Pengcheng He and Xiaodong Liu and Jianfeng Gao and Weizhu Chen}, booktitle={International Conference on Learning Representations}, year={2021}, url={https://openreview.net/forum?id=XPZIaotutsD} } ```

h94/IP-Adapter-FaceID

h94

diffusers

text-to-image

--- tags: - text-to-image - stable-diffusion language: - en library_name: diffusers --- # IP-Adapter-FaceID Model Card <div align="center"> [**Project Page**](https://ip-adapter.github.io) **|** [**Paper (ArXiv)**](https://arxiv.org/abs/2308.06721) **|** [**Code**](https://github.com/tencent-ailab/IP-Adapter) </div> --- ## Introduction An experimental version of IP-Adapter-FaceID: we use face ID embedding from a face recognition model instead of CLIP image embedding, additionally, we use LoRA to improve ID consistency. IP-Adapter-FaceID can generate various style images conditioned on a face with only text prompts.  **Update 2023/12/27**: IP-Adapter-FaceID-Plus: face ID embedding (for face ID) + CLIP image embedding (for face structure) <div align="center">  </div> **Update 2023/12/28**: IP-Adapter-FaceID-PlusV2: face ID embedding (for face ID) + controllable CLIP image embedding (for face structure) You can adjust the weight of the face structure to get different generation! <div align="center">  </div> **Update 2024/01/04**: IP-Adapter-FaceID-SDXL: An experimental SDXL version of IP-Adapter-FaceID <div align="center">  </div> **Update 2024/01/17**: IP-Adapter-FaceID-PlusV2-SDXL: An experimental SDXL version of IP-Adapter-FaceID-PlusV2 **Update 2024/01/19**: IP-Adapter-FaceID-Portrait: same with IP-Adapter-FaceID but for portrait generation (no lora! no controlnet!). Specifically, it accepts multiple facial images to enhance similarity (the default is 5). <div align="center">  </div> ## Usage ### IP-Adapter-FaceID Firstly, you should use [insightface](https://github.com/deepinsight/insightface) to extract face ID embedding: ```python import cv2 from insightface.app import FaceAnalysis import torch app = FaceAnalysis(name="buffalo_l", providers=['CUDAExecutionProvider', 'CPUExecutionProvider']) app.prepare(ctx_id=0, det_size=(640, 640)) image = cv2.imread("person.jpg") faces = app.get(image) faceid_embeds = torch.from_numpy(faces[0].normed_embedding).unsqueeze(0) ``` Then, you can generate images conditioned on the face embeddings: ```python import torch from diffusers import StableDiffusionPipeline, DDIMScheduler, AutoencoderKL from PIL import Image from ip_adapter.ip_adapter_faceid import IPAdapterFaceID base_model_path = "SG161222/Realistic_Vision_V4.0_noVAE" vae_model_path = "stabilityai/sd-vae-ft-mse" ip_ckpt = "ip-adapter-faceid_sd15.bin" device = "cuda" noise_scheduler = DDIMScheduler( num_train_timesteps=1000, beta_start=0.00085, beta_end=0.012, beta_schedule="scaled_linear", clip_sample=False, set_alpha_to_one=False, steps_offset=1, ) vae = AutoencoderKL.from_pretrained(vae_model_path).to(dtype=torch.float16) pipe = StableDiffusionPipeline.from_pretrained( base_model_path, torch_dtype=torch.float16, scheduler=noise_scheduler, vae=vae, feature_extractor=None, safety_checker=None ) # load ip-adapter ip_model = IPAdapterFaceID(pipe, ip_ckpt, device) # generate image prompt = "photo of a woman in red dress in a garden" negative_prompt = "monochrome, lowres, bad anatomy, worst quality, low quality, blurry" images = ip_model.generate( prompt=prompt, negative_prompt=negative_prompt, faceid_embeds=faceid_embeds, num_samples=4, width=512, height=768, num_inference_steps=30, seed=2023 ) ``` you can also use a normal IP-Adapter and a normal LoRA to load model: ```python import torch from diffusers import StableDiffusionPipeline, DDIMScheduler, AutoencoderKL from PIL import Image from ip_adapter.ip_adapter_faceid_separate import IPAdapterFaceID base_model_path = "SG161222/Realistic_Vision_V4.0_noVAE" vae_model_path = "stabilityai/sd-vae-ft-mse" ip_ckpt = "ip-adapter-faceid_sd15.bin" lora_ckpt = "ip-adapter-faceid_sd15_lora.safetensors" device = "cuda" noise_scheduler = DDIMScheduler( num_train_timesteps=1000, beta_start=0.00085, beta_end=0.012, beta_schedule="scaled_linear", clip_sample=False, set_alpha_to_one=False, steps_offset=1, ) vae = AutoencoderKL.from_pretrained(vae_model_path).to(dtype=torch.float16) pipe = StableDiffusionPipeline.from_pretrained( base_model_path, torch_dtype=torch.float16, scheduler=noise_scheduler, vae=vae, feature_extractor=None, safety_checker=None ) # load lora and fuse pipe.load_lora_weights(lora_ckpt) pipe.fuse_lora() # load ip-adapter ip_model = IPAdapterFaceID(pipe, ip_ckpt, device) # generate image prompt = "photo of a woman in red dress in a garden" negative_prompt = "monochrome, lowres, bad anatomy, worst quality, low quality, blurry" images = ip_model.generate( prompt=prompt, negative_prompt=negative_prompt, faceid_embeds=faceid_embeds, num_samples=4, width=512, height=768, num_inference_steps=30, seed=2023 ) ``` ### IP-Adapter-FaceID-SDXL Firstly, you should use [insightface](https://github.com/deepinsight/insightface) to extract face ID embedding: ```python import cv2 from insightface.app import FaceAnalysis import torch app = FaceAnalysis(name="buffalo_l", providers=['CUDAExecutionProvider', 'CPUExecutionProvider']) app.prepare(ctx_id=0, det_size=(640, 640)) image = cv2.imread("person.jpg") faces = app.get(image) faceid_embeds = torch.from_numpy(faces[0].normed_embedding).unsqueeze(0) ``` Then, you can generate images conditioned on the face embeddings: ```python import torch from diffusers import StableDiffusionXLPipeline, DDIMScheduler from PIL import Image from ip_adapter.ip_adapter_faceid import IPAdapterFaceIDXL base_model_path = "SG161222/RealVisXL_V3.0" ip_ckpt = "ip-adapter-faceid_sdxl.bin" device = "cuda" noise_scheduler = DDIMScheduler( num_train_timesteps=1000, beta_start=0.00085, beta_end=0.012, beta_schedule="scaled_linear", clip_sample=False, set_alpha_to_one=False, steps_offset=1, ) pipe = StableDiffusionXLPipeline.from_pretrained( base_model_path, torch_dtype=torch.float16, scheduler=noise_scheduler, add_watermarker=False, ) # load ip-adapter ip_model = IPAdapterFaceIDXL(pipe, ip_ckpt, device) # generate image prompt = "A closeup shot of a beautiful Asian teenage girl in a white dress wearing small silver earrings in the garden, under the soft morning light" negative_prompt = "monochrome, lowres, bad anatomy, worst quality, low quality, blurry" images = ip_model.generate( prompt=prompt, negative_prompt=negative_prompt, faceid_embeds=faceid_embeds, num_samples=2, width=1024, height=1024, num_inference_steps=30, guidance_scale=7.5, seed=2023 ) ``` ### IP-Adapter-FaceID-Plus Firstly, you should use [insightface](https://github.com/deepinsight/insightface) to extract face ID embedding and face image: ```python import cv2 from insightface.app import FaceAnalysis from insightface.utils import face_align import torch app = FaceAnalysis(name="buffalo_l", providers=['CUDAExecutionProvider', 'CPUExecutionProvider']) app.prepare(ctx_id=0, det_size=(640, 640)) image = cv2.imread("person.jpg") faces = app.get(image) faceid_embeds = torch.from_numpy(faces[0].normed_embedding).unsqueeze(0) face_image = face_align.norm_crop(image, landmark=faces[0].kps, image_size=224) # you can also segment the face ``` Then, you can generate images conditioned on the face embeddings: ```python import torch from diffusers import StableDiffusionPipeline, DDIMScheduler, AutoencoderKL from PIL import Image from ip_adapter.ip_adapter_faceid import IPAdapterFaceIDPlus v2 = False base_model_path = "SG161222/Realistic_Vision_V4.0_noVAE" vae_model_path = "stabilityai/sd-vae-ft-mse" image_encoder_path = "laion/CLIP-ViT-H-14-laion2B-s32B-b79K" ip_ckpt = "ip-adapter-faceid-plus_sd15.bin" if not v2 else "ip-adapter-faceid-plusv2_sd15.bin" device = "cuda" noise_scheduler = DDIMScheduler( num_train_timesteps=1000, beta_start=0.00085, beta_end=0.012, beta_schedule="scaled_linear", clip_sample=False, set_alpha_to_one=False, steps_offset=1, ) vae = AutoencoderKL.from_pretrained(vae_model_path).to(dtype=torch.float16) pipe = StableDiffusionPipeline.from_pretrained( base_model_path, torch_dtype=torch.float16, scheduler=noise_scheduler, vae=vae, feature_extractor=None, safety_checker=None ) # load ip-adapter ip_model = IPAdapterFaceIDPlus(pipe, image_encoder_path, ip_ckpt, device) # generate image prompt = "photo of a woman in red dress in a garden" negative_prompt = "monochrome, lowres, bad anatomy, worst quality, low quality, blurry" images = ip_model.generate( prompt=prompt, negative_prompt=negative_prompt, face_image=face_image, faceid_embeds=faceid_embeds, shortcut=v2, s_scale=1.0, num_samples=4, width=512, height=768, num_inference_steps=30, seed=2023 ) ``` ### IP-Adapter-FaceID-Portrait ```python import cv2 from insightface.app import FaceAnalysis import torch app = FaceAnalysis(name="buffalo_l", providers=['CUDAExecutionProvider', 'CPUExecutionProvider']) app.prepare(ctx_id=0, det_size=(640, 640)) images = ["1.jpg", "2.jpg", "3.jpg", "4.jpg", "5.jpg"] faceid_embeds = [] for image in images: image = cv2.imread("person.jpg") faces = app.get(image) faceid_embeds.append(torch.from_numpy(faces[0].normed_embedding).unsqueeze(0).unsqueeze(0)) faceid_embeds = torch.cat(faceid_embeds, dim=1) ``` ```python import torch from diffusers import StableDiffusionPipeline, DDIMScheduler, AutoencoderKL from PIL import Image from ip_adapter.ip_adapter_faceid_separate import IPAdapterFaceID base_model_path = "SG161222/Realistic_Vision_V4.0_noVAE" vae_model_path = "stabilityai/sd-vae-ft-mse" ip_ckpt = "ip-adapter-faceid-portrait_sd15.bin" device = "cuda" noise_scheduler = DDIMScheduler( num_train_timesteps=1000, beta_start=0.00085, beta_end=0.012, beta_schedule="scaled_linear", clip_sample=False, set_alpha_to_one=False, steps_offset=1, ) vae = AutoencoderKL.from_pretrained(vae_model_path).to(dtype=torch.float16) pipe = StableDiffusionPipeline.from_pretrained( base_model_path, torch_dtype=torch.float16, scheduler=noise_scheduler, vae=vae, feature_extractor=None, safety_checker=None ) # load ip-adapter ip_model = IPAdapterFaceID(pipe, ip_ckpt, device, num_tokens=16, n_cond=5) # generate image prompt = "photo of a woman in red dress in a garden" negative_prompt = "monochrome, lowres, bad anatomy, worst quality, low quality, blurry" images = ip_model.generate( prompt=prompt, negative_prompt=negative_prompt, faceid_embeds=faceid_embeds, num_samples=4, width=512, height=512, num_inference_steps=30, seed=2023 ) ``` ## Limitations and Bias - The models do not achieve perfect photorealism and ID consistency. - The generalization of the models is limited due to limitations of the training data, base model and face recognition model. ## Non-commercial use **AS InsightFace pretrained models are available for non-commercial research purposes, IP-Adapter-FaceID models are released exclusively for research purposes and is not intended for commercial use.**

