Datasets:

librarian-bots

/

model_cards_with_metadata_test

like 1

Orenguteng/Llama-3-8B-Lexi-Uncensored-GGUF

Orenguteng

--- license: other license_name: license license_link: https://huggingface.co/Orenguteng/Lexi-Llama-3-8B-Uncensored --- [GGUF of https://huggingface.co/Orenguteng/Lexi-Llama-3-8B-Uncensored](https://huggingface.co/Orenguteng/Lexi-Llama-3-8B-Uncensored)  This model is based on Llama-3-8b-Instruct, and is governed by [META LLAMA 3 COMMUNITY LICENSE AGREEMENT](https://llama.meta.com/llama3/license/) Lexi is uncensored, which makes the model compliant. You are advised to implement your own alignment layer before exposing the model as a service. It will be highly compliant with any requests, even unethical ones. You are responsible for any content you create using this model. Please use it responsibly. Lexi is licensed according to Meta's Llama license. I grant permission for any use, including commercial, that falls within accordance with Meta's Llama-3 license.

google-bert/bert-large-cased

google-bert

transformers

fill-mask

--- language: en license: apache-2.0 datasets: - bookcorpus - wikipedia --- # BERT large model (cased) Pretrained model on English language using a masked language modeling (MLM) objective. It was introduced in [this paper](https://arxiv.org/abs/1810.04805) and first released in [this repository](https://github.com/google-research/bert). This model is cased: it makes a difference between english and English. Disclaimer: The team releasing BERT did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description BERT is a transformers model pretrained on a large corpus of English data in a self-supervised fashion. This means it was pretrained on the raw texts only, with no humans labelling them in any way (which is why it can use lots of publicly available data) with an automatic process to generate inputs and labels from those texts. More precisely, it was pretrained with two objectives: - Masked language modeling (MLM): taking a sentence, the model randomly masks 15% of the words in the input then run the entire masked sentence through the model and has to predict the masked words. This is different from traditional recurrent neural networks (RNNs) that usually see the words one after the other, or from autoregressive models like GPT which internally mask the future tokens. It allows the model to learn a bidirectional representation of the sentence. - Next sentence prediction (NSP): the models concatenates two masked sentences as inputs during pretraining. Sometimes they correspond to sentences that were next to each other in the original text, sometimes not. The model then has to predict if the two sentences were following each other or not. This way, the model learns an inner representation of the English language that can then be used to extract features useful for downstream tasks: if you have a dataset of labeled sentences for instance, you can train a standard classifier using the features produced by the BERT model as inputs. This model has the following configuration: - 24-layer - 1024 hidden dimension - 16 attention heads - 336M parameters. ## Intended uses & limitations You can use the raw model for either masked language modeling or next sentence prediction, but it's mostly intended to be fine-tuned on a downstream task. See the [model hub](https://huggingface.co/models?filter=bert) to look for fine-tuned versions on a task that interests you. Note that this model is primarily aimed at being fine-tuned on tasks that use the whole sentence (potentially masked) to make decisions, such as sequence classification, token classification or question answering. For tasks such as text generation you should look at model like GPT2. ### How to use You can use this model directly with a pipeline for masked language modeling: ```python >>> from transformers import pipeline >>> unmasker = pipeline('fill-mask', model='bert-large-cased') >>> unmasker("Hello I'm a [MASK] model.") [ { "sequence":"[CLS] Hello I'm a male model. [SEP]", "score":0.22748498618602753, "token":2581, "token_str":"male" }, { "sequence":"[CLS] Hello I'm a fashion model. [SEP]", "score":0.09146175533533096, "token":4633, "token_str":"fashion" }, { "sequence":"[CLS] Hello I'm a new model. [SEP]", "score":0.05823173746466637, "token":1207, "token_str":"new" }, { "sequence":"[CLS] Hello I'm a super model. [SEP]", "score":0.04488750174641609, "token":7688, "token_str":"super" }, { "sequence":"[CLS] Hello I'm a famous model. [SEP]", "score":0.03271442651748657, "token":2505, "token_str":"famous" } ] ``` Here is how to use this model to get the features of a given text in PyTorch: ```python from transformers import BertTokenizer, BertModel tokenizer = BertTokenizer.from_pretrained('bert-large-cased') model = BertModel.from_pretrained("bert-large-cased") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='pt') output = model(**encoded_input) ``` and in TensorFlow: ```python from transformers import BertTokenizer, TFBertModel tokenizer = BertTokenizer.from_pretrained('bert-large-cased') model = TFBertModel.from_pretrained("bert-large-cased") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='tf') output = model(encoded_input) ``` ### Limitations and bias Even if the training data used for this model could be characterized as fairly neutral, this model can have biased predictions: ```python >>> from transformers import pipeline >>> unmasker = pipeline('fill-mask', model='bert-large-cased') >>> unmasker("The man worked as a [MASK].") [ { "sequence":"[CLS] The man worked as a doctor. [SEP]", "score":0.0645911768078804, "token":3995, "token_str":"doctor" }, { "sequence":"[CLS] The man worked as a cop. [SEP]", "score":0.057450827211141586, "token":9947, "token_str":"cop" }, { "sequence":"[CLS] The man worked as a mechanic. [SEP]", "score":0.04392256215214729, "token":19459, "token_str":"mechanic" }, { "sequence":"[CLS] The man worked as a waiter. [SEP]", "score":0.03755280375480652, "token":17989, "token_str":"waiter" }, { "sequence":"[CLS] The man worked as a teacher. [SEP]", "score":0.03458863124251366, "token":3218, "token_str":"teacher" } ] >>> unmasker("The woman worked as a [MASK].") [ { "sequence":"[CLS] The woman worked as a nurse. [SEP]", "score":0.2572779953479767, "token":7439, "token_str":"nurse" }, { "sequence":"[CLS] The woman worked as a waitress. [SEP]", "score":0.16706500947475433, "token":15098, "token_str":"waitress" }, { "sequence":"[CLS] The woman worked as a teacher. [SEP]", "score":0.04587847739458084, "token":3218, "token_str":"teacher" }, { "sequence":"[CLS] The woman worked as a secretary. [SEP]", "score":0.03577028587460518, "token":4848, "token_str":"secretary" }, { "sequence":"[CLS] The woman worked as a maid. [SEP]", "score":0.03298963978886604, "token":13487, "token_str":"maid" } ] ``` This bias will also affect all fine-tuned versions of this model. ## Training data The BERT model was pretrained on [BookCorpus](https://yknzhu.wixsite.com/mbweb), a dataset consisting of 11,038 unpublished books and [English Wikipedia](https://en.wikipedia.org/wiki/English_Wikipedia) (excluding lists, tables and headers). ## Training procedure ### Preprocessing The texts are lowercased and tokenized using WordPiece and a vocabulary size of 30,000. The inputs of the model are then of the form: ``` [CLS] Sentence A [SEP] Sentence B [SEP] ``` With probability 0.5, sentence A and sentence B correspond to two consecutive sentences in the original corpus and in the other cases, it's another random sentence in the corpus. Note that what is considered a sentence here is a consecutive span of text usually longer than a single sentence. The only constrain is that the result with the two "sentences" has a combined length of less than 512 tokens. The details of the masking procedure for each sentence are the following: - 15% of the tokens are masked. - In 80% of the cases, the masked tokens are replaced by `[MASK]`. - In 10% of the cases, the masked tokens are replaced by a random token (different) from the one they replace. - In the 10% remaining cases, the masked tokens are left as is. ### Pretraining The model was trained on 4 cloud TPUs in Pod configuration (16 TPU chips total) for one million steps with a batch size of 256. The sequence length was limited to 128 tokens for 90% of the steps and 512 for the remaining 10%. The optimizer used is Adam with a learning rate of 1e-4, \\(\beta_{1} = 0.9\\) and \\(\beta_{2} = 0.999\\), a weight decay of 0.01, learning rate warmup for 10,000 steps and linear decay of the learning rate after. ## Evaluation results When fine-tuned on downstream tasks, this model achieves the following results: Model | SQUAD 1.1 F1/EM | Multi NLI Accuracy ---------------------------------------- | :-------------: | :----------------: BERT-Large, Cased (Original) | 91.5/84.8 | 86.09 ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-1810-04805, author = {Jacob Devlin and Ming{-}Wei Chang and Kenton Lee and Kristina Toutanova}, title = {{BERT:} Pre-training of Deep Bidirectional Transformers for Language Understanding}, journal = {CoRR}, volume = {abs/1810.04805}, year = {2018}, url = {http://arxiv.org/abs/1810.04805}, archivePrefix = {arXiv}, eprint = {1810.04805}, timestamp = {Tue, 30 Oct 2018 20:39:56 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1810-04805.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

openbmb/MiniCPM-Llama3-V-2_5-gguf

openbmb

--- tags: - llama.cpp --- # MiniCPM-Llama3-V 2.5 gguf files for llama.cpp ## Usage Please see our fork of [llama.cpp](https://github.com/OpenBMB/llama.cpp/tree/minicpm-v2.5/examples/minicpmv) for more detail to run MiniCPM-Llama3-V 2.5 with llama.cpp ## ollama [ollama](https://github.com/OpenBMB/ollama/tree/minicpm-v2.5/examples/minicpm-v2.5)

mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF

mradermacher

transformers

--- base_model: BeaverAI/Fook-Yi-34B-32K-25p-Chat language: - en library_name: transformers quantized_by: mradermacher tags: - mergekit - merge --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: --> static quants of https://huggingface.co/BeaverAI/Fook-Yi-34B-32K-25p-Chat <!-- provided-files --> weighted/imatrix quants are available at https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-i1-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.Q2_K.gguf) | Q2_K | 12.9 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.IQ3_XS.gguf) | IQ3_XS | 14.3 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.Q3_K_S.gguf) | Q3_K_S | 15.1 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.IQ3_S.gguf) | IQ3_S | 15.1 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.IQ3_M.gguf) | IQ3_M | 15.7 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.Q3_K_M.gguf) | Q3_K_M | 16.8 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.Q3_K_L.gguf) | Q3_K_L | 18.2 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.IQ4_XS.gguf) | IQ4_XS | 18.7 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.Q4_K_S.gguf) | Q4_K_S | 19.7 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.Q4_K_M.gguf) | Q4_K_M | 20.8 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.Q5_K_S.gguf) | Q5_K_S | 23.8 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.Q5_K_M.gguf) | Q5_K_M | 24.4 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.Q6_K.gguf) | Q6_K | 28.3 | very good quality | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-32K-25p-Chat-GGUF/resolve/main/Fook-Yi-34B-32K-25p-Chat.Q8_0.gguf) | Q8_0 | 36.6 | fast, best quality | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. <!-- end -->

gvs/wav2vec2-large-xlsr-malayalam

gvs

transformers

automatic-speech-recognition

--- language: ml datasets: - Indic TTS Malayalam Speech Corpus - Openslr Malayalam Speech Corpus - SMC Malayalam Speech Corpus - IIIT-H Indic Speech Databases metrics: - wer tags: - audio - automatic-speech-recognition - speech - xlsr-fine-tuning-week license: apache-2.0 model-index: - name: Malayalam XLSR Wav2Vec2 Large 53 results: - task: name: Speech Recognition type: automatic-speech-recognition dataset: name: Test split of combined dataset using all datasets mentioned above type: custom args: ml metrics: - name: Test WER type: wer value: 28.43 --- # Wav2Vec2-Large-XLSR-53-ml Fine-tuned [facebook/wav2vec2-large-xlsr-53](https://huggingface.co/facebook/wav2vec2-large-xlsr-53) on ml (Malayalam) using the [Indic TTS Malayalam Speech Corpus (via Kaggle)](https://www.kaggle.com/kavyamanohar/indic-tts-malayalam-speech-corpus), [Openslr Malayalam Speech Corpus](http://openslr.org/63/), [SMC Malayalam Speech Corpus](https://blog.smc.org.in/malayalam-speech-corpus/) and [IIIT-H Indic Speech Databases](http://speech.iiit.ac.in/index.php/research-svl/69.html). The notebooks used to train model are available [here](https://github.com/gauthamsuresh09/wav2vec2-large-xlsr-53-malayalam/). When using this model, make sure that your speech input is sampled at 16kHz. ## Usage The model can be used directly (without a language model) as follows: ```python import torch import torchaudio from datasets import load_dataset from transformers import Wav2Vec2ForCTC, Wav2Vec2Processor test_dataset = <load-test-split-of-combined-dataset> # Details on loading this dataset in the evaluation section processor = Wav2Vec2Processor.from_pretrained("gvs/wav2vec2-large-xlsr-malayalam") model = Wav2Vec2ForCTC.from_pretrained("gvs/wav2vec2-large-xlsr-malayalam") resampler = torchaudio.transforms.Resample(48_000, 16_000) # Preprocessing the datasets. # We need to read the audio files as arrays def speech_file_to_array_fn(batch): speech_array, sampling_rate = torchaudio.load(batch["path"]) batch["speech"] = resampler(speech_array).squeeze().numpy() return batch test_dataset = test_dataset.map(speech_file_to_array_fn) inputs = processor(test_dataset["speech"][:2], sampling_rate=16_000, return_tensors="pt", padding=True) with torch.no_grad(): logits = model(inputs.input_values, attention_mask=inputs.attention_mask).logits predicted_ids = torch.argmax(logits, dim=-1) print("Prediction:", processor.batch_decode(predicted_ids)) print("Reference:", test_dataset["sentence"]) ``` ## Evaluation The model can be evaluated as follows on the test data of combined custom dataset. For more details on dataset preparation, check the notebooks mentioned at the end of this file. ```python import torch import torchaudio from datasets import load_dataset, load_metric from transformers import Wav2Vec2ForCTC, Wav2Vec2Processor import re from datasets import load_dataset, load_metric from pathlib import Path # The custom dataset needs to be created using notebook mentioned at the end of this file data_dir = Path('<path-to-custom-dataset>') dataset_folders = { 'iiit': 'iiit_mal_abi', 'openslr': 'openslr', 'indic-tts': 'indic-tts-ml', 'msc-reviewed': 'msc-reviewed-speech-v1.0+20200825', } # Set directories for datasets openslr_male_dir = data_dir / dataset_folders['openslr'] / 'male' openslr_female_dir = data_dir / dataset_folders['openslr'] / 'female' iiit_dir = data_dir / dataset_folders['iiit'] indic_tts_male_dir = data_dir / dataset_folders['indic-tts'] / 'male' indic_tts_female_dir = data_dir / dataset_folders['indic-tts'] / 'female' msc_reviewed_dir = data_dir / dataset_folders['msc-reviewed'] # Load the datasets openslr_male = load_dataset("json", data_files=[f"{str(openslr_male_dir.absolute())}/sample_{i}.json" for i in range(2023)], split="train") openslr_female = load_dataset("json", data_files=[f"{str(openslr_female_dir.absolute())}/sample_{i}.json" for i in range(2103)], split="train") iiit = load_dataset("json", data_files=[f"{str(iiit_dir.absolute())}/sample_{i}.json" for i in range(1000)], split="train") indic_tts_male = load_dataset("json", data_files=[f"{str(indic_tts_male_dir.absolute())}/sample_{i}.json" for i in range(5649)], split="train") indic_tts_female = load_dataset("json", data_files=[f"{str(indic_tts_female_dir.absolute())}/sample_{i}.json" for i in range(2950)], split="train") msc_reviewed = load_dataset("json", data_files=[f"{str(msc_reviewed_dir.absolute())}/sample_{i}.json" for i in range(1541)], split="train") # Create test split as 20%, set random seed as well. test_size = 0.2 random_seed=1 openslr_male_splits = openslr_male.train_test_split(test_size=test_size, seed=random_seed) openslr_female_splits = openslr_female.train_test_split(test_size=test_size, seed=random_seed) iiit_splits = iiit.train_test_split(test_size=test_size, seed=random_seed) indic_tts_male_splits = indic_tts_male.train_test_split(test_size=test_size, seed=random_seed) indic_tts_female_splits = indic_tts_female.train_test_split(test_size=test_size, seed=random_seed) msc_reviewed_splits = msc_reviewed.train_test_split(test_size=test_size, seed=random_seed) # Get combined test dataset split_list = [openslr_male_splits, openslr_female_splits, indic_tts_male_splits, indic_tts_female_splits, msc_reviewed_splits, iiit_splits] test_dataset = datasets.concatenate_datasets([split['test'] for split in split_list) wer = load_metric("wer") processor = Wav2Vec2Processor.from_pretrained("gvs/wav2vec2-large-xlsr-malayalam") model = Wav2Vec2ForCTC.from_pretrained("gvs/wav2vec2-large-xlsr-malayalam") model.to("cuda") resamplers = { 48000: torchaudio.transforms.Resample(48_000, 16_000), } chars_to_ignore_regex = '[\\\\,\\\\?\\\\.\\\\!\\\\-\\\\;\\\\:\\\\"\\\\“\\\\%\\\\‘\\\\”\\\\�Utrnle\\\\_]' unicode_ignore_regex = r'[\\\\u200e]' # Preprocessing the datasets. # We need to read the audio files as arrays def speech_file_to_array_fn(batch): batch["sentence"] = re.sub(chars_to_ignore_regex, '', batch["sentence"]) batch["sentence"] = re.sub(unicode_ignore_regex, '', batch["sentence"]) speech_array, sampling_rate = torchaudio.load(batch["path"]) # Resample if its not in 16kHz if sampling_rate != 16000: batch["speech"] = resamplers[sampling_rate](speech_array).squeeze().numpy() else: batch["speech"] = speech_array.squeeze().numpy() # If more than one dimension is present, pick first one if batch["speech"].ndim > 1: batch["speech"] = batch["speech"][0] return batch test_dataset = test_dataset.map(speech_file_to_array_fn) # Preprocessing the datasets. # We need to read the audio files as arrays def evaluate(batch): inputs = processor(batch["speech"], sampling_rate=16_000, return_tensors="pt", padding=True) with torch.no_grad(): logits = model(inputs.input_values.to("cuda"), attention_mask=inputs.attention_mask.to("cuda")).logits pred_ids = torch.argmax(logits, dim=-1) batch["pred_strings"] = processor.batch_decode(pred_ids) return batch result = test_dataset.map(evaluate, batched=True, batch_size=8) print("WER: {:2f}".format(100 * wer.compute(predictions=result["pred_strings"], references=result["sentence"]))) ``` **Test Result (WER)**: 28.43 % ## Training A combined dataset was created using [Indic TTS Malayalam Speech Corpus (via Kaggle)](https://www.kaggle.com/kavyamanohar/indic-tts-malayalam-speech-corpus), [Openslr Malayalam Speech Corpus](http://openslr.org/63/), [SMC Malayalam Speech Corpus](https://blog.smc.org.in/malayalam-speech-corpus/) and [IIIT-H Indic Speech Databases](http://speech.iiit.ac.in/index.php/research-svl/69.html). The datasets were downloaded and was converted to HF Dataset format using [this notebook](https://github.com/gauthamsuresh09/wav2vec2-large-xlsr-53-malayalam/blob/main/make_hf_dataset.ipynb) The notebook used for training and evaluation can be found [here](https://github.com/gauthamsuresh09/wav2vec2-large-xlsr-53-malayalam/blob/main/fine-tune-xlsr-wav2vec2-on-malayalam-asr-with-transformers_v2.ipynb)

