text_clean
stringlengths 3
2.28M
| label
int64 0
1
|
---|---|
as a first step towards this issue is about changing the message flow of opening and closing of regions without actually changing the implementation of what happens on both the master and regionserver sides this way we can debug the messaging changes before the introduction of more significant changes to the master architecture and handling of regions in transition | 1 |
deployed the wicket example to jboss as and i was checking conversation handling so i was booking a hotel and returned to search page using the link at the top of the page then i selected a different hotel and saw a wicket error page and the exception below in the logsthis is happening in snapshot as of today i have not confirmed if it is in error method onlinkclicked of interface orgapachewicketmarkuphtmllinkilinklistener targeted at component threw an exceptionorgapachewicketwicketruntimeexception method onlinkclicked of interface orgapachewicketmarkuphtmllinkilinklistener targeted at component threw an exception at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at by javalangreflectinvocationtargetexception at method at at at at morecaused by javalangillegalstateexception begin method invoked from a longrunning conversation try using beginjointrue on method onclick at at at at at error error serializing object class orgjbossseamexamplewicketmain orgapachewicketutilioserializablecheckerwicketnotserializableexception unable to serialize class javalangreflectmethodfield hierarchy is private orgjbossseamexamplewicketactionbookinglist orgjbossseamexamplewicketmainbookinglist private javautillist orgjbossseaminterceptrootinterceptoruserinterceptors private final javautilconcurrentlocksreentrantlocksync javautilconcurrentlocksreentrantlocksync private javautilmap orgjbossseamsecuritysecurityinterceptorrestrictions private javautilmap orgjbossseamsecuritysecurityinterceptorrestrictions field that is not serializable at at at at at at at source at at at at at at at at at at at at at at at at source at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at by javaionotserializableexception javalangreflectmethod at at at at source at at at at at at at at at at at at at source at at at at at at at at at at at at at at at at more | 1 |
current gfac output handling in orgapacheairavatacoregfacutilsoutpututils does not cover all output types various outputs should be handled example arrays should allow a delimiter strings should be handled by stripping quotes uris should be handled by such that absolute and relate paths can be written by applications | 1 |
user query traverse on indexedge and current implemenation for deserialize bytes array into indexedge firstindexedgedeserializable then call indexedgetoedge to create edge classi found out following parts copy data which is unnecessarynoformatpropsmap case k v k innervallikewithtsv version noformatthis inefficiency exist because indexedge use map and edge use map as type of props valueit sounds like micro optimization but since this is called a lot actually dependent on fetched edges i think improving this would create some changes on performanceto remove unnecessary copy i am suggesting change type of indexedges props same with edges props type map | 0 |
when we use hive remote metastore startupmsg and shutdownmsg are output in metastore log like | 0 |
the blacklist timeout check is backwards in the getblacklist method the isblacklisted is correct it removes from the blacklist if delta blacklisttimeout whereas getblacklist is removing if delta blacklisttimeoutthis bug causes destinations that get blacklisted to be removed from the blacklist before the timeout resulting in those requests having to be retried on another node it also could result in a backlisted destination from not being added back into the available destinations if one gets blacklisted and the next time it is checked that the blacklist timeout has passed that destination would then never be removed from the blacklist codejava public final class discoveryejbclientinterceptor implements ejbclientinterceptor private static final long blacklisttimeout accesscontrollerdoprivilegedprivilegedaction string val systemgetpropertyorgjbossejbclientdiscoveryblacklisttimeout try return timeunitmillisecondstonanoslongvalueofval catch numberformatexception e return static boolean isblacklistedabstractinvocationcontext context uri destination final set invocationblacklist if invocationblacklist null invocationblacklistcontainsdestination return if blacklistcontainskeydestination return final long blacklistedtimestamp final long delta systemnanotime if delta blacklisttimeout return else return private static set blacklistentrysetremoveife final long delta systemnanotime return delta return code | 0 |
doc issue contact philipphil cattanach” brought up during feb tobiash need docs providing more info about migrations from oraclejdk to openjdk and upgrading to a newer openjdk version rn includes base info but nothing about versions and nothing about openjdk to openjdk upgrades from amm pm discussionphilc not critical to add this information for release coming up in late march can open a jira to track this as future doc work | 0 |
seen in logs not sure what causes this this vm file is contentcontenttooltoolsrcwebappvmresourcessakaipropertiesscriptsvm error left side calendarcounter of operation has null value at vmresourcessakaipropertiesscriptsvm error left side calendarcounter of operation has null value at vmresourcessakaipropertiesscriptsvm | 0 |
hi we have identified the thread blocking during the deletion of temporary topic scenario we have a setup of requestreply mode using the temporary destinations the server hit no space memory and activemq is also stuck with that during this time the broker also fails to connect with the client checked the threads both send and delete was waiting for the connection it was stuck ar syncsendpacket expected behaviorno problem quoteat at at at at at we have restarted our activemq then after few minutes the amq is reconnected successfully then we have found that the thread blocking again the thread dump revelas that deletetempdestination is still waiting for the connection while send is resumed properly when it is reconnected with the broker problemcolor uri quote help me regarding this scenario am i missing something herecolor thanks in advance | 1 |
refer to the the rhamt ga review googledoc | 1 |
using project class groovyxjavafxgroovyfx line closuresetdelegatenew scenegraphbuilderprimarystage scenegraphbuilder is marked as cannot find symbol although groovyxjavafxscenegrpahbuildergroovy is available in the same package | 0 |
the slide webdav lib supports encrypted https connections so it should be possible to add https support to vfs too currently the webdav provider creates http urls in webdavclientfactoryjavamaybe some provider like webdavs could be added to switch to httpsurlregardswerner | 0 |
see for more | 0 |
noformathive describe function arraydescribe function arrayfailed parse error line cannot recognize input array in describe statementhive describe function arraydescribe function creates an array with the given elements time taken secondshive describe function mapdescribe function mapfailed parse error line cannot recognize input map in describe statementhive describe function mapdescribe function creates a map with the given keyvalue pairs time taken secondshive describe function casedescribe function casefailed parse error line cannot recognize input case in describe statementhive describe function casedescribe function caseokthere is no documentation for function casetime taken secondsnoformat | 0 |