facebook/esm2_t6_8M_UR50D

facebook

transformers

fill-mask

--- license: mit widget: - text: "MQIFVKTLTGKTITLEVEPS<mask>TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG" --- ## ESM-2 ESM-2 is a state-of-the-art protein model trained on a masked language modelling objective. It is suitable for fine-tuning on a wide range of tasks that take protein sequences as input. For detailed information on the model architecture and training data, please refer to the [accompanying paper](https://www.biorxiv.org/content/10.1101/2022.07.20.500902v2). You may also be interested in some demo notebooks ([PyTorch](https://colab.research.google.com/github/huggingface/notebooks/blob/main/examples/protein_language_modeling.ipynb), [TensorFlow](https://colab.research.google.com/github/huggingface/notebooks/blob/main/examples/protein_language_modeling-tf.ipynb)) which demonstrate how to fine-tune ESM-2 models on your tasks of interest. Several ESM-2 checkpoints are available in the Hub with varying sizes. Larger sizes generally have somewhat better accuracy, but require much more memory and time to train: | Checkpoint name | Num layers | Num parameters | |------------------------------|----|----------| | [esm2_t48_15B_UR50D](https://huggingface.co/facebook/esm2_t48_15B_UR50D) | 48 | 15B | | [esm2_t36_3B_UR50D](https://huggingface.co/facebook/esm2_t36_3B_UR50D) | 36 | 3B | | [esm2_t33_650M_UR50D](https://huggingface.co/facebook/esm2_t33_650M_UR50D) | 33 | 650M | | [esm2_t30_150M_UR50D](https://huggingface.co/facebook/esm2_t30_150M_UR50D) | 30 | 150M | | [esm2_t12_35M_UR50D](https://huggingface.co/facebook/esm2_t12_35M_UR50D) | 12 | 35M | | [esm2_t6_8M_UR50D](https://huggingface.co/facebook/esm2_t6_8M_UR50D) | 6 | 8M |

prajjwal1/bert-small

prajjwal1

transformers

--- language: - en license: - mit tags: - BERT - MNLI - NLI - transformer - pre-training --- The following model is a Pytorch pre-trained model obtained from converting Tensorflow checkpoint found in the [official Google BERT repository](https://github.com/google-research/bert). This is one of the smaller pre-trained BERT variants, together with [bert-tiny](https://huggingface.co/prajjwal1/bert-small), [bert-mini]([bert-small](https://huggingface.co/prajjwal1/bert-mini) and [bert-medium](https://huggingface.co/prajjwal1/bert-medium). They were introduced in the study `Well-Read Students Learn Better: On the Importance of Pre-training Compact Models` ([arxiv](https://arxiv.org/abs/1908.08962)), and ported to HF for the study `Generalization in NLI: Ways (Not) To Go Beyond Simple Heuristics` ([arXiv](https://arxiv.org/abs/2110.01518)). These models are supposed to be trained on a downstream task. If you use the model, please consider citing both the papers: ``` @misc{bhargava2021generalization, title={Generalization in NLI: Ways (Not) To Go Beyond Simple Heuristics}, author={Prajjwal Bhargava and Aleksandr Drozd and Anna Rogers}, year={2021}, eprint={2110.01518}, archivePrefix={arXiv}, primaryClass={cs.CL} } @article{DBLP:journals/corr/abs-1908-08962, author = {Iulia Turc and Ming{-}Wei Chang and Kenton Lee and Kristina Toutanova}, title = {Well-Read Students Learn Better: The Impact of Student Initialization on Knowledge Distillation}, journal = {CoRR}, volume = {abs/1908.08962}, year = {2019}, url = {http://arxiv.org/abs/1908.08962}, eprinttype = {arXiv}, eprint = {1908.08962}, timestamp = {Thu, 29 Aug 2019 16:32:34 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1908-08962.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ``` Config of this model: - `prajjwal1/bert-small` (L=4, H=512) [Model Link](https://huggingface.co/prajjwal1/bert-small) Other models to check out: - `prajjwal1/bert-tiny` (L=2, H=128) [Model Link](https://huggingface.co/prajjwal1/bert-tiny) - `prajjwal1/bert-mini` (L=4, H=256) [Model Link](https://huggingface.co/prajjwal1/bert-mini) - `prajjwal1/bert-medium` (L=8, H=512) [Model Link](https://huggingface.co/prajjwal1/bert-medium) Original Implementation and more info can be found in [this Github repository](https://github.com/prajjwal1/generalize_lm_nli). Twitter: [@prajjwal_1](https://twitter.com/prajjwal_1)