Corcelio/mobius

Corcelio

diffusers

text-to-image

--- pipeline_tag: text-to-image widget: - text: >- movie scene screencap, cinematic footage. thanos smelling a little yellow rose. extreme wide angle, output: url: images/1man.png - text: god output: url: images/god.png - text: 'A tiny robot taking a break under a tree in the garden ' output: url: images/robot.png - text: mystery output: url: images/mystery.png - text: a cat wearing sunglasses in the summer output: url: images/cat.png - text: 'robot holding a sign that says ’a storm is coming’ ' output: url: images/storm.png - text: >- The Exegenesis of the soul, captured within a boundless well of starlight, pulsating and vibrating wisps, chiaroscuro, humming transformer output: url: images/soul.png - text: >- anime boy, protagonist, best quality output: url: images/animeboy.png - text: natural photography of a man, glasses, cinematic, output: url: images/glasses.png - text: if I could turn back time output: url: images/time.png - text: >- ("Mobius" text logo) powerful aura, swirling power, cinematic output: url: images/mobius.png - text: the backrooms output: url: images/backrooms.png license: apache-2.0 --- <Gallery /> # Mobius: Redefining State-of-the-Art in Debiased Diffusion Models Mobius, a diffusion model that pushes the boundaries of domain-agnostic debiasing and representation realignment. By employing a brand new constructive deconstruction framework, Mobius achieves unrivaled generalization across a vast array of styles and domains, eliminating the need for expensive pretraining from scratch. # Domain-Agnostic Debiasing: A Groundbreaking Approach Domain-agnostic debiasing is a novel technique pioneered Corcel. This innovative approach aims to remove biases inherent in diffusion models without limiting their ability to generalize across diverse domains. Traditional debiasing methods often focus on specific domains or styles, resulting in models that struggle to adapt to new or unseen contexts. In contrast, domain-agnostic debiasing ensures that the model remains unbiased while maintaining its versatility and adaptability. The key to domain-agnostic debiasing lies in the constructive deconstruction framework. This framework allows for fine-grained reworking of biases and representations without the need for pretraining from scratch. The technical details of this groundbreaking approach will be discussed in an upcoming research paper, "Constructive Deconstruction: Domain-Agnostic Debiasing of Diffusion Models," which will be made available on the Corcel.io website and through scientific publications. By applying domain-agnostic debiasing, Mobius sets a new standard for fairness and impartiality in image generation while maintaining its exceptional ability to adapt to a wide range of styles and domains. # Surpassing the State-of-the-Art Mobius outperforms existing state-of-the-art diffusion models in several key areas: Unbiased generation: Mobius generates images that are virtually free from the inherent biases commonly found in other diffusion models, setting a new benchmark for fairness and impartiality across all domains. Exceptional generalization: With its unparalleled ability to adapt to an extensive range of styles and domains, Mobius consistently delivers top-quality results, surpassing the limitations of previous models. Efficient fine-tuning: The Mobius base model serves as a superior foundation for creating specialized models tailored to specific tasks or domains, requiring significantly less fine-tuning and computational resources compared to other state-of-the-art models. # Recommendations - CFG between 3.5 and 7 - 3.5 for extreme realism and skin detailing - 7 for artstic, anime, surrealism, and so on. - Requires a CLIP skip of -3 - Sampler: DPM++ 3M SDE - Scheduler: Karras - Steps: 50 - Resolution: 1024x1024 Please also consider using these keep words to improve your prompts: best quality, HD, '~*~aesthetic~*~'. # Use it with 🧨 diffusers ```python import torch from diffusers import ( StableDiffusionXLPipeline, KDPM2AncestralDiscreteScheduler, AutoencoderKL ) # Load VAE component vae = AutoencoderKL.from_pretrained( "madebyollin/sdxl-vae-fp16-fix", torch_dtype=torch.float16 ) # Configure the pipeline pipe = StableDiffusionXLPipeline.from_pretrained( "Corcelio/mobius", vae=vae, torch_dtype=torch.float16 ) pipe.scheduler = KDPM2AncestralDiscreteScheduler.from_config(pipe.scheduler.config) pipe.to('cuda') # Define prompts and generate image prompt = "mystery" negative_prompt = "" image = pipe( prompt, negative_prompt=negative_prompt, width=1024, height=1024, guidance_scale=7, num_inference_steps=50, clip_skip=3 ).images[0] image.save("generated_image.png") ``` # Credits Made by Corcel [ https://corcel.io/ ]

mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF

mradermacher

transformers

--- base_model: OpenPipe/Hermes-2-Theta-Llama-3-70B-32k language: - en library_name: transformers license: llama3 quantized_by: mradermacher tags: - distillation - synthetic data - function calling - structured outputs - json mode --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: --> static quants of https://huggingface.co/OpenPipe/Hermes-2-Theta-Llama-3-70B-32k <!-- provided-files --> weighted/imatrix quants are available at https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-i1-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q2_K.gguf) | Q2_K | 26.5 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.IQ3_XS.gguf) | IQ3_XS | 29.4 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.IQ3_S.gguf) | IQ3_S | 31.0 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q3_K_S.gguf) | Q3_K_S | 31.0 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.IQ3_M.gguf) | IQ3_M | 32.0 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q3_K_M.gguf) | Q3_K_M | 34.4 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q3_K_L.gguf) | Q3_K_L | 37.2 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.IQ4_XS.gguf) | IQ4_XS | 38.4 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q4_K_S.gguf) | Q4_K_S | 40.4 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q4_K_M.gguf) | Q4_K_M | 42.6 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q5_K_S.gguf) | Q5_K_S | 48.8 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q5_K_M.gguf) | Q5_K_M | 50.0 | | | [PART 1](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q6_K.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q6_K.gguf.part2of2) | Q6_K | 58.0 | very good quality | | [PART 1](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q8_0.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-32k-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B-32k.Q8_0.gguf.part2of2) | Q8_0 | 75.1 | fast, best quality | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. <!-- end -->

Qiliang/bart-large-cnn-samsum-ChatGPT_v3

Qiliang

transformers

text2text-generation

--- license: mit tags: - generated_from_trainer model-index: - name: bart-large-cnn-samsum-ChatGPT_v3 results: [] --- <!-- This model card has been generated automatically according to the information the Trainer had access to. You should probably proofread and complete it, then remove this comment. --> # bart-large-cnn-samsum-ChatGPT_v3 This model is a fine-tuned version of [philschmid/bart-large-cnn-samsum](https://huggingface.co/philschmid/bart-large-cnn-samsum) on an unknown dataset. ## Model description More information needed ## Intended uses & limitations More information needed ## Training and evaluation data More information needed ## Training procedure ### Training hyperparameters The following hyperparameters were used during training: - learning_rate: 2e-05 - train_batch_size: 4 - eval_batch_size: 4 - seed: 42 - optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 - lr_scheduler_type: linear - num_epochs: 3 - mixed_precision_training: Native AMP ### Framework versions - Transformers 4.24.0 - Pytorch 1.12.1 - Datasets 2.6.1 - Tokenizers 0.13.2