online occasions throughout all genres are likewise main to the uks songs economic climate in incomes from online songs overtook tapetaping ending up being an ever before agen togel terpercaya much a lot extra important part of musicians livelihoods therefore there is a higher require compared to ever before for a variety of locations from bars with to fields for recently established acts to development with as they expand their target market however important components of this online songs ecology have experienced recently grassroots togel hari ini locations are operate on limited margins and have been under stress for a long time from outside elements such as increasing expenses and gentrification also the bordering plan context could include to the concern also without the straightout suspicion on agen togel indonesia show over shake ‘n coming in the regional authorities licensing and advancement plans could militate versus a healthy and balanced songs scene if treatment isnt really required to safeguard it in between and london shed of its grassroots locations this developing dilemma triggered a reaction and agen togel singapura the songs location count on developed in functioned to press the provide up the plan program liaising with the mayor of londons workplace to develop a songs location save strategy and appoint a evening mayor to champ the citys nighttime economic climate the songs location trusts research study programs that the variety of locations in the funding in january was steady for the very first time in years however it takes a collective initiative and the circumstance is febrile for locations backwards and forwards the nation with endangered closures currently a consistent abstain | 0 |
a processor has a defined class name in the nar package when this name is changed and the processor exist in the current flow then nifi will not start but throw an exceptioninstead of throwing an exception and shutting down nifi the application should remove the invalidnot existing processor from the flow instead and start nifi as usual | 0 |
install on ubuntu run resultsegmentation fault core dumpedexpected result no error message the example should be run | 1 |
the code has a test case that uses a proprietary api field arraylength codejava warning arraylength is internal proprietary api and may be removed in a future release import comsunorgapachebcelinternalgenericarraylength warning arraylength is internal proprietary api and may be removed in a future release import comsunorgapachebcelinternalgenericarraylength warning arraylength is internal proprietary api and may be removed in a future release import comsunorgapachebcelinternalgenericarraylength code remove the import of this class as its not used and causes spurious warnings | 0 |
we need to ensure that we start pushing content to setup dod content is available behind like for previous centos releases we have rewriterules in place on mirrorstreamcentosorg vhost to redirect iso download to that cdn until mirrormanager has mirrors and then well redirect there | 1 |
get the following error message when try to download jira belarusian belarus language pack from marketplace or update from upm noformat requesting get on servlet files but only have get noformat | 1 |
description of problemwhen kiescanner is being created around a kiecontainer using kiemodule which has not been deployed into local maven repository nor its pom is otherwise accessible to kiescanner kiescanner reverts to parsing pomxml of the test project it is running in ie droolscompiler this pomxml fails to be parsed by native maven pom parser which leads to probably incorrectly initialized kiemodules dependencies resulting in the following npejavalangnullpointerexception null at at at at at at at be aware that the same npe although with a slightly different stacktrace is thrown if the artifact is being redeployed into local maven repository while kiescanner is scanning it concurrency issue this is quite serious because the kiescanner thread then stops scanning for new updatesexception in thread javalangnullpointerexception at at at at at at at at number of selected component if applicablebrms reproduciblealways the first npesteps to run the test from the attached pull requestactual resultstest fails with npeexpected resultstest succeedsadditional infoi have prepared reproducer for the first stacktrace of the npe as it is reproducible if you needed i can attach standalone reproducer for the second one or test the fix myself | 1 |
once tested push updated repositories to production | 0 |
as discussed we will upgrade auiarchive to use webdriver requires test conversion | 1 |
is not signed by a trusted signer exception on ibm jdksteps to reproduce use ibm jdk version se runtime environment build vm build jre linux compressed references jit enabled aot based on oracle create a deployment use private orgbouncycastle jboss module by adding jbossdeploymentstructurexmlcodexml code create this rest endpointcodejava get pathtest public string test throws exception outputencryptor encryptor new setproviderbc build return encryptortostring code use this provided dependencycodexml orgbouncycastle provided code make http call to previous endpoint oraclejdk ok wf with ibm jdk ok eap with ibm error default exception handling request to customapplicationtesttest orgjbossresteasyspiunhandledexception orgbouncycastlecmscmsexception cannot create key generator jce cannot authenticate the provider bc at at at at at at source at at source at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at source at at source at at source at at source at at source at at at at at at at at at at at by orgbouncycastlecmscmsexception cannot create key generator jce cannot authenticate the provider bc at at at at at orgjbosstesttestresourceproxyweldclientproxytestunknown source at method at at at at at at at at source at at at at at morecaused by javasecuritynosuchproviderexception jce cannot authenticate the provider bc at javaxcryptobaunknown source at javaxcryptokeygeneratorgetinstanceunknown source at at morecaused by javautiljarjarexception is not signed by a trusted signer at javaxcryptoaaunknown source at javaxcryptoaaunknown source at javaxcryptoaaunknown source at javaxcryptobbunknown source at javaxcryptobaunknown source morenoformat | 1 |
i released on ossrh few days ago but its still not synced with maven central i didnt have such issue with any previous version | 0 |
env cluster with sles centos and slurm purpose improve the current soak tests to scale to any number of client nodes processes tasks when running ior description the current soak test is both short running and uses few clients and servers create a variant that utilizes more of each particularly clients which can cores on a given machine and runs for hours | 1 |
noformat insecureplatformwarning complete output from command python setuppy egginfo using kuduhome directory tmpvirtualenvkudu using inferred kudubuild directory tmpvirtualenvkudubuildlatest userwarning unknown distribution option pythonrequires warningswarnmsg zipsafe flag not set analyzing archive contents installed traceback most recent call last file line in file line in testsuitekudutests file line in setup setupdistribution dist klassattrs file line in init selffetchbuildeggsattrs file line in fetchbuildeggs replaceconflictingtrue file line in resolve dist best envbestmatchreq ws installer file line in bestmatch dist workingsetfindreq file line in find raise versionconflictdist req pkgresourcesversionconflict setuptools noformat | 1 |