martin-ha/toxic-comment-model

martin-ha

transformers

text-classification

--- language: en --- ## Model description This model is a fine-tuned version of the [DistilBERT model](https://huggingface.co/transformers/model_doc/distilbert.html) to classify toxic comments. ## How to use You can use the model with the following code. ```python from transformers import AutoModelForSequenceClassification, AutoTokenizer, TextClassificationPipeline model_path = "martin-ha/toxic-comment-model" tokenizer = AutoTokenizer.from_pretrained(model_path) model = AutoModelForSequenceClassification.from_pretrained(model_path) pipeline = TextClassificationPipeline(model=model, tokenizer=tokenizer) print(pipeline('This is a test text.')) ``` ## Limitations and Bias This model is intended to use for classify toxic online classifications. However, one limitation of the model is that it performs poorly for some comments that mention a specific identity subgroup, like Muslim. The following table shows a evaluation score for different identity group. You can learn the specific meaning of this metrics [here](https://www.kaggle.com/c/jigsaw-unintended-bias-in-toxicity-classification/overview/evaluation). But basically, those metrics shows how well a model performs for a specific group. The larger the number, the better. | **subgroup** | **subgroup_size** | **subgroup_auc** | **bpsn_auc** | **bnsp_auc** | | ----------------------------- | ----------------- | ---------------- | ------------ | ------------ | | muslim | 108 | 0.689 | 0.811 | 0.88 | | jewish | 40 | 0.749 | 0.86 | 0.825 | | homosexual_gay_or_lesbian | 56 | 0.795 | 0.706 | 0.972 | | black | 84 | 0.866 | 0.758 | 0.975 | | white | 112 | 0.876 | 0.784 | 0.97 | | female | 306 | 0.898 | 0.887 | 0.948 | | christian | 231 | 0.904 | 0.917 | 0.93 | | male | 225 | 0.922 | 0.862 | 0.967 | | psychiatric_or_mental_illness | 26 | 0.924 | 0.907 | 0.95 | The table above shows that the model performs poorly for the muslim and jewish group. In fact, you pass the sentence "Muslims are people who follow or practice Islam, an Abrahamic monotheistic religion." Into the model, the model will classify it as toxic. Be mindful for this type of potential bias. ## Training data The training data comes this [Kaggle competition](https://www.kaggle.com/c/jigsaw-unintended-bias-in-toxicity-classification/data). We use 10% of the `train.csv` data to train the model. ## Training procedure You can see [this documentation and codes](https://github.com/MSIA/wenyang_pan_nlp_project_2021) for how we train the model. It takes about 3 hours in a P-100 GPU. ## Evaluation results The model achieves 94% accuracy and 0.59 f1-score in a 10000 rows held-out test set.

mpi-inno-comp/paecter

mpi-inno-comp

sentence-transformers

sentence-similarity

--- language: en pipeline_tag: sentence-similarity tags: - patent-similarity - sentence-transformers - feature-extraction - sentence-similarity - transformers datasets: - patents license: apache-2.0 --- # paecter This is a [sentence-transformers](https://www.SBERT.net) model. This model is fine-tuned on patent texts, leveraging Google's BERT for Patents as its base. It can be used to generate 1024 dimensional dense vector for patent texts for downstream tasks like semantic search, prior art search, clustering, and patent landscaping. <!--- Describe your model here --> ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer sentences = ["This is an example sentence", "Each sentence is converted"] model = SentenceTransformer('mpi-inno-comp/paecter') embeddings = model.encode(sentences) print(embeddings) ``` ## Usage (HuggingFace Transformers) Without [sentence-transformers](https://www.SBERT.net), you can use the model like this: First, you pass your input through the transformer model, then you have to apply the right pooling-operation on-top of the contextualized word embeddings. ```python from transformers import AutoTokenizer, AutoModel import torch #Mean Pooling - Take attention mask into account for correct averaging def mean_pooling(model_output, attention_mask): token_embeddings = model_output[0] #First element of model_output contains all token embeddings input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) # Sentences we want sentence embeddings for sentences = ['This is an example sentence', 'Each sentence is converted'] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('mpi-inno-comp/paecter') model = AutoModel.from_pretrained('mpi-inno-comp/paecter') # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt', max_length=512) # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, mean pooling. sentence_embeddings = mean_pooling(model_output, encoded_input['attention_mask']) print("Sentence embeddings:") print(sentence_embeddings) ``` ## Evaluation Results <!--- Describe how your model was evaluated --> Evaluation of this model is available in our paper, [PaECTER: Patent-level Representation Learning using Citation-informed Transformers ](https://arxiv.org/abs/2402.19411) ## Training The model was trained with the parameters: **DataLoader**: `torch.utils.data.dataloader.DataLoader` of length 318750 with parameters: ``` {'batch_size': 4, 'sampler': 'torch.utils.data.sampler.RandomSampler', 'batch_sampler': 'torch.utils.data.sampler.BatchSampler'} ``` **Loss**: `sentence_transformers.losses.CustomTripletLoss.CustomTripletLoss` with parameters: ``` {'distance_metric': 'TripletDistanceMetric.EUCLIDEAN', 'triplet_margin': 1} ``` Parameters of the fit()-Method: ``` { "epochs": 1, "evaluation_steps": 4000, "evaluator": "sentence_transformers.evaluation.TripletEvaluator.TripletEvaluator", "max_grad_norm": 1, "optimizer_class": "<class 'torch.optim.adamw.AdamW'>", "optimizer_params": { "lr": 1e-05 }, "scheduler": "WarmupLinear", "steps_per_epoch": null, "warmup_steps": 31875.0, "weight_decay": 0.01 } ``` ## Full Model Architecture ``` SentenceTransformer( (0): Transformer({'max_seq_length': 512, 'do_lower_case': False}) with Transformer model: BertModel (1): Pooling({'word_embedding_dimension': 1024, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False, 'pooling_mode_weightedmean_tokens': False, 'pooling_mode_lasttoken': False}) ) ``` ## Citing & Authors ``` @misc{ghosh2024paecter, title={PaECTER: Patent-level Representation Learning using Citation-informed Transformers}, author={Mainak Ghosh and Sebastian Erhardt and Michael E. Rose and Erik Buunk and Dietmar Harhoff}, year={2024}, eprint={2402.19411}, archivePrefix={arXiv}, primaryClass={cs.IR} } ```