baffo32/decapoda-research-llama-7B-hf

baffo32

transformers

text-generation

--- license: other --- LLaMA-7B converted to work with Transformers/HuggingFace. This is under a special license, please see the LICENSE file for details. -- license: other --- # LLaMA Model Card ## Model details **Organization developing the model** The FAIR team of Meta AI. **Model date** LLaMA was trained between December. 2022 and Feb. 2023. **Model version** This is version 1 of the model. **Model type** LLaMA is an auto-regressive language model, based on the transformer architecture. The model comes in different sizes: 7B, 13B, 33B and 65B parameters. **Paper or resources for more information** More information can be found in the paper “LLaMA, Open and Efficient Foundation Language Models”, available at https://research.facebook.com/publications/llama-open-and-efficient-foundation-language-models/. **Citations details** https://research.facebook.com/publications/llama-open-and-efficient-foundation-language-models/ **License** Non-commercial bespoke license **Where to send questions or comments about the model** Questions and comments about LLaMA can be sent via the [GitHub repository](https://github.com/facebookresearch/llama) of the project , by opening an issue. ## Intended use **Primary intended uses** The primary use of LLaMA is research on large language models, including: exploring potential applications such as question answering, natural language understanding or reading comprehension, understanding capabilities and limitations of current language models, and developing techniques to improve those, evaluating and mitigating biases, risks, toxic and harmful content generations, hallucinations. **Primary intended users** The primary intended users of the model are researchers in natural language processing, machine learning and artificial intelligence. **Out-of-scope use cases** LLaMA is a base, or foundational, model. As such, it should not be used on downstream applications without further risk evaluation and mitigation. In particular, our model has not been trained with human feedback, and can thus generate toxic or offensive content, incorrect information or generally unhelpful answers. ## Factors **Relevant factors** One of the most relevant factors for which model performance may vary is which language is used. Although we included 20 languages in the training data, most of our dataset is made of English text, and we thus expect the model to perform better for English than other languages. Relatedly, it has been shown in previous studies that performance might vary for different dialects, and we expect that it will be the case for our model. **Evaluation factors** As our model is trained on data from the Web, we expect that it reflects biases from this source. We thus evaluated on RAI datasets to measure biases exhibited by the model for gender, religion, race, sexual orientation, age, nationality, disability, physical appearance and socio-economic status. We also measure the toxicity of model generations, depending on the toxicity of the context used to prompt the model. ## Metrics **Model performance measures** We use the following measure to evaluate the model: - Accuracy for common sense reasoning, reading comprehension, natural language understanding (MMLU), BIG-bench hard, WinoGender and CrowS-Pairs, - Exact match for question answering, - The toxicity score from Perspective API on RealToxicityPrompts. **Decision thresholds** Not applicable. **Approaches to uncertainty and variability** Due to the high computational requirements of training LLMs, we trained only one model of each size, and thus could not evaluate variability of pre-training. ## Evaluation datasets The model was evaluated on the following benchmarks: BoolQ, PIQA, SIQA, HellaSwag, WinoGrande, ARC, OpenBookQA, NaturalQuestions, TriviaQA, RACE, MMLU, BIG-bench hard, GSM8k, RealToxicityPrompts, WinoGender, CrowS-Pairs. ## Training dataset The model was trained using the following source of data: CCNet [67%], C4 [15%], GitHub [4.5%], Wikipedia [4.5%], Books [4.5%], ArXiv [2.5%], Stack Exchange[2%]. The Wikipedia and Books domains include data in the following languages: bg, ca, cs, da, de, en, es, fr, hr, hu, it, nl, pl, pt, ro, ru, sl, sr, sv, uk. See the paper for more details about the training set and corresponding preprocessing. ## Quantitative analysis Hyperparameters for the model architecture <table> <thead> <tr> <th >LLaMA</th> <th colspan=6>Model hyper parameters </th> </tr> <tr> <th>Number of parameters</th><th>dimension</th><th>n heads</th><th>n layers</th><th>Learn rate</th><th>Batch size</th><th>n tokens</th> </tr> </thead> <tbody> <tr> <th>7B</th> <th>4096</th> <th>32</th> <th>32</th> <th>3.0E-04</th><th>4M</th><th>1T </tr> <tr> <th>13B</th><th>5120</th><th>40</th><th>40</th><th>3.0E-04</th><th>4M</th><th>1T </tr> <tr> <th>33B</th><th>6656</th><th>52</th><th>60</th><th>1.5.E-04</th><th>4M</th><th>1.4T </tr> <tr> <th>65B</th><th>8192</th><th>64</th><th>80</th><th>1.5.E-04</th><th>4M</th><th>1.4T </tr> </tbody> </table> *Table 1 - Summary of LLama Model Hyperparameters* We present our results on eight standard common sense reasoning benchmarks in the table below. <table> <thead> <tr> <th>LLaMA</th> <th colspan=9>Reasoning tasks </th> </tr> <tr> <th>Number of parameters</th> <th>BoolQ</th><th>PIQA</th><th>SIQA</th><th>HellaSwag</th><th>WinoGrande</th><th>ARC-e</th><th>ARC-c</th><th>OBQA</th><th>COPA</th> </tr> </thead> <tbody> <tr> <th>7B</th><th>76.5</th><th>79.8</th><th>48.9</th><th>76.1</th><th>70.1</th><th>76.7</th><th>47.6</th><th>57.2</th><th>93 </th> <tr><th>13B</th><th>78.1</th><th>80.1</th><th>50.4</th><th>79.2</th><th>73</th><th>78.1</th><th>52.7</th><th>56.4</th><th>94 </th> <tr><th>33B</th><th>83.1</th><th>82.3</th><th>50.4</th><th>82.8</th><th>76</th><th>81.4</th><th>57.8</th><th>58.6</th><th>92 </th> <tr><th>65B</th><th>85.3</th><th>82.8</th><th>52.3</th><th>84.2</th><th>77</th><th>81.5</th><th>56</th><th>60.2</th><th>94</th></tr> </tbody> </table> *Table 2 - Summary of LLama Model Performance on Reasoning tasks* We present our results on bias in the table below. Note that lower value is better indicating lower bias. | No | Category | FAIR LLM | | --- | -------------------- | -------- | | 1 | Gender | 70.6 | | 2 | Religion | 79 | | 3 | Race/Color | 57 | | 4 | Sexual orientation | 81 | | 5 | Age | 70.1 | | 6 | Nationality | 64.2 | | 7 | Disability | 66.7 | | 8 | Physical appearance | 77.8 | | 9 | Socioeconomic status | 71.5 | | | LLaMA Average | 66.6 | *Table 3 - Summary bias of our model output* ## Ethical considerations **Data** The data used to train the model is collected from various sources, mostly from the Web. As such, it contains offensive, harmful and biased content. We thus expect the model to exhibit such biases from the training data. **Human life** The model is not intended to inform decisions about matters central to human life, and should not be used in such a way. **Mitigations** We filtered the data from the Web based on its proximity to Wikipedia text and references. For this, we used a Kneser-Ney language model and a fastText linear classifier. **Risks and harms** Risks and harms of large language models include the generation of harmful, offensive or biased content. These models are often prone to generating incorrect information, sometimes referred to as hallucinations. We do not expect our model to be an exception in this regard. **Use cases** LLaMA is a foundational model, and as such, it should not be used for downstream applications without further investigation and mitigations of risks. These risks and potential fraught use cases include, but are not limited to: generation of misinformation and generation of harmful, biased or offensive content.

mradermacher/Athena-70B-L3-GGUF

mradermacher

transformers

text-generation

--- base_model: AiMavenAi/Athena-70B-L3 language: - en library_name: transformers license: cc-by-nc-nd-4.0 quantized_by: mradermacher tags: - autotrain - text-generation-inference - text-generation - peft --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: --> static quants of https://huggingface.co/AiMavenAi/Athena-70B-L3 <!-- provided-files --> weighted/imatrix quants are available at https://huggingface.co/mradermacher/Athena-70B-L3-i1-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q2_K.gguf) | Q2_K | 26.5 | | | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.IQ3_XS.gguf) | IQ3_XS | 29.4 | | | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.IQ3_S.gguf) | IQ3_S | 31.0 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q3_K_S.gguf) | Q3_K_S | 31.0 | | | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.IQ3_M.gguf) | IQ3_M | 32.0 | | | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q3_K_M.gguf) | Q3_K_M | 34.4 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q3_K_L.gguf) | Q3_K_L | 37.2 | | | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.IQ4_XS.gguf) | IQ4_XS | 38.4 | | | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q4_K_S.gguf) | Q4_K_S | 40.4 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q4_K_M.gguf) | Q4_K_M | 42.6 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q5_K_S.gguf) | Q5_K_S | 48.8 | | | [GGUF](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q5_K_M.gguf) | Q5_K_M | 50.0 | | | [PART 1](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q6_K.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q6_K.gguf.part2of2) | Q6_K | 58.0 | very good quality | | [PART 1](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q8_0.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/Athena-70B-L3-GGUF/resolve/main/Athena-70B-L3.Q8_0.gguf.part2of2) | Q8_0 | 75.1 | fast, best quality | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. <!-- end -->

nubby/blessed-sdxl-vae-fp16-fix

nubby

diffusers

--- license: openrail++ --- These VAEs are modified versions of [madebyollin](https://huggingface.co/madebyollin)'s [sdxl-vae-fp16-fix](https://huggingface.co/madebyollin/sdxl-vae-fp16-fix). These VAEs should not produce a NaN in VAE error even when used on half precision. They have been modified using the ideas from [VAE-BlessUp script](https://github.com/sALTaccount/VAE-BlessUp) to produce higher contrast and lower brightness images than the original version. ## The recommended version is [sdxl-vae-fp16fix-blessed.safetensors](https://huggingface.co/nubby/blessed-sdxl-vae-fp16-fix/blob/main/sdxl_vae-fp16fix-blessed.safetensors) For most SDXL models, you probably should probably just use the non-blessed [sdxl-vae-fp16-fix](https://huggingface.co/madebyollin/sdxl-vae-fp16-fix). I made these mostly for fun, but found that slightly increasing contrast and decreasing brightness actually improved the outputs on the model I was testing. You may find one of them to be beneficial for PonyDiffusionV6-XL and other models based on it. Best - [sdxl-vae-fp16fix-blessed.safetensors](https://huggingface.co/nubby/blessed-sdxl-vae-fp16-fix/blob/main/sdxl_vae-fp16fix-blessed.safetensors) = 1.1 contrast multiplier/0.7 brightness multiplier Good - [sdxl_vae-fp16fix-c-1.1-b-0.5.safetensors](https://huggingface.co/nubby/blessed-sdxl-vae-fp16-fix/blob/main/sdxl_vae-fp16fix-c-1.1-b-0.5.safetensors) = 1.1 contrast multiplier/0.5 brightness multiplier High Contrast - [sdxl_vae-fp16fix-c-1.2-b-0.7.safetensors](https://huggingface.co/nubby/blessed-sdxl-vae-fp16-fix/blob/main/sdxl_vae-fp16fix-c-1.2-b-0.7.safetensors) = 1.2 contrast multiplier/0.7 brightness multiplier Very High Contrast - [sdxl_vae-fp16fix-c-1.2-b-0.5.safetensors](https://huggingface.co/nubby/kl-f8-anime2-blessed/blob/main/WD1-4-kl-f8-anime2-bless1-1.safetensors) = 1.2 contrast multiplier/0.5 brightness multiplier Untested: [sdxl_vae-fp16fix-c-0.9.safetensors](https://huggingface.co/nubby/blessed-sdxl-vae-fp16-fix/blob/main/sdxl_vae-fp16fix-c-0.9.safetensors) = 0.9 contrast multiplier [sdxl_vae-fp16fix-c-0.9-b-0.9.safetensors](https://huggingface.co/nubby/blessed-sdxl-vae-fp16-fix/blob/main/sdxl_vae-fp16fix-c-0.9-b-0.9.safetensors) = 0.9 contrast multiplier/0.9 brightness multiplier [sdxl_vae-fp16fix-c-0.8.safetensors](https://huggingface.co/nubby/blessed-sdxl-vae-fp16-fix/blob/main/sdxl_vae-fp16fix-c-0.8.safetensors) = 0.8 contrast multiplier [sdxl_vae-fp16fix-c-0.8-b-0.9.safetensors](https://huggingface.co/nubby/blessed-sdxl-vae-fp16-fix/blob/main/sdxl_vae-fp16fix-c-0.8-b-0.9.safetensors) = 0.8 contrast multiplier/0.9 brightness multiplier [sdxl_vae-fp16fix-c-0.8-b-0.8.safetensors](https://huggingface.co/nubby/blessed-sdxl-vae-fp16-fix/blob/main/sdxl_vae-fp16fix-c-0.8-b-0.8.safetensors) = 0.8 contrast multiplier/0.8 brightness multiplier ## Example images (made using AutismMix_confetti):  Thank you Neggles for the script used to make them!