create a rule that pulls up constants through a union operator | 0 |
with multithreaded dcs spjs with output params are failingsqlcreate library spjcall file opthometrafodionspjcalljarsqlcreate procedure in int out int external name library spjcall language java parameter style javasqlcall error parameter for set of parameters is not setthe spj jar file calljar can be found on under opthometrafodionspj it has a very simple spj procedure public static void paramint int paramarrayofint paramarrayofint paramint | 1 |
in rare circumstances topologyawareconsistenthashfactory can fail to allocate numowners owners to each segment resulting in an error undefined failed to start rebalance index size javalangindexoutofboundsexception index size at at at at at at at at at at at at at at at at at codethis can happen only after a node leaves when it happens the rebalance is stopped and the some keys will remain with less than numowners owners if another node leaves some keys may be lost if another node joins the next rebalance will succeed and the keys will be redistributed properly | 0 |
if the project name in configxml has a space in it when building with it will succeed but fail to load the wwwindexhtml filethis works correctly in | 1 |
a vendor reported that they were unable to update their addon name raimonds from eazybi hes receiving the error which i verfied on his addon and another the error message is an unexpected error occurred that prevented us from saving the addon data please try again later this is a blocker because weve asked addon developers to update their addon names from jira ondemand to jira cloud and now theyre not able to | 1 |
for example gl context creation can fail on windows when using dated drivers or due to angle problemsthis now results in blank windows or crashesthese errors should be checked and api should be added to the classes up to qqmlapplicationengine allowing to query it and to exit an application cleanly | 0 |
user storyas a user i want my data partitioned so that i have quick and convenient access to only the data i needthis is to determine how well postgresql table partitioning will function and perform if it performs well it will lay the groundwork for increasing our available window of data as well as our data retentionthis work should be based on postgresql needs to be executed in four stages develop a partitioning plan create the procedure or programming that will migrate the existing targeted database tables to partitioned tables and copy the table data integrate partitioned tables into api django orm and migrations determine the performance benefit of these tables in terms of any change to a known baseline assuming that baseline will be taken from the current performance enhancement work and then running the same performance testing against the partitioned tables this should be evaluated using ab testingeach of these stages should be its own story rolling up to this ux requirements ui requirements documentation requirements backend qe requirements additional information and acceptance criteria an agreed upon plan and new issues are written to execute on partitioning tables and any additional api and data engineering changes needed to accommodate partitioned tables if this is a viable option and if it requires any setup to the engine or any setup to the database that could prove beneficial to other projects a plan to work with app sre to get those config changes tested and available to other projects at red hat demonstrated performance improvement | 1 |
problem docker proxy repositories in nexus do not successfully proxy content in a docker hosted repository in nexus when the remote url of the proxy repository includes extra path info example docker proxy remote url noformattitlelogging from nexus which shows a successful proxy of docker content info admin orgsonatypenexusrepositorydockerinternaldockerproxyfacetimpl invalidating proxy caches of dockerproxy debug admin orgsonatypenexushttpclientoutbound get debug admin orgsonatypenexushttpclientoutbound ok ms info admin orgsonatypenexusrepositoryhttpclientinternalhttpclientfacetimpl repository status for dockerproxy changed from ready to available reason na for na info system orgelasticsearchclustermetadata updatemapping debug admin orgsonatypenexushttpclientoutbound get debug admin orgsonatypenexushttpclientoutbound ok ms noformat noformattitlelogging from which shows an unsuccessful proxy of content debug admin orgsonatypenexushttpclientoutbound get debug admin orgsonatypenexushttpclientoutbound ok ms info admin orgsonatypenexusrepositoryhttpclientinternalhttpclientfacetimpl repository status for changed from ready to available reason na for na debug admin orgsonatypenexushttpclientoutbound get debug admin orgsonatypenexushttpclientoutbound not found ms warn admin orgsonatypenexusrepositorydockerinternaldockerproxyfacetimpl could not parse error response unexpected character code expected a valid value number string array object true false or null at error admin orgsonatypenexusrepositorydockerinternaldockerproxyfacetimpl could not fetch the tag latest by its digest unknown at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at orgsonatypenexusrepositoryviewcontextproceedcallunknown source at at at at at method at at at at at at at at at at at source at at at at at at at at orgsonatypenexusrepositoryviewcontextproceedcallunknown source at at method at at at at at at at at at at at source at at at at at at at at orgsonatypenexusrepositoryviewcontextproceedcallunknown source at at method at at at at at at at at at at at source at at orgsonatypenexusrepositoryviewcontextproceedcallunknown source at at method at at at at at at at at at at at source at at orgsonatypenexusrepositoryviewcontextproceedcallunknown source at at at at at method at at at at at at at at at at at at at source at at orgsonatypenexusrepositoryviewcontextproceedcallunknown source at at at at at method at at at at at at at at at at at source at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at at warn admin error get provided digest did not match uploaded content noformat diagnosis the issue seems to be the extra path info of repositorydockerhosted in the docker proxy repository url is stripped off before the outbound request for the layer manifest is retrieved this means it receives html content from a error response instead of the actual docker content workaround if possible change the proxy repository remote url to not use extra path info ie setup the remote repository to listen on a specific connector port so that it can be accessed at a root path context change the proxy repository url to that remote specific port and remove the extra path info when implementing the workaround be cautious of the potential performance penalty of extra http connectors in the remote nexus as described in | 1 |
this bug was imported from another system and requires review from a project committer before some of the details can be marked public for more information about historical bugs please read why are some bugs missing informationyou can request a review of this bug report by sending an email to please be sure to include the bug number in your request | 1 |