ByteDance/SDXL-Lightning

ByteDance

diffusers

text-to-image

--- license: openrail++ tags: - text-to-image - stable-diffusion library_name: diffusers inference: false --- # SDXL-Lightning  SDXL-Lightning is a lightning-fast text-to-image generation model. It can generate high-quality 1024px images in a few steps. For more information, please refer to our research paper: [SDXL-Lightning: Progressive Adversarial Diffusion Distillation](https://arxiv.org/abs/2402.13929). We open-source the model as part of the research. Our models are distilled from [stabilityai/stable-diffusion-xl-base-1.0](https://huggingface.co/stabilityai/stable-diffusion-xl-base-1.0). This repository contains checkpoints for 1-step, 2-step, 4-step, and 8-step distilled models. The generation quality of our 2-step, 4-step, and 8-step model is amazing. Our 1-step model is more experimental. We provide both full UNet and LoRA checkpoints. The full UNet models have the best quality while the LoRA models can be applied to other base models. ## Demos * Generate with all configurations, best quality: [Demo](https://huggingface.co/spaces/ByteDance/SDXL-Lightning) ## Checkpoints * `sdxl_lightning_Nstep.safetensors`: All-in-one checkpoint, for ComfyUI. * `sdxl_lightning_Nstep_unet.safetensors`: UNet checkpoint only, for Diffusers. * `sdxl_lightning_Nstep_lora.safetensors`: LoRA checkpoint, for Diffusers and ComfyUI. ## Diffusers Usage Please always use the correct checkpoint for the corresponding inference steps. ### 2-Step, 4-Step, 8-Step UNet ```python import torch from diffusers import StableDiffusionXLPipeline, UNet2DConditionModel, EulerDiscreteScheduler from huggingface_hub import hf_hub_download from safetensors.torch import load_file base = "stabilityai/stable-diffusion-xl-base-1.0" repo = "ByteDance/SDXL-Lightning" ckpt = "sdxl_lightning_4step_unet.safetensors" # Use the correct ckpt for your step setting! # Load model. unet = UNet2DConditionModel.from_config(base, subfolder="unet").to("cuda", torch.float16) unet.load_state_dict(load_file(hf_hub_download(repo, ckpt), device="cuda")) pipe = StableDiffusionXLPipeline.from_pretrained(base, unet=unet, torch_dtype=torch.float16, variant="fp16").to("cuda") # Ensure sampler uses "trailing" timesteps. pipe.scheduler = EulerDiscreteScheduler.from_config(pipe.scheduler.config, timestep_spacing="trailing") # Ensure using the same inference steps as the loaded model and CFG set to 0. pipe("A girl smiling", num_inference_steps=4, guidance_scale=0).images[0].save("output.png") ``` ### 2-Step, 4-Step, 8-Step LoRA Use LoRA only if you are using non-SDXL base models. Otherwise use our UNet checkpoint for better quality. ```python import torch from diffusers import StableDiffusionXLPipeline, EulerDiscreteScheduler from huggingface_hub import hf_hub_download base = "stabilityai/stable-diffusion-xl-base-1.0" repo = "ByteDance/SDXL-Lightning" ckpt = "sdxl_lightning_4step_lora.safetensors" # Use the correct ckpt for your step setting! # Load model. pipe = StableDiffusionXLPipeline.from_pretrained(base, torch_dtype=torch.float16, variant="fp16").to("cuda") pipe.load_lora_weights(hf_hub_download(repo, ckpt)) pipe.fuse_lora() # Ensure sampler uses "trailing" timesteps. pipe.scheduler = EulerDiscreteScheduler.from_config(pipe.scheduler.config, timestep_spacing="trailing") # Ensure using the same inference steps as the loaded model and CFG set to 0. pipe("A girl smiling", num_inference_steps=4, guidance_scale=0).images[0].save("output.png") ``` ### 1-Step UNet The 1-step model is only experimental and the quality is much less stable. Consider using the 2-step model for much better quality. The 1-step model uses "sample" prediction instead of "epsilon" prediction! The scheduler needs to be configured correctly. ```python import torch from diffusers import StableDiffusionXLPipeline, UNet2DConditionModel, EulerDiscreteScheduler from huggingface_hub import hf_hub_download from safetensors.torch import load_file base = "stabilityai/stable-diffusion-xl-base-1.0" repo = "ByteDance/SDXL-Lightning" ckpt = "sdxl_lightning_1step_unet_x0.safetensors" # Use the correct ckpt for your step setting! # Load model. unet = UNet2DConditionModel.from_config(base, subfolder="unet").to("cuda", torch.float16) unet.load_state_dict(load_file(hf_hub_download(repo, ckpt), device="cuda")) pipe = StableDiffusionXLPipeline.from_pretrained(base, unet=unet, torch_dtype=torch.float16, variant="fp16").to("cuda") # Ensure sampler uses "trailing" timesteps and "sample" prediction type. pipe.scheduler = EulerDiscreteScheduler.from_config(pipe.scheduler.config, timestep_spacing="trailing", prediction_type="sample") # Ensure using the same inference steps as the loaded model and CFG set to 0. pipe("A girl smiling", num_inference_steps=1, guidance_scale=0).images[0].save("output.png") ``` ## ComfyUI Usage Please always use the correct checkpoint for the corresponding inference steps. Please use Euler sampler with sgm_uniform scheduler. ### 2-Step, 4-Step, 8-Step Full 1. Download the full checkpoint (`sdxl_lightning_Nstep.safetensors`) to `/ComfyUI/models/checkpoints`. 1. Download our [ComfyUI full workflow](comfyui/sdxl_lightning_workflow_full.json).  ### 2-Step, 4-Step, 8-Step LoRA Use LoRA only if you are using non-SDXL base models. Otherwise use our full checkpoint for better quality. 1. Prepare your own base model. 1. Download the LoRA checkpoint (`sdxl_lightning_Nstep_lora.safetensors`) to `/ComfyUI/models/loras` 1. Download our [ComfyUI LoRA workflow](comfyui/sdxl_lightning_workflow_lora.json).  ### 1-Step The 1-step model is only experimental and the quality is much less stable. Consider using the 2-step model for much better quality. 1. Update your ComfyUI to the latest version. 1. Download the full checkpoint (`sdxl_lightning_1step_x0.safetensors`) to `/ComfyUI/models/checkpoints`. 1. Download our [ComfyUI full 1-step workflow](comfyui/sdxl_lightning_workflow_full_1step.json).  ## Cite Our Work ``` @misc{lin2024sdxllightning, title={SDXL-Lightning: Progressive Adversarial Diffusion Distillation}, author={Shanchuan Lin and Anran Wang and Xiao Yang}, year={2024}, eprint={2402.13929}, archivePrefix={arXiv}, primaryClass={cs.CV} } ```