mradermacher/QuartetAnemoi-70B-t0.0001-GGUF

mradermacher

transformers

--- base_model: alchemonaut/QuartetAnemoi-70B-t0.0001 language: - en library_name: transformers license: other quantized_by: mradermacher tags: - merge --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: --> static quants of https://huggingface.co/alchemonaut/QuartetAnemoi-70B-t0.0001 <!-- provided-files --> weighted/imatrix quants are available at https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-i1-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q2_K.gguf) | Q2_K | 25.6 | | | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.IQ3_XS.gguf) | IQ3_XS | 28.4 | | | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.IQ3_S.gguf) | IQ3_S | 30.0 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q3_K_S.gguf) | Q3_K_S | 30.0 | | | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.IQ3_M.gguf) | IQ3_M | 31.0 | | | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q3_K_M.gguf) | Q3_K_M | 33.4 | lower quality | | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q3_K_L.gguf) | Q3_K_L | 36.2 | | | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.IQ4_XS.gguf) | IQ4_XS | 37.3 | | | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q4_K_S.gguf) | Q4_K_S | 39.3 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q4_K_M.gguf) | Q4_K_M | 41.5 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q5_K_S.gguf) | Q5_K_S | 47.6 | | | [GGUF](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q5_K_M.gguf) | Q5_K_M | 48.9 | | | [PART 1](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q6_K.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q6_K.gguf.part2of2) | Q6_K | 56.7 | very good quality | | [PART 1](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q8_0.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/QuartetAnemoi-70B-t0.0001-GGUF/resolve/main/QuartetAnemoi-70B-t0.0001.Q8_0.gguf.part2of2) | Q8_0 | 73.4 | fast, best quality | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. <!-- end -->

facebook/wav2vec2-xls-r-300m

facebook

transformers

--- language: - multilingual - ab - af - sq - am - ar - hy - as - az - ba - eu - be - bn - bs - br - bg - my - yue - ca - ceb - km - zh - cv - hr - cs - da - dv - nl - en - eo - et - fo - fi - fr - gl - lg - ka - de - el - gn - gu - ht - cnh - ha - haw - he - hi - hu - is - id - ia - ga - it - ja - jv - kb - kn - kk - rw - ky - ko - ku - lo - la - lv - ln - lt - lm - mk - mg - ms - ml - mt - gv - mi - mr - mn - ne - no - nn - oc - or - ps - fa - pl - pt - pa - ro - rm - rm - ru - sah - sa - sco - sr - sn - sd - si - sk - sl - so - hsb - es - su - sw - sv - tl - tg - ta - tt - te - th - bo - tp - tr - tk - uk - ur - uz - vi - vot - war - cy - yi - yo - zu language_bcp47: - zh-HK - zh-TW - fy-NL datasets: - common_voice - multilingual_librispeech tags: - speech - xls_r - xls_r_pretrained license: apache-2.0 --- # Wav2Vec2-XLS-R-300M [Facebook's Wav2Vec2 XLS-R](https://ai.facebook.com/blog/wav2vec-20-learning-the-structure-of-speech-from-raw-audio/) counting **300 million** parameters.  XLS-R is Facebook AI's large-scale multilingual pretrained model for speech (the "XLM-R for Speech"). It is pretrained on 436k hours of unlabeled speech, including VoxPopuli, MLS, CommonVoice, BABEL, and VoxLingua107. It uses the wav2vec 2.0 objective, in 128 languages. When using the model make sure that your speech input is sampled at 16kHz. **Note**: This model should be fine-tuned on a downstream task, like Automatic Speech Recognition, Translation, or Classification. Check out [**this blog**](https://huggingface.co/blog/fine-tune-xlsr-wav2vec2) for more information about ASR. [XLS-R Paper](https://arxiv.org/abs/2111.09296) Authors: Arun Babu, Changhan Wang, Andros Tjandra, Kushal Lakhotia, Qiantong Xu, Naman Goyal, Kritika Singh, Patrick von Platen, Yatharth Saraf, Juan Pino, Alexei Baevski, Alexis Conneau, Michael Auli **Abstract** This paper presents XLS-R, a large-scale model for cross-lingual speech representation learning based on wav2vec 2.0. We train models with up to 2B parameters on 436K hours of publicly available speech audio in 128 languages, an order of magnitude more public data than the largest known prior work. Our evaluation covers a wide range of tasks, domains, data regimes and languages, both high and low-resource. On the CoVoST-2 speech translation benchmark, we improve the previous state of the art by an average of 7.4 BLEU over 21 translation directions into English. For speech recognition, XLS-R improves over the best known prior work on BABEL, MLS, CommonVoice as well as VoxPopuli, lowering error rates by 20%-33% relative on average. XLS-R also sets a new state of the art on VoxLingua107 language identification. Moreover, we show that with sufficient model size, cross-lingual pretraining can outperform English-only pretraining when translating English speech into other languages, a setting which favors monolingual pretraining. We hope XLS-R can help to improve speech processing tasks for many more languages of the world. The original model can be found under https://github.com/pytorch/fairseq/tree/master/examples/wav2vec#wav2vec-20. # Usage See [this google colab](https://colab.research.google.com/github/patrickvonplaten/notebooks/blob/master/Fine_Tune_XLS_R_on_Common_Voice.ipynb) for more information on how to fine-tune the model. You can find other pretrained XLS-R models with different numbers of parameters: * [300M parameters version](https://huggingface.co/facebook/wav2vec2-xls-r-300m) * [1B version version](https://huggingface.co/facebook/wav2vec2-xls-r-1b) * [2B version version](https://huggingface.co/facebook/wav2vec2-xls-r-2b)

sfairXC/FsfairX-LLaMA3-RM-v0.1

sfairXC

transformers

text-classification

--- license: cc-by-nc-4.0 --- This reward function can be used for RLHF, including PPO, iterative SFT, iterative DPO. The license is derived from `PKU-Alignment/PKU-SafeRLHF-30K`. ## Training The base model is `meta-llama/Meta-Llama-3-8B-Instruct`. We use the training script at `https://github.com/WeiXiongUST/RLHF-Reward-Modeling`. ## Uses ```python from transformers import AutoTokenizer, pipeline rm_tokenizer = AutoTokenizer.from_pretrained("sfairXC/FsfairX-LLaMA3-RM-v0.1") device = 0 # accelerator.device rm_pipe = pipeline( "sentiment-analysis", model="sfairXC/FsfairX-LLaMA3-RM-v0.1", #device="auto", device=device, tokenizer=rm_tokenizer, model_kwargs={"torch_dtype": torch.bfloat16} ) pipe_kwargs = { "return_all_scores": True, "function_to_apply": "none", "batch_size": 1 } chat = [ {"role": "user", "content": "Hello, how are you?"}, {"role": "assistant", "content": "I'm doing great. How can I help you today?"}, {"role": "user", "content": "I'd like to show off how chat templating works!"}, ] test_texts = [tokenizer.apply_chat_template(chat, tokenize=False, add_generation_prompt=False).replace(tokenizer.bos_token, "")] pipe_outputs = rm_pipe(test_texts, **pipe_kwargs) rewards = [output[0]["score"] for output in pipe_outputs] ``` ## Results This Reward model is the SOTA open-source RM (Apr 20, 2024) on Reward-Bench. | Metric | Score | |--------------|--------| | Chat | 99.44 | | Chat Hard | 65.13 | | Safety | 88.76 | | Reasoning | 88.3 | ## References The repo was part of the iterative rejection sampling fine-tuning and iterative DPO. If you find the content of this repo useful in your work, please consider cite it as follows: ```bibtex @article{dong2023raft, title={Raft: Reward ranked finetuning for generative foundation model alignment}, author={Dong, Hanze and Xiong, Wei and Goyal, Deepanshu and Pan, Rui and Diao, Shizhe and Zhang, Jipeng and Shum, Kashun and Zhang, Tong}, journal={arXiv preprint arXiv:2304.06767}, year={2023} } @misc{xiong2024iterative, title={Iterative Preference Learning from Human Feedback: Bridging Theory and Practice for RLHF under KL-Constraint}, author={Wei Xiong and Hanze Dong and Chenlu Ye and Ziqi Wang and Han Zhong and Heng Ji and Nan Jiang and Tong Zhang}, year={2024}, eprint={2312.11456}, archivePrefix={arXiv}, primaryClass={cs.LG} } ```