it might be convenient to have a method in our client for updating event for certain resource | 0 |
for example caused by orggradleapigradleexception checkstyle rule violations were found see the report at checkstyle files with violations checkstyle violations by severity at at at at at orgcodehaus | 1 |
when using usesolraddschematrue this does not support child nested documents as per the normal update handler i would expect this to either be mentioned in the documentation as a limitation or supported | 0 |
im confused that selectedrow doesnt work for me it returns an object of correct type but having null idso i modified the bookingfaces sample to reflect my problem i extracted superclass from class booking and rebuild the war just as i expected the sample application now no longer work you cant cancel your bookingswill throw exceptiondetails i moved property id and smoking from booking to superbooking and make booking extends superbooking i attach the two files zipped in this postis this a bug in swf or there are some mustavoid stuff | 1 |
we use mvn version in traviscontrollersh which should be runmvn version this doesnt affect the build result just prints wrong maven version information cc | 0 |
due to changeset the viewer build will fail with performing viewermanifest copy traceback most recent call last file lindenindranewviewviewermanifestpy line in from indrabase import llsd file lindenindranewviewlibpythonindrabasellsdpy line in from indrabase import lluuid file lindenindranewviewlibpythonindrabaselluuidpy line in class uuidobject file lindenindranewviewlibpythonindrabaselluuidpy line in uuid ip socketgethostbynamesocketgethostname socketerror resource temporarily unavailable make error make error this is because in lluuidpy there is a try ip socketgethostbynamesocketgethostname exceptsocketgaierror however the error that is not caught is a socketerror the fix is to catch that error | 0 |
in the current generator for the java api we use paramobjects to deal with the problem of many optional dependencies however they are currently placed within the scope of another class for organization this makes them difficult to call and can confuse users so we should move them out to the global scope | 0 |
use the license selector and youll get a | 1 |
as a windows user software developer id like to verify my xerces download archive this is also said on apache website however the explanation on how to do it is incomprehensible for a normal guy like me without enough qualifications in nerdish i have successfully validated downloads from other sources | 1 |
more information on the dmn manual acceptance testsfor all nodes check they can be resized moved connected renamed in context editors check adding rows removing rows moving rows adding column removing columns type into cell whole diagram save reopen | 1 |
bziajiralint oftenn fails because pip are missing from the servers it runs onshuold limit the nodes it runs on or get pip installed more generallyerror from build mailscode pip install upgrade user bugzilla bugzillatools pythonbugzilla jira pytztraceback most recent call last file qaserviceshudsonlocalbinpip line in from pip import mainimporterror no module named pipcode | 0 |
in message center area forum and topic have open and close dates they arent converted to and from the current time zone when you look at the code note that its misleading it reads an iso dates from the browser the looks like its independent of time zone the problem is that it depends upon the time zone setting of the browser which we dont want we want the date the user sees to depend upon their time zone setting in sakai not the browser in fact while the iso date is read its processed with a simpledateformat that ignores the time zone this is misleading but correct | 1 |
we have an empty section in refguide that needs filling in on how to enable offheap writepath how to know youve set it up right or not how to tune it and how it relates to direct memory allocation and offheap readpath | 1 |
does our activity class provide all the needed methods and members according to the shindig activity javadoc the activity fields that are required to have container support are title titleid and appid right now we do not include titleid in our activity representation and we might want more fields from shindigs activity brought over as well then we should make sure all required fields are present when building our activity | 0 |
having a file allpolicy containing the followinggrant permission javasecurityallpermission and starting felix withjava djavasecuritymanager djavasecuritypolicyallpolicy jarbinfelixjarim gettingwelcome to felixjavalangclassnotfoundexception orgapachefelixframeworksecurityactivator at at javasecurityaccesscontrollerdoprivilegednative method at at at at at at at at at error starting orgosgiframeworkbundleexception activator start error in bundle orgapachefelixshell javalangclasscastexception javautiljarjarfile cannot be cast to orgapachefelixframeworkutiljarfilex at at at at at at at at at at at at at at error starting orgosgiframeworkbundleexception activator start error in bundle orgapachefelixshelltui javalangclasscastexception javautiljarjarfile cannot be cast to orgapachefelixframeworkutiljarfilex at at at at at at at at at at at at at at error starting orgosgiframeworkbundleexception activator start error in bundle orgapachefelixbundlerepository javalangclasscastexception javautiljarjarfile cannot be cast to orgapachefelixframeworkutiljarfilex at at at at at at at at at at at at at at error starting orgosgiframeworkbundleexception activator start error in bundle javalangclasscastexception javautiljarjarfile cannot be cast to orgapachefelixframeworkutiljarfilex at at at at at at at at at at at at at at error starting orgosgiframeworkbundleexception activator start error in bundle orgapachefelixscr javalangclasscastexception javautiljarjarfile cannot be cast to orgapachefelixframeworkutiljarfilex at at at at at at at at at at at at at at error starting mvnorgapachefelixorgapachefelixconfigadmin orgosgiframeworkbundleexception activator start error in bundle orgapachefelixconfigadmin javalangclasscastexception javautiljarjarfile cannot be cast to orgapachefelixframeworkutiljarfilex at at at at at at at at at at at at at at | 1 |
application sourcetreeexe framework version description the process was terminated due to an unhandled exception exception info systemxmlxmlexception at systemxmlxmltextreaderimplthrowsystemexception at byref byref byref at systemxmlxmltextreaderimplparsetext at systemxmlxmltextreaderimplparseelementcontent at systemxmlxmltextreaderimplskip at systemconfigurationxmlutilstrictskiptonextelementsystemconfigurationexceptionaction at systemconfigurationbaseconfigurationrecordscansectionsrecursivesystemconfigurationxmlutil systemstring boolean systemstring systemconfigurationoverridemodesetting boolean at systemconfigurationbaseconfigurationrecordscansectionsrecursivesystemconfigurationxmlutil systemstring boolean systemstring systemconfigurationoverridemodesetting boolean at systemconfigurationbaseconfigurationrecordscansectionssystemconfigurationxmlutil at systemconfigurationbaseconfigurationrecordinitconfigfromfile exception info systemconfigurationconfigurationerrorsexception at systemconfigurationconfigurationschemaerrorsthrowiferrorsboolean at systemconfigurationbaseconfigurationrecordthrowifparseerrorssystemconfigurationconfigurationschemaerrors at systemconfigurationclientconfigurationsystemonconfigremovedsystemobject systemconfigurationinternalinternalconfigeventargs exception info systemconfigurationconfigurationerrorsexception at systemconfigurationconfigurationmanagerprepareconfigsystem at systemconfigurationconfigurationmanagergetsectionsystemstring at systemconfigurationconfigurationmanagergetappsettings at systemwindowsbasecompatibilitypreferencescctor exception info systemtypeinitializationexception at sourcetreeappctor at sourcetreeappmain | 1 |