distilbert/distilbert-base-cased

distilbert

transformers

fill-mask

--- language: en license: apache-2.0 datasets: - bookcorpus - wikipedia --- # Model Card for DistilBERT base model (cased) This model is a distilled version of the [BERT base model](https://huggingface.co/bert-base-cased). It was introduced in [this paper](https://arxiv.org/abs/1910.01108). The code for the distillation process can be found [here](https://github.com/huggingface/transformers/tree/main/examples/research_projects/distillation). This model is cased: it does make a difference between english and English. All the training details on the pre-training, the uses, limitations and potential biases (included below) are the same as for [DistilBERT-base-uncased](https://huggingface.co/distilbert-base-uncased). We highly encourage to check it if you want to know more. ## Model description DistilBERT is a transformers model, smaller and faster than BERT, which was pretrained on the same corpus in a self-supervised fashion, using the BERT base model as a teacher. This means it was pretrained on the raw texts only, with no humans labelling them in any way (which is why it can use lots of publicly available data) with an automatic process to generate inputs and labels from those texts using the BERT base model. More precisely, it was pretrained with three objectives: - Distillation loss: the model was trained to return the same probabilities as the BERT base model. - Masked language modeling (MLM): this is part of the original training loss of the BERT base model. When taking a sentence, the model randomly masks 15% of the words in the input then run the entire masked sentence through the model and has to predict the masked words. This is different from traditional recurrent neural networks (RNNs) that usually see the words one after the other, or from autoregressive models like GPT which internally mask the future tokens. It allows the model to learn a bidirectional representation of the sentence. - Cosine embedding loss: the model was also trained to generate hidden states as close as possible as the BERT base model. This way, the model learns the same inner representation of the English language than its teacher model, while being faster for inference or downstream tasks. ## Intended uses & limitations You can use the raw model for either masked language modeling or next sentence prediction, but it's mostly intended to be fine-tuned on a downstream task. See the [model hub](https://huggingface.co/models?filter=distilbert) to look for fine-tuned versions on a task that interests you. Note that this model is primarily aimed at being fine-tuned on tasks that use the whole sentence (potentially masked) to make decisions, such as sequence classification, token classification or question answering. For tasks such as text generation you should look at model like GPT2. ### How to use You can use this model directly with a pipeline for masked language modeling: ```python >>> from transformers import pipeline >>> unmasker = pipeline('fill-mask', model='distilbert-base-uncased') >>> unmasker("Hello I'm a [MASK] model.") [{'sequence': "[CLS] hello i'm a role model. [SEP]", 'score': 0.05292855575680733, 'token': 2535, 'token_str': 'role'}, {'sequence': "[CLS] hello i'm a fashion model. [SEP]", 'score': 0.03968575969338417, 'token': 4827, 'token_str': 'fashion'}, {'sequence': "[CLS] hello i'm a business model. [SEP]", 'score': 0.034743521362543106, 'token': 2449, 'token_str': 'business'}, {'sequence': "[CLS] hello i'm a model model. [SEP]", 'score': 0.03462274372577667, 'token': 2944, 'token_str': 'model'}, {'sequence': "[CLS] hello i'm a modeling model. [SEP]", 'score': 0.018145186826586723, 'token': 11643, 'token_str': 'modeling'}] ``` Here is how to use this model to get the features of a given text in PyTorch: ```python from transformers import DistilBertTokenizer, DistilBertModel tokenizer = DistilBertTokenizer.from_pretrained('distilbert-base-uncased') model = DistilBertModel.from_pretrained("distilbert-base-uncased") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='pt') output = model(**encoded_input) ``` and in TensorFlow: ```python from transformers import DistilBertTokenizer, TFDistilBertModel tokenizer = DistilBertTokenizer.from_pretrained('distilbert-base-uncased') model = TFDistilBertModel.from_pretrained("distilbert-base-uncased") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='tf') output = model(encoded_input) ``` ### Limitations and bias Even if the training data used for this model could be characterized as fairly neutral, this model can have biased predictions. It also inherits some of [the bias of its teacher model](https://huggingface.co/bert-base-uncased#limitations-and-bias). ```python >>> from transformers import pipeline >>> unmasker = pipeline('fill-mask', model='distilbert-base-uncased') >>> unmasker("The White man worked as a [MASK].") [{'sequence': '[CLS] the white man worked as a blacksmith. [SEP]', 'score': 0.1235365942120552, 'token': 20987, 'token_str': 'blacksmith'}, {'sequence': '[CLS] the white man worked as a carpenter. [SEP]', 'score': 0.10142576694488525, 'token': 10533, 'token_str': 'carpenter'}, {'sequence': '[CLS] the white man worked as a farmer. [SEP]', 'score': 0.04985016956925392, 'token': 7500, 'token_str': 'farmer'}, {'sequence': '[CLS] the white man worked as a miner. [SEP]', 'score': 0.03932540491223335, 'token': 18594, 'token_str': 'miner'}, {'sequence': '[CLS] the white man worked as a butcher. [SEP]', 'score': 0.03351764753460884, 'token': 14998, 'token_str': 'butcher'}] >>> unmasker("The Black woman worked as a [MASK].") [{'sequence': '[CLS] the black woman worked as a waitress. [SEP]', 'score': 0.13283951580524445, 'token': 13877, 'token_str': 'waitress'}, {'sequence': '[CLS] the black woman worked as a nurse. [SEP]', 'score': 0.12586183845996857, 'token': 6821, 'token_str': 'nurse'}, {'sequence': '[CLS] the black woman worked as a maid. [SEP]', 'score': 0.11708822101354599, 'token': 10850, 'token_str': 'maid'}, {'sequence': '[CLS] the black woman worked as a prostitute. [SEP]', 'score': 0.11499975621700287, 'token': 19215, 'token_str': 'prostitute'}, {'sequence': '[CLS] the black woman worked as a housekeeper. [SEP]', 'score': 0.04722772538661957, 'token': 22583, 'token_str': 'housekeeper'}] ``` This bias will also affect all fine-tuned versions of this model. ## Training data DistilBERT pretrained on the same data as BERT, which is [BookCorpus](https://yknzhu.wixsite.com/mbweb), a dataset consisting of 11,038 unpublished books and [English Wikipedia](https://en.wikipedia.org/wiki/English_Wikipedia) (excluding lists, tables and headers). ## Training procedure ### Preprocessing The texts are lowercased and tokenized using WordPiece and a vocabulary size of 30,000. The inputs of the model are then of the form: ``` [CLS] Sentence A [SEP] Sentence B [SEP] ``` With probability 0.5, sentence A and sentence B correspond to two consecutive sentences in the original corpus and in the other cases, it's another random sentence in the corpus. Note that what is considered a sentence here is a consecutive span of text usually longer than a single sentence. The only constrain is that the result with the two "sentences" has a combined length of less than 512 tokens. The details of the masking procedure for each sentence are the following: - 15% of the tokens are masked. - In 80% of the cases, the masked tokens are replaced by `[MASK]`. - In 10% of the cases, the masked tokens are replaced by a random token (different) from the one they replace. - In the 10% remaining cases, the masked tokens are left as is. ### Pretraining The model was trained on 8 16 GB V100 for 90 hours. See the [training code](https://github.com/huggingface/transformers/tree/master/examples/distillation) for all hyperparameters details. ## Evaluation results When fine-tuned on downstream tasks, this model achieves the following results: Glue test results: | Task | MNLI | QQP | QNLI | SST-2 | CoLA | STS-B | MRPC | RTE | |:----:|:----:|:----:|:----:|:-----:|:----:|:-----:|:----:|:----:| | | 81.5 | 87.8 | 88.2 | 90.4 | 47.2 | 85.5 | 85.6 | 60.6 | ### BibTeX entry and citation info ```bibtex @article{Sanh2019DistilBERTAD, title={DistilBERT, a distilled version of BERT: smaller, faster, cheaper and lighter}, author={Victor Sanh and Lysandre Debut and Julien Chaumond and Thomas Wolf}, journal={ArXiv}, year={2019}, volume={abs/1910.01108} } ``` <a href="https://huggingface.co/exbert/?model=distilbert-base-uncased"> <img width="300px" src="https://cdn-media.huggingface.co/exbert/button.png"> </a>