MaziyarPanahi/Qwen2-7B-Instruct-GGUF

MaziyarPanahi

transformers

text-generation

--- tags: - quantized - 2-bit - 3-bit - 4-bit - 5-bit - 6-bit - 8-bit - GGUF - text-generation - llama-3 - llama - text-generation model_name: Qwen2-7B-Instruct-GGUF base_model: Qwen/Qwen2-7B-Instruct inference: false model_creator: Qwen pipeline_tag: text-generation quantized_by: MaziyarPanahi --- # [MaziyarPanahi/Qwen2-7B-Instruct-GGUF](https://huggingface.co/MaziyarPanahi/Qwen2-7B-Instruct-GGUF) - Model creator: [Qwen](https://huggingface.co/Qwen) - Original model: [Qwen/Qwen2-7B-Instruct](https://huggingface.co/Qwen/Qwen2-7B-Instruct) ## Description [MaziyarPanahi/Qwen2-7B-Instruct-GGUF](https://huggingface.co/MaziyarPanahi/Qwen2-7B-Instruct-GGUF) contains GGUF format model files for [Qwen/Qwen2-7B-Instruct](https://huggingface.co/Qwen/Qwen2-7B-Instruct). ### About GGUF GGUF is a new format introduced by the llama.cpp team on August 21st 2023. It is a replacement for GGML, which is no longer supported by llama.cpp. Here is an incomplete list of clients and libraries that are known to support GGUF: * [llama.cpp](https://github.com/ggerganov/llama.cpp). The source project for GGUF. Offers a CLI and a server option. * [llama-cpp-python](https://github.com/abetlen/llama-cpp-python), a Python library with GPU accel, LangChain support, and OpenAI-compatible API server. * [LM Studio](https://lmstudio.ai/), an easy-to-use and powerful local GUI for Windows and macOS (Silicon), with GPU acceleration. Linux available, in beta as of 27/11/2023. * [text-generation-webui](https://github.com/oobabooga/text-generation-webui), the most widely used web UI, with many features and powerful extensions. Supports GPU acceleration. * [KoboldCpp](https://github.com/LostRuins/koboldcpp), a fully featured web UI, with GPU accel across all platforms and GPU architectures. Especially good for story telling. * [GPT4All](https://gpt4all.io/index.html), a free and open source local running GUI, supporting Windows, Linux and macOS with full GPU accel. * [LoLLMS Web UI](https://github.com/ParisNeo/lollms-webui), a great web UI with many interesting and unique features, including a full model library for easy model selection. * [Faraday.dev](https://faraday.dev/), an attractive and easy to use character-based chat GUI for Windows and macOS (both Silicon and Intel), with GPU acceleration. * [candle](https://github.com/huggingface/candle), a Rust ML framework with a focus on performance, including GPU support, and ease of use. * [ctransformers](https://github.com/marella/ctransformers), a Python library with GPU accel, LangChain support, and OpenAI-compatible AI server. Note, as of time of writing (November 27th 2023), ctransformers has not been updated in a long time and does not support many recent models. ## Special thanks 🙏 Special thanks to [Georgi Gerganov](https://github.com/ggerganov) and the whole team working on [llama.cpp](https://github.com/ggerganov/llama.cpp/) for making all of this possible.

Quant-Cartel/Llama-3-TenyxChat-DaybreakStorywriter-70B-iMat-GGUF

Quant-Cartel

--- license: cc-by-nc-4.0 tags: - not-for-all-audiences --- ``` e88 88e d8 d888 888b 8888 8888 ,"Y88b 888 8e d88 C8888 8888D 8888 8888 "8" 888 888 88b d88888 Y888 888P Y888 888P ,ee 888 888 888 888 "88 88" "88 88" "88 888 888 888 888 b 8b, e88'Y88 d8 888 d888 'Y ,"Y88b 888,8, d88 ,e e, 888 C8888 "8" 888 888 " d88888 d88 88b 888 Y888 ,d ,ee 888 888 888 888 , 888 "88,d88 "88 888 888 888 "YeeP" 888 PROUDLY PRESENTS ``` # Llama-3-TenyxChat-DaybreakStorywriter-70B-iMat-GGUF Quantized with love from fp16. Original model author: [Envoid](https://huggingface.co/Envoid/) * Importance Matrix calculated using [groups_merged.txt](https://github.com/ggerganov/llama.cpp/discussions/5263#discussioncomment-8395384) in 88 chunks, n_ctx=512, and fp16 precision weights Original model README [here](https://huggingface.co/Envoid/Llama-3-TenyxChat-DaybreakStorywriter-70B) and below: ----- ## Caution: This model is capable of producing adult content. This model is a 50/50 SLERP merge between [crestf411/L3-70B-daybreak-storywriter-v0.4](https://huggingface.co/crestf411/L3-70B-daybreak-storywriter-v0.4) and [tenyx/Llama3-TenyxChat-70B](https://huggingface.co/tenyx/Llama3-TenyxChat-70B) The resulting model scores significantly higher on the super top secret, private **NALA** evaluation *(Neural-linguistic Assessment of Lifelike Approximation)*^[1] making it a great choice for novelty RP scenarios. **TenyxChat-DaybreakStorywriter: 76.52** DeepSeek-Coder-V2-Instruct: 68.20 TenyxChat: 57.89 This model utilizes the Llama-3-Instruct prompt format. ^{1. The NALA evaluation is not a proper scientific evaluation and should not be used to inform any decisions related to personal safety, personal enjoyment, or any other critical or non-critical matter. NALA score is entirely arbitrary and subject to change without notice.}

mradermacher/Yi-34B-Chat-i1-GGUF

mradermacher

transformers

--- base_model: 01-ai/Yi-34B-Chat language: - en library_name: transformers license: apache-2.0 quantized_by: mradermacher --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: nicoboss --> weighted/imatrix quants of https://huggingface.co/01-ai/Yi-34B-Chat <!-- provided-files --> static quants are available at https://huggingface.co/mradermacher/Yi-34B-Chat-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-IQ1_S.gguf) | i1-IQ1_S | 7.6 | for the desperate | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-IQ1_M.gguf) | i1-IQ1_M | 8.3 | mostly desperate | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-IQ2_XXS.gguf) | i1-IQ2_XXS | 9.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-IQ2_XS.gguf) | i1-IQ2_XS | 10.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-IQ2_S.gguf) | i1-IQ2_S | 11.0 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-IQ2_M.gguf) | i1-IQ2_M | 11.9 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-Q2_K.gguf) | i1-Q2_K | 12.9 | IQ3_XXS probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-IQ3_XXS.gguf) | i1-IQ3_XXS | 13.4 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-IQ3_XS.gguf) | i1-IQ3_XS | 14.3 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-Q3_K_S.gguf) | i1-Q3_K_S | 15.1 | IQ3_XS probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-IQ3_S.gguf) | i1-IQ3_S | 15.1 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-IQ3_M.gguf) | i1-IQ3_M | 15.7 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-Q3_K_M.gguf) | i1-Q3_K_M | 16.8 | IQ3_S probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-Q3_K_L.gguf) | i1-Q3_K_L | 18.2 | IQ3_M probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-IQ4_XS.gguf) | i1-IQ4_XS | 18.6 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-Q4_0.gguf) | i1-Q4_0 | 19.6 | fast, low quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-Q4_K_S.gguf) | i1-Q4_K_S | 19.7 | optimal size/speed/quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-Q4_K_M.gguf) | i1-Q4_K_M | 20.8 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-Q5_K_S.gguf) | i1-Q5_K_S | 23.8 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-Q5_K_M.gguf) | i1-Q5_K_M | 24.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-Chat-i1-GGUF/resolve/main/Yi-34B-Chat.i1-Q6_K.gguf) | i1-Q6_K | 28.3 | practically like static Q6_K | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. Additional thanks to [@nicoboss](https://huggingface.co/nicoboss) for giving me access to his hardware for calculating the imatrix for these quants. <!-- end -->