currently streamexpressiontest consists of a single junit test that calls or methods each targeting a particular type of stream or scenarioeach of these scenarios would benefit being split into its own separate junit test this would allow each scenario to passfail independently | 0 |
introduced a new field fileid in webhdfs filestatus json representationthere are a two issues with this this is changing the webhdfs rest api this has not been documented webhdfsfilesystem should not fail when that field is not present this is the case when using httpfs against a fs implementation other than hdfs which does not handle fileid | 1 |
after set the value in the acroform fields i want to flatten the pdf so that there should not be any form fields in my output pdf and when i am writing acroformflatten its not workinghere is my java codecodepackage comsdrcimageimport javaiofileimport javautillistimport orgapachepdfboxpdmodelpddocumentimport orgapachepdfboxpdmodelinteractiveformpdacroformimport orgapachepdfboxpdmodelinteractiveformpdfieldpublic class pdfboxlanguagetest public static void mainstring args throws exception string formtemplate cusersxxxxdownloadscpistestlanguagepdf pddocument pdfdocument pddocumentloadnew fileformtemplate pdacroform acroform pdfdocumentgetdocumentcataloggetacroform acroformsetneedappearancestrue need this line for hindi if acroform null get field names list fieldlist acroformgetfields for pdfield pdfield fieldlist if here i am passing a text in english acroformgetfieldpdfieldgetfullyqualifiednamesetvaluewelcome pdfieldsetreadonlytrue not working pdfieldgetcosobjectsetintff not working else if here i am passing a text in englishhindi acroformgetfieldpdfieldgetfullyqualifiednamesetvaluewelcomeनमस्ते pdfieldsetreadonlytrue not working pdfieldgetcosobjectsetintff not working else here i am passing a text in hindi acroformgetfieldpdfieldgetfullyqualifiednamesetvalueनमस्ते pdfieldsetreadonlytrue not working pdfieldgetcosobjectsetintff not working acroformflatten not working pdfdocumentsavecusersxxxxdownloadscpistestlanguageepdf acroformflatten not working pdfdocumentclose systemoutprintlndone systemoutprintln code | 1 |
code failed to execute goal on project beamrunnersgearpump could not resolve dependencies for project the following artifacts could not be resolved failure to find in was cached in the local repository resolution will not be reattempted until the update interval of nexus has elapsed or updates are forced code | 0 |
blog posts for aerogear datasync aggregator ping | 0 |
ok so we have one send email method which takes orgapachecommonsmailemail param it then checks to see if email sending is enabledconfigured by server instance then sends the mail if it is problem happens for our qa testing we need to test email content but dont want to send emails to actual users in qa environment what we want to do is modify our one send email method and clear out the toccbcc fields and then set the to field to be our testing list but there is no way to remove emails already added setting it to null or empty collection results in an emailexception and we cant create a new email instance and copy because there is no get message accessor available we need a way to remove emailssomehow | 1 |
if a worker is not respond requested task should be info orgapachetajoquerymasterdefaulttaskscheduler assigned localracktotal attempted cancelassigntotal locality rack host error orgapachetajorpcnettyclientbase exception error orgapachetajoquerymasterdefaulttaskscheduler javautilconcurrentexecutionexception comgoogleprotobufserviceexceptionnoformat | 1 |
some of these apis are described in this will be along the lines of google cloud data flow triggereviction policies | 0 |
noformat started ended started orgapachegeodedistributedinternaldlockandtxlockregressiontest testdlockprotectsagainsttransactionconflict ended started ended started ended from the stack dumps it seems to be waiting for the dlock noformat pooled waiting message processor daemon tid nid in objectwait javalangthreadstate waiting on object monitor at javalangobjectwaitnative method at at locked a javalangobject at locked a javautilhashmap at at at at at at at at at noformat is causing the processor to wait noformat pooled waiting message processor daemon tid nid waiting for monitor entry javalangthreadstate blocked on object monitor at waiting to lock a javautilhashmap at at at at at at at at | 0 |
mongo provides write concern with varying level of durability and performance characteristics when using replica sets its possible that replica member lag behind in synching up the changes from primary this introduces replication lag which can increase if the write rate is quite high one of the recommended ways to mitigate such scenarios is to change the write concern to higher values journal ack replica ack to as to slow down writes on primaryin mongodocumentstore it can be supported in following way have a periodic job which obtains current replsetgetstatus determine the potential lag from the command result if the lag is significant then change the write concern used in mongodocumentstore to syned journal ack replica ack etc | 0 |
summary links added using configured shortcut links on your confluence site is broken when you edit the page steps to reproduce configure shortcut links eg key test expanded value default alias s create a new page and a link to atlassian text using publish the page edit the page and publish again expected results the link should still be working after editing the page actual results the link will not work after editing the page | 1 |
in some tests mock public key format gets validated by real field validator although it is not required by that tests logic | 0 |
if no news for since the last cr release for this component please reject and close this issue the final nn page will be aggregated from all previous nn documents if you want to add a comment to the final document then create a separate file in whatsnew and submit a pull request the final nn page will be aggregated from all previous nn documents plus this finaladoc if you want to replace all previous nns by a new document then create a new file in whatsnew add pageincludeprevious false attribute to the document and submit a pull request this query contains the search for the specific components to see all use this query | 1 |