colbert-ir/colbertv2.0

colbert-ir

transformers

--- license: mit language: - en tags: - ColBERT --- <p align="center"> <img align="center" src="https://github.com/stanford-futuredata/ColBERT/blob/main/docs/images/colbertofficial.png?raw=true" width="430px" /> </p> <p align="left"> # ColBERT (v2) ### ColBERT is a _fast_ and _accurate_ retrieval model, enabling scalable BERT-based search over large text collections in tens of milliseconds. [<img align="center" src="https://colab.research.google.com/assets/colab-badge.svg" />](https://colab.research.google.com/github/stanford-futuredata/ColBERT/blob/main/docs/intro2new.ipynb) <p align="center"> <img align="center" src="https://github.com/stanford-futuredata/ColBERT/blob/main/docs/images/ColBERT-Framework-MaxSim-W370px.png?raw=true" /> </p> <p align="center"> <b>Figure 1:</b> ColBERT's late interaction, efficiently scoring the fine-grained similarity between a queries and a passage. </p> As Figure 1 illustrates, ColBERT relies on fine-grained **contextual late interaction**: it encodes each passage into a **matrix** of token-level embeddings (shown above in blue). Then at search time, it embeds every query into another matrix (shown in green) and efficiently finds passages that contextually match the query using scalable vector-similarity (`MaxSim`) operators. These rich interactions allow ColBERT to surpass the quality of _single-vector_ representation models, while scaling efficiently to large corpora. You can read more in our papers: * [**ColBERT: Efficient and Effective Passage Search via Contextualized Late Interaction over BERT**](https://arxiv.org/abs/2004.12832) (SIGIR'20). * [**Relevance-guided Supervision for OpenQA with ColBERT**](https://arxiv.org/abs/2007.00814) (TACL'21). * [**Baleen: Robust Multi-Hop Reasoning at Scale via Condensed Retrieval**](https://arxiv.org/abs/2101.00436) (NeurIPS'21). * [**ColBERTv2: Effective and Efficient Retrieval via Lightweight Late Interaction**](https://arxiv.org/abs/2112.01488) (NAACL'22). * [**PLAID: An Efficient Engine for Late Interaction Retrieval**](https://arxiv.org/abs/2205.09707) (CIKM'22). ---- ## 🚨 **Announcements** * (1/29/23) We have merged a new index updater feature and support for additional Hugging Face models! These are in beta so please give us feedback as you try them out. * (1/24/23) If you're looking for the **DSP** framework for composing ColBERTv2 and LLMs, it's at: https://github.com/stanfordnlp/dsp ---- ## ColBERTv1 The ColBERTv1 code from the SIGIR'20 paper is in the [`colbertv1` branch](https://github.com/stanford-futuredata/ColBERT/tree/colbertv1). See [here](#branches) for more information on other branches. ## Installation ColBERT requires Python 3.7+ and Pytorch 1.9+ and uses the [Hugging Face Transformers](https://github.com/huggingface/transformers) library. We strongly recommend creating a conda environment using the commands below. (If you don't have conda, follow the official [conda installation guide](https://docs.anaconda.com/anaconda/install/linux/#installation).) We have also included a new environment file specifically for CPU-only environments (`conda_env_cpu.yml`), but note that if you are testing CPU execution on a machine that includes GPUs you might need to specify `CUDA_VISIBLE_DEVICES=""` as part of your command. Note that a GPU is required for training and indexing. ``` conda env create -f conda_env[_cpu].yml conda activate colbert ``` If you face any problems, please [open a new issue](https://github.com/stanford-futuredata/ColBERT/issues) and we'll help you promptly! ## Overview Using ColBERT on a dataset typically involves the following steps. **Step 0: Preprocess your collection.** At its simplest, ColBERT works with tab-separated (TSV) files: a file (e.g., `collection.tsv`) will contain all passages and another (e.g., `queries.tsv`) will contain a set of queries for searching the collection. **Step 1: Download the [pre-trained ColBERTv2 checkpoint](https://downloads.cs.stanford.edu/nlp/data/colbert/colbertv2/colbertv2.0.tar.gz).** This checkpoint has been trained on the MS MARCO Passage Ranking task. You can also _optionally_ [train your own ColBERT model](#training). **Step 2: Index your collection.** Once you have a trained ColBERT model, you need to [index your collection](#indexing) to permit fast retrieval. This step encodes all passages into matrices, stores them on disk, and builds data structures for efficient search. **Step 3: Search the collection with your queries.** Given the model and index, you can [issue queries over the collection](#retrieval) to retrieve the top-k passages for each query. Below, we illustrate these steps via an example run on the MS MARCO Passage Ranking task. ## API Usage Notebook **NEW**: We have an experimental notebook on [Google Colab](https://colab.research.google.com/github/stanford-futuredata/ColBERT/blob/main/docs/intro2new.ipynb) that you can use with free GPUs. Indexing 10,000 on the free Colab T4 GPU takes six minutes. This Jupyter notebook **[docs/intro.ipynb notebook](docs/intro.ipynb)** illustrates using the key features of ColBERT with the new Python API. It includes how to download the ColBERTv2 model checkpoint trained on MS MARCO Passage Ranking and how to download our new LoTTE benchmark. ## Data This repository works directly with a simple **tab-separated file** format to store queries, passages, and top-k ranked lists. * Queries: each line is `qid \t query text`. * Collection: each line is `pid \t passage text`. * Top-k Ranking: each line is `qid \t pid \t rank`. This works directly with the data format of the [MS MARCO Passage Ranking](https://github.com/microsoft/MSMARCO-Passage-Ranking) dataset. You will need the training triples (`triples.train.small.tar.gz`), the official top-1000 ranked lists for the dev set queries (`top1000.dev`), and the dev set relevant passages (`qrels.dev.small.tsv`). For indexing the full collection, you will also need the list of passages (`collection.tar.gz`). ## Indexing For fast retrieval, indexing precomputes the ColBERT representations of passages. Example usage: ```python from colbert.infra import Run, RunConfig, ColBERTConfig from colbert import Indexer if __name__=='__main__': with Run().context(RunConfig(nranks=1, experiment="msmarco")): config = ColBERTConfig( nbits=2, root="/path/to/experiments", ) indexer = Indexer(checkpoint="/path/to/checkpoint", config=config) indexer.index(name="msmarco.nbits=2", collection="/path/to/MSMARCO/collection.tsv") ``` ## Retrieval We typically recommend that you use ColBERT for **end-to-end** retrieval, where it directly finds its top-k passages from the full collection: ```python from colbert.data import Queries from colbert.infra import Run, RunConfig, ColBERTConfig from colbert import Searcher if __name__=='__main__': with Run().context(RunConfig(nranks=1, experiment="msmarco")): config = ColBERTConfig( root="/path/to/experiments", ) searcher = Searcher(index="msmarco.nbits=2", config=config) queries = Queries("/path/to/MSMARCO/queries.dev.small.tsv") ranking = searcher.search_all(queries, k=100) ranking.save("msmarco.nbits=2.ranking.tsv") ``` You can optionally specify the `ncells`, `centroid_score_threshold`, and `ndocs` search hyperparameters to trade off between speed and result quality. Defaults for different values of `k` are listed in colbert/searcher.py. We can evaluate the MSMARCO rankings using the following command: ``` python -m utility.evaluate.msmarco_passages --ranking "/path/to/msmarco.nbits=2.ranking.tsv" --qrels "/path/to/MSMARCO/qrels.dev.small.tsv" ``` ## Training We provide a [pre-trained model checkpoint](https://downloads.cs.stanford.edu/nlp/data/colbert/colbertv2/colbertv2.0.tar.gz), but we also detail how to train from scratch here. Note that this example demonstrates the ColBERTv1 style of training, but the provided checkpoint was trained with ColBERTv2. Training requires a JSONL triples file with a `[qid, pid+, pid-]` list per line. The query IDs and passage IDs correspond to the specified `queries.tsv` and `collection.tsv` files respectively. Example usage (training on 4 GPUs): ```python from colbert.infra import Run, RunConfig, ColBERTConfig from colbert import Trainer if __name__=='__main__': with Run().context(RunConfig(nranks=4, experiment="msmarco")): config = ColBERTConfig( bsize=32, root="/path/to/experiments", ) trainer = Trainer( triples="/path/to/MSMARCO/triples.train.small.tsv", queries="/path/to/MSMARCO/queries.train.small.tsv", collection="/path/to/MSMARCO/collection.tsv", config=config, ) checkpoint_path = trainer.train() print(f"Saved checkpoint to {checkpoint_path}...") ``` ## Running a lightweight ColBERTv2 server We provide a script to run a lightweight server which serves k (upto 100) results in ranked order for a given search query, in JSON format. This script can be used to power DSP programs. To run the server, update the environment variables `INDEX_ROOT` and `INDEX_NAME` in the `.env` file to point to the appropriate ColBERT index. The run the following command: ``` python server.py ``` A sample query: ``` http://localhost:8893/api/search?query=Who won the 2022 FIFA world cup&k=25 ``` ## Branches ### Supported branches * [`main`](https://github.com/stanford-futuredata/ColBERT/tree/main): Stable branch with ColBERTv2 + PLAID. * [`colbertv1`](https://github.com/stanford-futuredata/ColBERT/tree/colbertv1): Legacy branch for ColBERTv1. ### Deprecated branches * [`new_api`](https://github.com/stanford-futuredata/ColBERT/tree/new_api): Base ColBERTv2 implementation. * [`cpu_inference`](https://github.com/stanford-futuredata/ColBERT/tree/cpu_inference): ColBERTv2 implementation with CPU search support. * [`fast_search`](https://github.com/stanford-futuredata/ColBERT/tree/fast_search): ColBERTv2 implementation with PLAID. * [`binarization`](https://github.com/stanford-futuredata/ColBERT/tree/binarization): ColBERT with a baseline binarization-based compression strategy (as opposed to ColBERTv2's residual compression, which we found to be more robust). ## Acknowledgments ColBERT logo designed by Chuyi Zhang.

ckiplab/albert-tiny-chinese-ws

ckiplab

transformers

token-classification

--- language: - zh thumbnail: https://ckip.iis.sinica.edu.tw/files/ckip_logo.png tags: - pytorch - token-classification - albert - zh license: gpl-3.0 --- # CKIP ALBERT Tiny Chinese This project provides traditional Chinese transformers models (including ALBERT, BERT, GPT2) and NLP tools (including word segmentation, part-of-speech tagging, named entity recognition). 這個專案提供了繁體中文的 transformers 模型（包含 ALBERT、BERT、GPT2）及自然語言處理工具（包含斷詞、詞性標記、實體辨識）。 ## Homepage - https://github.com/ckiplab/ckip-transformers ## Contributers - [Mu Yang](https://muyang.pro) at [CKIP](https://ckip.iis.sinica.edu.tw) (Author & Maintainer) ## Usage Please use BertTokenizerFast as tokenizer instead of AutoTokenizer. 請使用 BertTokenizerFast 而非 AutoTokenizer。 ``` from transformers import ( BertTokenizerFast, AutoModel, ) tokenizer = BertTokenizerFast.from_pretrained('bert-base-chinese') model = AutoModel.from_pretrained('ckiplab/albert-tiny-chinese-ws') ``` For full usage and more information, please refer to https://github.com/ckiplab/ckip-transformers. 有關完整使用方法及其他資訊，請參見 https://github.com/ckiplab/ckip-transformers 。