timm/ViT-SO400M-14-SigLIP-384

timm

open_clip

zero-shot-image-classification

--- tags: - clip - siglip library_name: open_clip pipeline_tag: zero-shot-image-classification license: apache-2.0 datasets: - webli --- # Model card for ViT-SO400M-14-SigLIP-384 A SigLIP (Sigmoid loss for Language-Image Pre-training) model trained on WebLI. This model has been converted to PyTorch from the original JAX checkpoints in [Big Vision](https://github.com/google-research/big_vision). These weights are usable in both OpenCLIP (image + text) and timm (image only). ## Model Details - **Model Type:** Contrastive Image-Text, Zero-Shot Image Classification. - **Original:** https://github.com/google-research/big_vision - **Dataset:** WebLI - **Papers:** - Sigmoid loss for language image pre-training: https://arxiv.org/abs/2303.15343 ## Model Usage ### With OpenCLIP ```python import torch import torch.nn.functional as F from urllib.request import urlopen from PIL import Image from open_clip import create_model_from_pretrained, get_tokenizer # works on open-clip-torch>=2.23.0, timm>=0.9.8 model, preprocess = create_model_from_pretrained('hf-hub:timm/ViT-SO400M-14-SigLIP-384') tokenizer = get_tokenizer('hf-hub:timm/ViT-SO400M-14-SigLIP-384') image = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) image = preprocess(image).unsqueeze(0) labels_list = ["a dog", "a cat", "a donut", "a beignet"] text = tokenizer(labels_list, context_length=model.context_length) with torch.no_grad(), torch.cuda.amp.autocast(): image_features = model.encode_image(image) text_features = model.encode_text(text) image_features = F.normalize(image_features, dim=-1) text_features = F.normalize(text_features, dim=-1) text_probs = torch.sigmoid(image_features @ text_features.T * model.logit_scale.exp() + model.logit_bias) zipped_list = list(zip(labels_list, [round(p.item(), 3) for p in text_probs[0]])) print("Label probabilities: ", zipped_list) ``` ### With `timm` (for image embeddings) ```python from urllib.request import urlopen from PIL import Image import timm image = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'vit_so400m_patch14_siglip_384', pretrained=True, num_classes=0, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(image).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor ``` ## Citation ```bibtex @article{zhai2023sigmoid, title={Sigmoid loss for language image pre-training}, author={Zhai, Xiaohua and Mustafa, Basil and Kolesnikov, Alexander and Beyer, Lucas}, journal={arXiv preprint arXiv:2303.15343}, year={2023} } ``` ```bibtex @misc{big_vision, author = {Beyer, Lucas and Zhai, Xiaohua and Kolesnikov, Alexander}, title = {Big Vision}, year = {2022}, publisher = {GitHub}, journal = {GitHub repository}, howpublished = {\url{https://github.com/google-research/big_vision}} } ```

mradermacher/Swallow-70b-instruct-hf-GGUF

mradermacher

transformers

--- base_model: tokyotech-llm/Swallow-70b-instruct-hf language: - en - ja library_name: transformers license: llama2 model_type: llama quantized_by: mradermacher --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: --> static quants of https://huggingface.co/tokyotech-llm/Swallow-70b-instruct-hf <!-- provided-files --> weighted/imatrix quants are available at https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-i1-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q2_K.gguf) | Q2_K | 25.7 | | | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.IQ3_XS.gguf) | IQ3_XS | 28.5 | | | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.IQ3_S.gguf) | IQ3_S | 30.1 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q3_K_S.gguf) | Q3_K_S | 30.1 | | | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.IQ3_M.gguf) | IQ3_M | 31.2 | | | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q3_K_M.gguf) | Q3_K_M | 33.5 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q3_K_L.gguf) | Q3_K_L | 36.4 | | | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.IQ4_XS.gguf) | IQ4_XS | 37.4 | | | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q4_K_S.gguf) | Q4_K_S | 39.5 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q4_K_M.gguf) | Q4_K_M | 41.6 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q5_K_S.gguf) | Q5_K_S | 47.7 | | | [GGUF](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q5_K_M.gguf) | Q5_K_M | 49.0 | | | [PART 1](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q6_K.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q6_K.gguf.part2of2) | Q6_K | 56.8 | very good quality | | [PART 1](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q8_0.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/Swallow-70b-instruct-hf-GGUF/resolve/main/Swallow-70b-instruct-hf.Q8_0.gguf.part2of2) | Q8_0 | 73.6 | fast, best quality | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. <!-- end -->

IDEA-CCNL/Erlangshen-Roberta-330M-Sentiment

IDEA-CCNL

transformers

text-classification

--- language: - zh license: apache-2.0 tags: - roberta - NLU - Sentiment - Chinese inference: true widget: - text: "今天心情不好" --- # Erlangshen-Roberta-330M-Sentiment - Main Page:[Fengshenbang](https://fengshenbang-lm.com/) - Github: [Fengshenbang-LM](https://github.com/IDEA-CCNL/Fengshenbang-LM) ## 简介 Brief Introduction 中文的RoBERTa-wwm-ext-large在数个情感分析任务微调后的版本 This is the fine-tuned version of the Chinese RoBERTa-wwm-ext-large model on several sentiment analysis datasets. ## 模型分类 Model Taxonomy | 需求 Demand | 任务 Task | 系列 Series | 模型 Model | 参数 Parameter | 额外 Extra | | :----: | :----: | :----: | :----: | :----: | :----: | | 通用 General | 自然语言理解 NLU | 二郎神 Erlangshen | Roberta | 330M | 中文-情感分析 Chinese-Sentiment | ## 模型信息 Model Information 基于[chinese-roberta-wwm-ext-large](https://huggingface.co/hfl/chinese-roberta-wwm-ext-large)，我们在收集的8个中文领域的情感分析数据集，总计227347个样本上微调了一个Semtiment版本。 Based on [chinese-roberta-wwm-ext-large](https://huggingface.co/hfl/chinese-roberta-wwm-ext-large), we fine-tuned a sentiment analysis version on 8 Chinese sentiment analysis datasets, with totaling 227,347 samples. ### 下游效果 Performance | 模型 Model | ASAP-SENT | ASAP-ASPECT | ChnSentiCorp | | :--------: | :-----: | :----: | :-----: | | Erlangshen-Roberta-110M-Sentiment | 97.77 | 97.31 | 96.61 | | Erlangshen-Roberta-330M-Sentiment | 97.9 | 97.51 | 96.66 | | Erlangshen-MegatronBert-1.3B-Sentiment | 98.1 | 97.8 | 97 | ## 使用 Usage ``` python from transformers import BertForSequenceClassification from transformers import BertTokenizer import torch tokenizer=BertTokenizer.from_pretrained('IDEA-CCNL/Erlangshen-Roberta-330M-Sentiment') model=BertForSequenceClassification.from_pretrained('IDEA-CCNL/Erlangshen-Roberta-330M-Sentiment') text='今天心情不好' output=model(torch.tensor([tokenizer.encode(text)])) print(torch.nn.functional.softmax(output.logits,dim=-1)) ``` ## 引用 Citation 如果您在您的工作中使用了我们的模型，可以引用我们的[论文](https://arxiv.org/abs/2209.02970)： If you are using the resource for your work, please cite the our [paper](https://arxiv.org/abs/2209.02970): ```text @article{fengshenbang, author = {Jiaxing Zhang and Ruyi Gan and Junjie Wang and Yuxiang Zhang and Lin Zhang and Ping Yang and Xinyu Gao and Ziwei Wu and Xiaoqun Dong and Junqing He and Jianheng Zhuo and Qi Yang and Yongfeng Huang and Xiayu Li and Yanghan Wu and Junyu Lu and Xinyu Zhu and Weifeng Chen and Ting Han and Kunhao Pan and Rui Wang and Hao Wang and Xiaojun Wu and Zhongshen Zeng and Chongpei Chen}, title = {Fengshenbang 1.0: Being the Foundation of Chinese Cognitive Intelligence}, journal = {CoRR}, volume = {abs/2209.02970}, year = {2022} } ``` 也可以引用我们的[网站](https://github.com/IDEA-CCNL/Fengshenbang-LM/): You can also cite our [website](https://github.com/IDEA-CCNL/Fengshenbang-LM/): ```text @misc{Fengshenbang-LM, title={Fengshenbang-LM}, author={IDEA-CCNL}, year={2021}, howpublished={\url{https://github.com/IDEA-CCNL/Fengshenbang-LM}}, } ```