when closing down a native window im getting the following exceptiontypeerror error type coercion failed cannot convert to mxmanagersnativedragmanagerimpl at mxmanagerswindowedsystemmanager at flashdisplaynativemenuitemselect at flashdisplaynativemenuitemperformkeyequivalent at flashdisplaynativemenumenuitemperformkeyequivalent at flashdisplaynativemenuperformkeyequivalent at flashdisplaynativemenuitemmenuperformkeyequivalent at flashdisplaynativemenuitemperformkeyequivalent at flashdisplaynativemenumenuitemperformkeyequivalent at flashdisplaynativemenuperformkeyequivalent at flashdesktopnativeapplicationmenuperformkeyequivalent at flashdesktopnativeapplicationonkeydowncapturelooking at the code the first check should not be trying to cast to an object type its then attempting to compare its type perhaps use as then check for null to know whether or not you have a nativedragmanager or not private cleans up references to window also removes self from toplevelsystemmanagers list mxinternal function cleanupeeventvoid if nativedragmanagerimplsingletongetclassmxmanagersidragmanagergetinstance is nativedragmanagerimpl nativedragmanagerimplsingletongetclassmxmanagersidragmanagergetinstanceunregistersystemmanagerthis systemmanagerglobalstoplevelsystemmanagerssplicesystemmanagerglobalstoplevelsystemmanagersindexofthis mywindowremoveeventlistenerclose cleanup mywindow null | 0 |
its really nothing but i noticed it while perusing the wiki since this section pulls from some javadoc i created the patch for the source file once applied eventually when the wiki updates all will be well | 0 |
code building wildfly camel modules defaultclean wildflycamelmodules enforceversions wildflycamelmodules createmodulesarchive wildflycamelmodules downloading reactor summary wildfly camel success wildfly camel modules failure wildfly camel subsystem skipped wildfly camel webapp skipped wildfly camel patch skipped wildfly camel docker skipped wildfly camel enricher skipped wildfly camel testsuite skipped wildfly camel testsuite standalone skipped wildfly camel testsuite domain skipped wildfly camel example skipped wildfly camel example common skipped wildfly camel example camel cdi skipped wildfly camel example camel jpa skipped wildfly camel example camel cxf soap skipped wildfly camel example camel activemq skipped wildfly camel example camel rest skipped build failure total time s finished at final memory failed to execute goal createmodulesarchive on project wildflycamelmodules cannot resolve dependency failed to collect dependencies at you may use dependencyexcludes to exclude broken dependencies from examination failed to read artifact descriptor for could not transfer artifact fromto jbossearlyaccessrepository error transferring file downloadengbosredhatcom from unknown host downloadengbosredhatcomcodeto reproduce build | 1 |
the ruinrecreate move is great for diversification to escape local optima | 1 |
i suggest the following edits to the to the enhancingwithmaven page at add failonerrortrue to use dirbasedirtargetclasses instead of dirtargetclasses because of problems with relative directories when using multiproject pom with etc structureexplainremind that the mavenantrunplugin is very problematic i ran into weired issues with it because i had other instances of the mavenantrunplugin in another project than the one i was putting this into and adding the mavenantrunplugin with openjpa enhancement to a project caused class no longer found issues in another pom that also used the mavenantrunplugin but worked beforeif using the mavenantrunplugin could also taskdef to use the pcenhancertaskopenjpac ant task i found this to be more suitable as i can easily use to eg exclude some classes that are in a jar until i ran into the problem above and switched to the openjpa maven plugin which works well actuallybut point out that the openjpa maven plugin at comes with its own fixed version of openjpa currently a very outdated and no longer found apparently which makes it a lot less useful unless there is a way to work around this force the version of a dependency of a plugin to another version see but lastly the enhancer could probably also be integrated into maven using or havent tried this but may be worth pointing outpps why dont you integrate the openjpamavenplugin with openjpa directly and test and distribute it | 0 |
this bug was imported from another system and requires review from a project committer before some of the details can be marked public for more information about historical bugs please read why are some bugs missing informationyou can request a review of this bug report by sending an email to please be sure to include the bug number in your request | 1 |
kafkacontinuousstream has a bug where polltimeoutms is always set to default value as the value of kafkasourceproviderconsumerpolltimeout is kafkaconsumerpolltimeoutms which keylowercased map has been provided as sourceoptions this is due to the missing spot which map should be passed as caseinsensitivestringmap as | 0 |
note that we get pentaho dependencies from the spring repo not maven central like most other dependencies if you try to open the link in your browser it will prompt you for a username and password what went wrong could not determine the dependencies of task javahcataloganalyzetestclassesdependencies could not resolve all dependencies for configuration javahcatalogtestcompile could not resolve required by project javahcatalog could not resolve could not get resource could not get received status code from server unauthorized | 1 |
hey all in relation to and i need to report issues about the usage of deferred rendering inside a element these are on git as of today the whole scene is flipped upside down alpha premultiply is not solved in this case see screenshot the example produces the following error message property positiontransformed invalid readonly or does not exist attached a modified version of the deferredrendererqml example i only added a plane to show the alpha issue and changed maincpp to load a | 0 |
we noticed this on chrome on windows it seems on osx it is fine ill paste attachments so you can see what we mean | 0 |
the goraci component built for the hbase and cassandra modules has to be built for the goradynamodb module as well | 0 |
telnetoutputstreamjava appears to have a bug that if we send a iac to the stream returned by telnetclientgetoutputstream we get duplicate iac commands to the telnet serveri looked through the code and i think i have found the reasonline appears to just send two iac case breakline appears to send the original character which is a iac and a iac thus producing two iacs in the else if ch public void writeint ch throws synchronized ch if if if if ch lastwascr return else if ch lastwascr switch case lastwascr case else if ch | 1 |
i am creating a custom cordova plugin and want to make an external api call inside it but the native java method is called from plugin js when the api call is made inside it the code which i have used is given belowcordovaplugintspjscodejavascriptcordovadefinecordovaplugintsptsp functionrequire exports module var exec requirecordovaexecvar tsp function var appid tspprototypestartinit functionappid tspappid appid return success error cordovaexecsuccess error tsp ifwindowplugins windowplugins if windowpluginstsp windowpluginstsp new tspif typeof module undefined moduleexports moduleexports tspcodetspjavacodejavaimport androidappactivityimport androidcontentcontextimport androidosbundleimport androidutillogimport orgapachecordovaapicordovapluginimport orgapachecordovaapicallbackcontextimport orgapachecordovaapicordovainterfaceimport orgapachecordovaapipluginresultimport javaiobufferedreaderimport javaioioexceptionimport javaioinputstreamreaderimport javautilarraylistimport javautillistimport orgapachehttphttpresponseimport orgapachehttpclientclientprotocolexceptionimport orgapachehttpclienthttpclientimport orgapachehttpcliententityurlencodedformentityimport orgapachehttpclientmethodscloseablehttpresponseimport orgapachehttpclientmethodshttpgetimport orgapachehttpclientmethodshttppostimport