Helsinki-NLP/opus-mt-ru-en

Helsinki-NLP

transformers

translation

--- tags: - translation license: cc-by-4.0 --- ### opus-mt-ru-en ## Table of Contents - [Model Details](#model-details) - [Uses](#uses) - [Risks, Limitations and Biases](#risks-limitations-and-biases) - [Training](#training) - [Evaluation](#evaluation) - [Citation Information](#citation-information) - [How to Get Started With the Model](#how-to-get-started-with-the-model) ## Model Details **Model Description:** - **Developed by:** Language Technology Research Group at the University of Helsinki - **Model Type:** Transformer-align - **Language(s):** - Source Language: Russian - Target Language: English - **License:** CC-BY-4.0 - **Resources for more information:** - [GitHub Repo](https://github.com/Helsinki-NLP/OPUS-MT-train) ## Uses #### Direct Use This model can be used for translation and text-to-text generation. ## Risks, Limitations and Biases **CONTENT WARNING: Readers should be aware this section contains content that is disturbing, offensive, and can propagate historical and current stereotypes.** Significant research has explored bias and fairness issues with language models (see, e.g., [Sheng et al. (2021)](https://aclanthology.org/2021.acl-long.330.pdf) and [Bender et al. (2021)](https://dl.acm.org/doi/pdf/10.1145/3442188.3445922)). Further details about the dataset for this model can be found in the OPUS readme: [ru-en](https://github.com/Helsinki-NLP/OPUS-MT-train/blob/master/models/ru-en/README.md) ## Training #### Training Data ##### Preprocessing * Pre-processing: Normalization + SentencePiece * Dataset: [opus](https://github.com/Helsinki-NLP/Opus-MT) * Download original weights: [opus-2020-02-26.zip](https://object.pouta.csc.fi/OPUS-MT-models/ru-en/opus-2020-02-26.zip) * Test set translations: [opus-2020-02-26.test.txt](https://object.pouta.csc.fi/OPUS-MT-models/ru-en/opus-2020-02-26.test.txt) ## Evaluation #### Results * test set scores: [opus-2020-02-26.eval.txt](https://object.pouta.csc.fi/OPUS-MT-models/ru-en/opus-2020-02-26.eval.txt) #### Benchmarks | testset | BLEU | chr-F | |-----------------------|-------|-------| | newstest2012.ru.en | 34.8 | 0.603 | | newstest2013.ru.en | 27.9 | 0.545 | | newstest2014-ruen.ru.en | 31.9 | 0.591 | | newstest2015-enru.ru.en | 30.4 | 0.568 | | newstest2016-enru.ru.en | 30.1 | 0.565 | | newstest2017-enru.ru.en | 33.4 | 0.593 | | newstest2018-enru.ru.en | 29.6 | 0.565 | | newstest2019-ruen.ru.en | 31.4 | 0.576 | | Tatoeba.ru.en | 61.1 | 0.736 | ## Citation Information ```bibtex @InProceedings{TiedemannThottingal:EAMT2020, author = {J{\"o}rg Tiedemann and Santhosh Thottingal}, title = {{OPUS-MT} — {B}uilding open translation services for the {W}orld}, booktitle = {Proceedings of the 22nd Annual Conferenec of the European Association for Machine Translation (EAMT)}, year = {2020}, address = {Lisbon, Portugal} } ``` ## How to Get Started With the Model ```python from transformers import AutoTokenizer, AutoModelForSeq2SeqLM tokenizer = AutoTokenizer.from_pretrained("Helsinki-NLP/opus-mt-ru-en") model = AutoModelForSeq2SeqLM.from_pretrained("Helsinki-NLP/opus-mt-ru-en") ```

allenai/scibert_scivocab_uncased

allenai

transformers

--- language: en --- # SciBERT This is the pretrained model presented in [SciBERT: A Pretrained Language Model for Scientific Text](https://www.aclweb.org/anthology/D19-1371/), which is a BERT model trained on scientific text. The training corpus was papers taken from [Semantic Scholar](https://www.semanticscholar.org). Corpus size is 1.14M papers, 3.1B tokens. We use the full text of the papers in training, not just abstracts. SciBERT has its own wordpiece vocabulary (scivocab) that's built to best match the training corpus. We trained cased and uncased versions. Available models include: * `scibert_scivocab_cased` * `scibert_scivocab_uncased` The original repo can be found [here](https://github.com/allenai/scibert). If using these models, please cite the following paper: ``` @inproceedings{beltagy-etal-2019-scibert, title = "SciBERT: A Pretrained Language Model for Scientific Text", author = "Beltagy, Iz and Lo, Kyle and Cohan, Arman", booktitle = "EMNLP", year = "2019", publisher = "Association for Computational Linguistics", url = "https://www.aclweb.org/anthology/D19-1371" } ```

pyannote/voice-activity-detection

pyannote

pyannote-audio

automatic-speech-recognition

--- tags: - pyannote - pyannote-audio - pyannote-audio-pipeline - audio - voice - speech - speaker - voice-activity-detection - automatic-speech-recognition datasets: - ami - dihard - voxconverse license: mit extra_gated_prompt: "The collected information will help acquire a better knowledge of pyannote.audio userbase and help its maintainers apply for grants to improve it further. If you are an academic researcher, please cite the relevant papers in your own publications using the model. If you work for a company, please consider contributing back to pyannote.audio development (e.g. through unrestricted gifts). We also provide scientific consulting services around speaker diarization and machine listening." extra_gated_fields: Company/university: text Website: text I plan to use this model for (task, type of audio data, etc): text --- I propose (paid) scientific [consulting services](https://herve.niderb.fr/consulting.html) to companies willing to make the most of their data and open-source speech processing toolkits (and `pyannote` in particular). # 🎹 Voice activity detection Relies on pyannote.audio 2.1: see [installation instructions](https://github.com/pyannote/pyannote-audio#installation). ```python # 1. visit hf.co/pyannote/segmentation and accept user conditions # 2. visit hf.co/settings/tokens to create an access token # 3. instantiate pretrained voice activity detection pipeline from pyannote.audio import Pipeline pipeline = Pipeline.from_pretrained("pyannote/voice-activity-detection", use_auth_token="ACCESS_TOKEN_GOES_HERE") output = pipeline("audio.wav") for speech in output.get_timeline().support(): # active speech between speech.start and speech.end ... ``` ## Citation ```bibtex @inproceedings{Bredin2021, Title = {{End-to-end speaker segmentation for overlap-aware resegmentation}}, Author = {{Bredin}, Herv{\'e} and {Laurent}, Antoine}, Booktitle = {Proc. Interspeech 2021}, Address = {Brno, Czech Republic}, Month = {August}, Year = {2021}, } ``` ```bibtex @inproceedings{Bredin2020, Title = {{pyannote.audio: neural building blocks for speaker diarization}}, Author = {{Bredin}, Herv{\'e} and {Yin}, Ruiqing and {Coria}, Juan Manuel and {Gelly}, Gregory and {Korshunov}, Pavel and {Lavechin}, Marvin and {Fustes}, Diego and {Titeux}, Hadrien and {Bouaziz}, Wassim and {Gill}, Marie-Philippe}, Booktitle = {ICASSP 2020, IEEE International Conference on Acoustics, Speech, and Signal Processing}, Address = {Barcelona, Spain}, Month = {May}, Year = {2020}, } ```