orgapachehttpimplclienthttpclientbuilderimport orgapachehttpimplclienthttpclientsimport orgjsonjsonarrayimport orgjsonjsonexceptionimport orgjsonjsonobjectimport sampletest this class echoes a string called from javascript public class tsp extends cordovaplugin this is to prevent an issue where if two javascript calls are made to onesignal expecting a callback then only one would fire private static void callbacksuccesscallbackcontext callbackcontext jsonobject jsonobject if jsonobject null in case there are no data jsonobject new jsonobject pluginresult pluginresult new pluginresultpluginresultstatusok jsonobject pluginresultsetkeepcallbacktrue callbackcontextsendpluginresultpluginresult private static void callbackerrorcallbackcontext callbackcontext jsonobject jsonobject if jsonobject null in case there are no data jsonobject new jsonobject pluginresult pluginresult new pluginresultpluginresultstatuserror jsonobject pluginresultsetkeepcallbacktrue callbackcontextsendpluginresultpluginresult private static void callbackerrorcallbackcontext callbackcontext string str pluginresult pluginresult new pluginresultpluginresultstatuserror str pluginresultsetkeepcallbacktrue callbackcontextsendpluginresultpluginresult override public boolean executestring action jsonarray args callbackcontext callbackcontext throws jsonexception if string message callbackcontext return true return false private void message callbackcontext callbackcontext jsonobject jsonids new jsonobject test snew test if message null messagelength try string s s n os version systemgetpropertyosversion androidosbuildversionincremental s n os api level androidosbuildversionsdkint s n device androidosbuilddevice s n model and product androidosbuildmodel androidosbuildproduct jsonidsputmessage message jsonidsputdebuginfoss try httpget httpget new httpget closeablehttpresponse response httpclientscreatedefaultexecutehttpget int responsecode responsegetstatuslinegetstatuscode jsonidsputgetrequesturlhttpgetgeturitostring jsonidsputresponsecode integertostringresponsecode bufferedreader in new bufferedreadernew inputstreamreaderresponsegetentitygetcontent stringbuffer sb new stringbuffer string line while line inreadline null sbappendnline inclose jsonidsputcontentline catch exception e jsonidsputexception etostring callbackerrorcallbackcontextjsonids eprintstacktrace callbacksuccesscallbackcontextjsonids catchthrowable t tprintstacktrace else callbackerrorcallbackcontextexpected one nonempty string argument codepluginxmlcodexmlplugin idcordovaplugintsp xmlns xmlnsandroid cordovaplugintsp codethe plugin method call i made in my app codejavascript sucess jsonstringifydata functionerror error jsonstringifyerror codeplease help me | 1 |
in case the user doesnt have an application on openshift or domain link should point to create openshift application wizard not to the import openshift application wizard also the link could be named more appropriately in this case user will be creating application not importingnewappserverpngthumbnail | 0 |
running the simple action preference test in the testsuite causes it ot fail with a result not found message | 1 |
a liquibase comparison of a virgin db vs a converted db revealed a missing announcements column messageorder as well as missing indexes in the converted database associated with work i added the following scripts to the mysql conversion scripts as part of my testfix work table announcementmessage add column messageorder default nulldrop index ieanncmsgattrib on announcementmessagecreate index ieanncmsgattrib on announcementmessage draft pubview owner messageorderdrop index announcementmessagecdd on announcementmessagecreate index announcementmessagecdd on announcementmessage channelid messagedate messageorder draftwe need the parallel scripts written in the oracle dialect added to the oracle conversion scripts | 1 |
abstractkeyedstatebackendapplytoallkeys uses backends getkeysstatename namespace to get all keys that belong to namespace but in rocksdbkeyedstatebackendgetkeys if just return a object which wrap a rocksdb iterator that is dangous because rocksdb will ping the resources that belong to the iterator into memory untill iteratorclose is invoked but it didnt invoked right now this will lead to memory leak finally | 1 |
to ensure that the different modules of jackson work consistently we can use the jacksonbom to specify different versions used by avro | 0 |
codezypper install y ambariserverloading repository datareading installed packagesresolving package dependenciesthe following new packages are going to be installed ambariserver postgresqlinit postgresqlserver the following packages are not supported by their vendor ambariserver postgresqlinit postgresqlserver new packages to installoverall download size mib after the operation additional mib will be usedcontinue y yretrieving package kib kib unpackedretrieving retrieving package kib kib unpackedretrieving retrieving package mib mib unpackedretrieving retrieving package mib mib unpackedretrieving retrieving package kib kib unpackedretrieving retrieving package mib mib unpackedretrieving installing additional rpm outputwarning varcachezypppackageshosted header dsa signature nokey key id additional rpm outputwarning varcachezypppackageshosted header dsa signature nokey key id etcsysconfigpostgresqlinstalling additional rpm outputwarning varcachezypppackageshosted header dsa signature nokey key id additional rpm outputwarning varcachezypppackageshosted header dsa signature nokey key id additional rpm outputwarning varcachezypppackageshosted header dsa signature nokey key id additional rpm outputinsserv warning script ambariserver missing lsb tagsinsserv warning script ambariserver missing lsb tagsinsserv defaultstart undefined assuming default start runlevels for script ambariserverambariserver dbssh o stricthostkeycheckingno o userknownhostsfiledevnull q i ambariserver setup susing python ambariserverchecking selinuxwarning could not run usrsbinsestatus okcustomize user account for ambariserver daemon n adjusting ambariserver permissions and ownershipchecking firewall not activechecking jdkwarning javahome must be valid on all hostswarning jce policy files are required for configuring kerberos security if you plan to use kerberosplease make sure jce unlimited strength jurisdiction policy files are valid on all hostscompleting setupconfiguring databaseenter advanced database configuration n configuring databasedefault properties detected using builtin databaseconfiguring ambari databasechecking postgresqlrunning initdb this may take upto a minuteabout to start postgresqlerror exiting with exit code reason unable to start postgresql server exitingset skipservicecheckstrue ambari properties file on the server hostssh o stricthostkeycheckingno o userknownhostsfiledevnull q i sed i sskipservicechecksfalseskipservicecheckstrue etcambariserverconfambaripropertiesssh o stricthostkeycheckingno o userknownhostsfiledevnull q i export ambariserver start bash line export not a valid identifierbash line export not a valid identifierbash line export not a valid identifierusing python ambariserverambari server running with administrator privilegesrunning initdb this may take upto a minuteabout to start postgresqlerror exiting with exit code reason unable to start postgresql server status none exitingcodecodevarlibpgsqldata cat postmasterlog utc fatal could not create lock file no such file or utc fatal could not create lock file no such file or utc fatal could not create lock file no such file or utc fatal could not create lock file no such file or directorycode | 1 |