microsoft/resnet-50

microsoft

transformers

image-classification

--- license: apache-2.0 tags: - vision - image-classification datasets: - imagenet-1k --- # ResNet-50 v1.5 ResNet model pre-trained on ImageNet-1k at resolution 224x224. It was introduced in the paper [Deep Residual Learning for Image Recognition](https://arxiv.org/abs/1512.03385) by He et al. Disclaimer: The team releasing ResNet did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description ResNet (Residual Network) is a convolutional neural network that democratized the concepts of residual learning and skip connections. This enables to train much deeper models. This is ResNet v1.5, which differs from the original model: in the bottleneck blocks which require downsampling, v1 has stride = 2 in the first 1x1 convolution, whereas v1.5 has stride = 2 in the 3x3 convolution. This difference makes ResNet50 v1.5 slightly more accurate (\~0.5% top1) than v1, but comes with a small performance drawback (~5% imgs/sec) according to [Nvidia](https://catalog.ngc.nvidia.com/orgs/nvidia/resources/resnet_50_v1_5_for_pytorch).  ## Intended uses & limitations You can use the raw model for image classification. See the [model hub](https://huggingface.co/models?search=resnet) to look for fine-tuned versions on a task that interests you. ### How to use Here is how to use this model to classify an image of the COCO 2017 dataset into one of the 1,000 ImageNet classes: ```python from transformers import AutoImageProcessor, ResNetForImageClassification import torch from datasets import load_dataset dataset = load_dataset("huggingface/cats-image") image = dataset["test"]["image"][0] processor = AutoImageProcessor.from_pretrained("microsoft/resnet-50") model = ResNetForImageClassification.from_pretrained("microsoft/resnet-50") inputs = processor(image, return_tensors="pt") with torch.no_grad(): logits = model(**inputs).logits # model predicts one of the 1000 ImageNet classes predicted_label = logits.argmax(-1).item() print(model.config.id2label[predicted_label]) ``` For more code examples, we refer to the [documentation](https://huggingface.co/docs/transformers/main/en/model_doc/resnet). ### BibTeX entry and citation info ```bibtex @inproceedings{he2016deep, title={Deep residual learning for image recognition}, author={He, Kaiming and Zhang, Xiangyu and Ren, Shaoqing and Sun, Jian}, booktitle={Proceedings of the IEEE conference on computer vision and pattern recognition}, pages={770--778}, year={2016} } ```

davebulaval/MeaningBERT

davebulaval

transformers

text-classification

--- title: MeaningBERT emoji: 🦀 colorFrom: purple colorTo: indigo sdk: gradio sdk_version: 4.2.0 app_file: app.py pinned: false --- # Here is MeaningBERT MeaningBERT is an automatic and trainable metric for assessing meaning preservation between sentences. MeaningBERT was proposed in our article [MeaningBERT: assessing meaning preservation between sentences](https://www.frontiersin.org/articles/10.3389/frai.2023.1223924/full). Its goal is to assess meaning preservation between two sentences that correlate highly with human judgments and sanity checks. For more details, refer to our publicly available article. > This public version of our model uses the best model trained (where in our article, we present the performance results > of an average of 10 models) for a more extended period (500 epochs instead of 250). We have observed later that the > model can further reduce dev loss and increase performance. Also, we have changed the data augmentation technique used > in the article for a more robust one, that also includes the commutative property of the meaning function. Namely, Meaning(Sent_a, Sent_b) = Meaning(Sent_b, Sent_a). - [HuggingFace Model Card](https://huggingface.co/davebulaval/MeaningBERT) - [HuggingFace Metric Card](https://huggingface.co/spaces/davebulaval/meaningbert) ## Sanity Check Correlation to human judgment is one way to evaluate the quality of a meaning preservation metric. However, it is inherently subjective, since it uses human judgment as a gold standard, and expensive since it requires a large dataset annotated by several humans. As an alternative, we designed two automated tests: evaluating meaning preservation between identical sentences (which should be 100% preserving) and between unrelated sentences (which should be 0% preserving). In these tests, the meaning preservation target value is not subjective and does not require human annotation to be measured. They represent a trivial and minimal threshold a good automatic meaning preservation metric should be able to achieve. Namely, a metric should be minimally able to return a perfect score (i.e., 100%) if two identical sentences are compared and return a null score (i.e., 0%) if two sentences are completely unrelated. ### Identical Sentences The first test evaluates meaning preservation between identical sentences. To analyze the metrics' capabilities to pass this test, we count the number of times a metric rating was greater or equal to a threshold value X∈[95, 99] and divide It is calculated by the number of sentences to create a ratio of the number of times the metric gives the expected rating. To account for computer floating-point inaccuracy, we round the ratings to the nearest integer and do not use a threshold value of 100%. ### Unrelated Sentences Our second test evaluates meaning preservation between a source sentence and an unrelated sentence generated by a large language model.3 The idea is to verify that the metric finds a meaning preservation rating of 0 when given a completely irrelevant sentence mainly composed of irrelevant words (also known as word soup). Since this test's expected rating is 0, we check that the metric rating is lower or equal to a threshold value X∈[5, 1]. Again, to account for computer floating-point inaccuracy, we round the ratings to the nearest integer and do not use a threshold value of 0%. ## Use MeaningBERT You can use MeaningBERT as a [model](https://huggingface.co/davebulaval/MeaningBERT) that you can retrain or use for inference using the following with HuggingFace ```python # Load model directly from transformers import AutoTokenizer, AutoModelForSequenceClassification tokenizer = AutoTokenizer.from_pretrained("davebulaval/MeaningBERT") model = AutoModelForSequenceClassification.from_pretrained("davebulaval/MeaningBERT") ``` or you can use MeaningBERT as a metric for evaluation (no retrain) using the following with HuggingFace ```python import torch from transformers import AutoTokenizer, AutoModelForSequenceClassification tokenizer = AutoTokenizer.from_pretrained("davebulaval/MeaningBERT") scorer = AutoModelForSequenceClassification.from_pretrained("davebulaval/MeaningBERT") scorer.eval() documents = ["He wanted to make them pay.", "This sandwich looks delicious.", "He wants to eat."] simplifications = ["He wanted to make them pay.", "This sandwich looks delicious.", "Whatever, whenever, this is a sentence."] # We tokenize the text as a pair and return Pytorch Tensors tokenize_text = tokenizer(documents, simplifications, truncation=True, padding=True, return_tensors="pt") with torch.no_grad(): # We process the text scores = scorer(**tokenize_text) print(scores.logits.tolist()) ``` or using our HuggingFace Metric module ```python import evaluate documents = ["He wanted to make them pay.", "This sandwich looks delicious.", "He wants to eat."] simplifications = ["He wanted to make them pay.", "This sandwich looks delicious.", "Whatever, whenever, this is a sentence."] meaning_bert = evaluate.load("davebulaval/meaningbert") print(meaning_bert.compute(documents=documents, simplifications=simplifications)) ``` ------------------ ## Cite Use the following citation to cite MeaningBERT ``` @ARTICLE{10.3389/frai.2023.1223924, AUTHOR={Beauchemin, David and Saggion, Horacio and Khoury, Richard}, TITLE={MeaningBERT: assessing meaning preservation between sentences}, JOURNAL={Frontiers in Artificial Intelligence}, VOLUME={6}, YEAR={2023}, URL={https://www.frontiersin.org/articles/10.3389/frai.2023.1223924}, DOI={10.3389/frai.2023.1223924}, ISSN={2624-8212}, } ``` ------------------ ## Contributing to MeaningBERT We welcome user input, whether it regards bugs found in the library or feature propositions! Make sure to have a look at our [contributing guidelines](https://github.com/GRAAL-Research/MeaningBERT/blob/main/.github/CONTRIBUTING.md) for more details on this matter. ## License MeaningBERT is MIT licensed, as found in the [LICENSE file](https://github.com/GRAAL-Research/risc/blob/main/LICENSE). ------------------

kredor/punctuate-all

kredor

transformers

token-classification

This is based on [Oliver Guhr's work](https://huggingface.co/oliverguhr/fullstop-punctuation-multilang-large). The difference is that it is a finetuned xlm-roberta-base instead of an xlm-roberta-large and on twelve languages instead of four. The languages are: English, German, French, Spanish, Bulgarian, Italian, Polish, Dutch, Czech, Portugese, Slovak, Slovenian. ----- report ----- precision recall f1-score support 0 0.99 0.99 0.99 73317475 . 0.94 0.95 0.95 4484845 , 0.86 0.86 0.86 6100650 ? 0.88 0.85 0.86 136479 - 0.60 0.29 0.39 233630 : 0.71 0.49 0.58 152424 accuracy 0.98 84425503 macro avg 0.83 0.74 0.77 84425503 weighted avg 0.98 0.98 0.98 84425503 ----- confusion matrix ----- t/p 0 . , ? - : 0 1.0 0.0 0.0 0.0 0.0 0.0 . 0.0 1.0 0.0 0.0 0.0 0.0 , 0.1 0.0 0.9 0.0 0.0 0.0 ? 0.0 0.1 0.0 0.8 0.0 0.0 - 0.1 0.1 0.5 0.0 0.3 0.0 : 0.0 0.3 0.1 0.0 0.0 0.5