readme has contents like this tls is enabledcolor receive full blockscolor codescolor receive filtered blockscolor receive filtered blockscolor should align with to receive full blocks。 the file link | 0 |
currently i use qt creator installed system wide and i have no write permissions to the default highlighter directory i think that is good idea to hide system directory from configuration dialog and add another directory in the user profile in that case system administrator can setup in system directory common definitions pack for all users and any user can setup his own definitions pack in guarantee writable area his profile | 0 |
override the default hadoop fs impl which moves trash under new trash location will be this change also unifies the trash root with ofs cc | 1 |
add support to to checkstyle plugin analyze and set the bestfit configuration properties for the apache ignite needs noformat validates javadoc comments to help ensure they are well formed the following checks are performed ensures the first sentence ends with proper punctuation that is a period question mark or exclamation mark by default javadoc automatically places the first sentence in the method summary table and index without proper punctuation the javadoc may be malformed all items eligible for the inheritdoc tag are exempt from this requirement check text for javadoc statements that do not have any description this includes both completely empty javadoc and javadoc with only tags such as param and return check text for incomplete html tags verifies that html tags have corresponding end tags and issues an unclosed html tag found error if not an extra html tag found error is issued if an end tag is found without a previous open tag check that a package javadoc comment is wellformed as described above and not missing from any packageinfojava files check for allowed html tags the list of allowed html tags is a abbr acronym address area b bdo big blockquote br caption cite code colgroup dd del div dfn dl dt em fieldset font to hr i img ins kbd li ol p pre q samp small span strong sub sup table tbody td tfoot th thread tr tt u ul noformat | 0 |
model orghibernatesearchtestembeddedproduct needs to have its custname as nullablefalse refuses to create it on its current status because it is being marked as nullable | 0 |
because of license incompatibilities we need to replace tinymce lgpl with something elsei looked at fckeditor but that is also not compatibleyui editor released under bsd is compatible and should do the job of a rich editor examplewe can move the tinymce example to clickclick | 1 |
description of problemdesigner sometimes displays sets of scrollbars that need to be adjusted to make things properly visible this is especially visible with a smaller screen resolutionsthis makes working with it unpleasant and very cumbersome | 0 |
the following construct is somewhat common in doxiacore attaddattribute attributeclass a the documentation says that basic attributes including class are supported however in cases like this either that a or the class that was provided in the attributes parameter will be ignored the correct way to do this is to append the provided class to a if a class attribute was provided | 0 |
remove orchestration for patches that targets specific services | 1 |
i dont see tuscanys and in the binary distro i think these should be included | 1 |
the comments leading up to made me realise that we are not using expressions in the configuration of the subsystem tests i dont think that needs to block the pr but it should be changed for wildfly are already testing this in the integration tests but it is good to test this closer to the source as well | 1 |
issue description i installed sourcetree enterprise and attempted to login to my local bitbucket server installation the login fails with the message failed to check login for user the log has the following entries error insufficient authentication credentials error failed to check login for user the root url username and password are the same ones i use when successfully logging into bitbucket in internet explorer on the same pc my username does not include any special characters such as the symbol i have tried the suggestions in the following what additional authentication credentials should be supplied and how it seems rather over the top to raise a bug when i suspect all im missing is some documentation on how to set sourcetree up correctly but i cant seem to find anything and the community question i raised hasnt received any responses cause as of sourcetree for windows it appears that the login to local bitbucket server instance will fail with failed to check login for user when bitbucket server is on a context path eg work around use sourcetree for windows or temporarily drop the context path by changing the base url of bitbucket to say just eg update reverse proxy from bitbucket to deleted the servercontextpath line out of bitbucketproperties updated the bitbucket administration » base url to just restart bitbucket perform the login into sourcetree and hopefully it succeeds this time once all the users have installed sourcetree you can revert bitbucket back to the context path bitbucket now that you are in sourcetree you should be able to clone a repo from and do all things branch commit push pull etc | 1 |
passing to qmakesubstitutes a file that contains a and is encoded in the output is detected by notepad as and the character becomes � or � if i force notepad to decode it as is it expected that qmake always interprets the input file as so it can only rewrite unknown character since it didnt understand the input or should qmake blindly copy all non ascii chars in strings | 0 |
noticed that in some circumstances the database table that sql object store attempts to create had duplicate column names tracked this behaviour down to the logic within orgapacheisisruntimesdfltobjectstoressqlautoabstractautomapper the setupfieldmappers method can be called into recursively meaning that the simple aggregation of columns into a list as then used by the setupfullmapping method is not sufficientalthough i dont understand everything that is going on here it seems that a safer way to proceed is to use a map and to key the elements by the objectassociation ie property that way there can only ever be one thing added per processed field | 0 |
velocityengineinit opens velocitylog multiple times every call to velocityengineinit opens velocitylog several times frequent calls to init eg in dogetdopost will use up all file descriptors of the operation system this is a critical problem because windows deletes all files that a process wants to open after windows has no more file descriptors left on windows nt you get too many open files and nothing is deleted steps to reproduce java test see attachment while test is still running do a gnulinux lsof grep velocitylogwc l b windows handle find velocitylog you can get handleexe from expected result velocitylog should be opened one or a few times actual result velocitylog is opened times times per call to init | 1 |
this does not appear to work out of the boxerror from server forbidden clusteroperatorsconfigopenshiftio is forbidden user developer cannot list resource clusteroperators in api group configopenshiftio at the cluster scopereported by rgoodfel | 1 |
Subsets and Splits