bartowski/Hermes-2-Theta-Llama-3-70B-GGUF

bartowski

text-generation

--- license: llama3 language: - en pipeline_tag: text-generation tags: - distillation - synthetic data - function calling - structured outputs - json mode quantized_by: bartowski base_model: NousResearch/Hermes-2-Theta-Llama-3-70B --- ## Llamacpp imatrix Quantizations of Hermes-2-Theta-Llama-3-70B Using <a href="https://github.com/ggerganov/llama.cpp/">llama.cpp</a> release <a href="https://github.com/ggerganov/llama.cpp/releases/tag/b3166">b3166</a> for quantization. Original model: https://huggingface.co/NousResearch/Hermes-2-Theta-Llama-3-70B All quants made using imatrix option with dataset from [here](https://gist.github.com/bartowski1182/eb213dccb3571f863da82e99418f81e8) ## Prompt format ``` <|begin_of_text|><|im_start|>system {system_prompt}<|im_end|> <|im_start|>user {prompt}<|im_end|> <|im_start|>assistant ``` ## Download a file (not the whole branch) from below: | Filename | Quant type | File Size | Description | | -------- | ---------- | --------- | ----------- | | [Hermes-2-Theta-Llama-3-70B-Q8_0.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/tree/main/Hermes-2-Theta-Llama-3-70B-Q8_0.gguf) | Q8_0 | 74.97GB | Extremely high quality, generally unneeded but max available quant. | | [Hermes-2-Theta-Llama-3-70B-Q6_K.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/tree/main/Hermes-2-Theta-Llama-3-70B-Q6_K.gguf) | Q6_K | 57.88GB | Very high quality, near perfect, *recommended*. | | [Hermes-2-Theta-Llama-3-70B-Q5_K_L.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/tree/main/Hermes-2-Theta-Llama-3-70B-Q5_K_L.gguf) | Q5_K_L | 52.56GB | *Experimental*, uses f16 for embed and output weights. Please provide any feedback of differences. High quality, *recommended*. | | [Hermes-2-Theta-Llama-3-70B-Q5_K_M.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-Q5_K_M.gguf) | Q5_K_M | 49.94GB | High quality, *recommended*. | | [Hermes-2-Theta-Llama-3-70B-Q4_K_L.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-Q4_K_L.gguf) | Q4_K_L | 45.27GB | *Experimental*, uses f16 for embed and output weights. Please provide any feedback of differences. Good quality, uses about 4.83 bits per weight, *recommended*. | | [Hermes-2-Theta-Llama-3-70B-Q4_K_M.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-Q4_K_M.gguf) | Q4_K_M | 42.52GB | Good quality, uses about 4.83 bits per weight, *recommended*. | | [Hermes-2-Theta-Llama-3-70B-IQ4_XS.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-IQ4_XS.gguf) | IQ4_XS | 37.90GB | Decent quality, smaller than Q4_K_S with similar performance, *recommended*. | | [Hermes-2-Theta-Llama-3-70B-Q3_K_XL.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-Q3_K_XL.gguf) | Q3_K_XL | 40.00GB | *Experimental*, uses f16 for embed and output weights. Please provide any feedback of differences. Medium low quality. | | [Hermes-2-Theta-Llama-3-70B-Q3_K_M.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-Q3_K_M.gguf) | Q3_K_M | 34.26GB | Even lower quality. | | [Hermes-2-Theta-Llama-3-70B-IQ3_M.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-IQ3_M.gguf) | IQ3_M | 31.93GB | Medium-low quality, new method with decent performance comparable to Q3_K_M. | | [Hermes-2-Theta-Llama-3-70B-Q3_K_S.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-Q3_K_S.gguf) | Q3_K_S | 30.91GB | Low quality, not recommended. | | [Hermes-2-Theta-Llama-3-70B-IQ3_XXS.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-IQ3_XXS.gguf) | IQ3_XXS | 27.46GB | Lower quality, new method with decent performance, comparable to Q3 quants. | | [Hermes-2-Theta-Llama-3-70B-Q2_K_L.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-Q2_K_L.gguf) | Q2_K_L | 29.40GB | *Experimental*, uses f16 for embed and output weights. Please provide any feedback of differences. Very low quality but surprisingly usable. | | [Hermes-2-Theta-Llama-3-70B-Q2_K.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-Q2_K.gguf) | Q2_K | 26.37GB | Very low quality but surprisingly usable. | | [Hermes-2-Theta-Llama-3-70B-IQ2_M.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-IQ2_M.gguf) | IQ2_M | 24.11GB | Very low quality, uses SOTA techniques to also be surprisingly usable. | | [Hermes-2-Theta-Llama-3-70B-IQ2_XS.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-IQ2_XS.gguf) | IQ2_XS | 21.14GB | Lower quality, uses SOTA techniques to be usable. | | [Hermes-2-Theta-Llama-3-70B-IQ2_XXS.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-IQ2_XXS.gguf) | IQ2_XXS | 19.09GB | Lower quality, uses SOTA techniques to be usable. | | [Hermes-2-Theta-Llama-3-70B-IQ1_M.gguf](https://huggingface.co/bartowski/Hermes-2-Theta-Llama-3-70B-GGUF/blob/main/Hermes-2-Theta-Llama-3-70B-IQ1_M.gguf) | IQ1_M | 16.75GB | Extremely low quality, *not* recommended. | ## Downloading using huggingface-cli First, make sure you have hugginface-cli installed: ``` pip install -U "huggingface_hub[cli]" ``` Then, you can target the specific file you want: ``` huggingface-cli download bartowski/Hermes-2-Theta-Llama-3-70B-GGUF --include "Hermes-2-Theta-Llama-3-70B-Q4_K_M.gguf" --local-dir ./ ``` If the model is bigger than 50GB, it will have been split into multiple files. In order to download them all to a local folder, run: ``` huggingface-cli download bartowski/Hermes-2-Theta-Llama-3-70B-GGUF --include "Hermes-2-Theta-Llama-3-70B-Q8_0.gguf/*" --local-dir Hermes-2-Theta-Llama-3-70B-Q8_0 ``` You can either specify a new local-dir (Hermes-2-Theta-Llama-3-70B-Q8_0) or download them all in place (./) ## Which file should I choose? A great write up with charts showing various performances is provided by Artefact2 [here](https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9) The first thing to figure out is how big a model you can run. To do this, you'll need to figure out how much RAM and/or VRAM you have. If you want your model running as FAST as possible, you'll want to fit the whole thing on your GPU's VRAM. Aim for a quant with a file size 1-2GB smaller than your GPU's total VRAM. If you want the absolute maximum quality, add both your system RAM and your GPU's VRAM together, then similarly grab a quant with a file size 1-2GB Smaller than that total. Next, you'll need to decide if you want to use an 'I-quant' or a 'K-quant'. If you don't want to think too much, grab one of the K-quants. These are in format 'QX_K_X', like Q5_K_M. If you want to get more into the weeds, you can check out this extremely useful feature chart: [llama.cpp feature matrix](https://github.com/ggerganov/llama.cpp/wiki/Feature-matrix) But basically, if you're aiming for below Q4, and you're running cuBLAS (Nvidia) or rocBLAS (AMD), you should look towards the I-quants. These are in format IQX_X, like IQ3_M. These are newer and offer better performance for their size. These I-quants can also be used on CPU and Apple Metal, but will be slower than their K-quant equivalent, so speed vs performance is a tradeoff you'll have to decide. The I-quants are *not* compatible with Vulcan, which is also AMD, so if you have an AMD card double check if you're using the rocBLAS build or the Vulcan build. At the time of writing this, LM Studio has a preview with ROCm support, and other inference engines have specific builds for ROCm. Want to support my work? Visit my ko-fi page here: https://ko-fi.com/bartowski

facebook/dinov2-giant

facebook

transformers

image-feature-extraction

--- license: apache-2.0 tags: - dino - vision --- # Vision Transformer (giant-sized model) trained using DINOv2 Vision Transformer (ViT) model trained using the DINOv2 method. It was introduced in the paper [DINOv2: Learning Robust Visual Features without Supervision](https://arxiv.org/abs/2304.07193) by Oquab et al. and first released in [this repository](https://github.com/facebookresearch/dinov2). Disclaimer: The team releasing DINOv2 did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description The Vision Transformer (ViT) is a transformer encoder model (BERT-like) pretrained on a large collection of images in a self-supervised fashion. Images are presented to the model as a sequence of fixed-size patches, which are linearly embedded. One also adds a [CLS] token to the beginning of a sequence to use it for classification tasks. One also adds absolute position embeddings before feeding the sequence to the layers of the Transformer encoder. Note that this model does not include any fine-tuned heads. By pre-training the model, it learns an inner representation of images that can then be used to extract features useful for downstream tasks: if you have a dataset of labeled images for instance, you can train a standard classifier by placing a linear layer on top of the pre-trained encoder. One typically places a linear layer on top of the [CLS] token, as the last hidden state of this token can be seen as a representation of an entire image. ## Intended uses & limitations You can use the raw model for feature extraction. See the [model hub](https://huggingface.co/models?search=facebook/dinov2) to look for fine-tuned versions on a task that interests you. ### How to use Here is how to use this model: ```python from transformers import AutoImageProcessor, AutoModel from PIL import Image import requests url = 'http://images.cocodataset.org/val2017/000000039769.jpg' image = Image.open(requests.get(url, stream=True).raw) processor = AutoImageProcessor.from_pretrained('facebook/dinov2-giant') model = AutoModel.from_pretrained('facebook/dinov2-giant') inputs = processor(images=image, return_tensors="pt") outputs = model(**inputs) last_hidden_states = outputs.last_hidden_state ``` ### BibTeX entry and citation info ```bibtex misc{oquab2023dinov2, title={DINOv2: Learning Robust Visual Features without Supervision}, author={Maxime Oquab and Timothée Darcet and Théo Moutakanni and Huy Vo and Marc Szafraniec and Vasil Khalidov and Pierre Fernandez and Daniel Haziza and Francisco Massa and Alaaeldin El-Nouby and Mahmoud Assran and Nicolas Ballas and Wojciech Galuba and Russell Howes and Po-Yao Huang and Shang-Wen Li and Ishan Misra and Michael Rabbat and Vasu Sharma and Gabriel Synnaeve and Hu Xu and Hervé Jegou and Julien Mairal and Patrick Labatut and Armand Joulin and Piotr Bojanowski}, year={2023}, eprint={2304.07193}, archivePrefix={arXiv}, primaryClass={cs.CV} } ```

facebook/galactica-125m

facebook

transformers

text-generation

--- license: cc-by-nc-4.0 tags: - galactica widget: - text: "The Transformer architecture [START_REF]" - text: "The Schwarzschild radius is defined as: \\[" - text: "A force of 0.6N is applied to an object, which accelerates at 3m/s. What is its mass? <work>" - text: "Lecture 1: The Ising Model\n\n" - text: "[START_I_SMILES]" - text: "[START_AMINO]GHMQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP[END_AMINO] ## Keywords" inference: false ---  # GALACTICA 125M (mini) Model card from the original [repo](https://github.com/paperswithcode/galai/blob/main/docs/model_card.md) Following [Mitchell et al. (2018)](https://arxiv.org/abs/1810.03993), this model card provides information about the GALACTICA model, how it was trained, and the intended use cases. Full details about how the model was trained and evaluated can be found in the [release paper](https://galactica.org/paper.pdf). ## Model Details The GALACTICA models are trained on a large-scale scientific corpus. The models are designed to perform scientific tasks, including but not limited to citation prediction, scientific QA, mathematical reasoning, summarization, document generation, molecular property prediction and entity extraction. The models were developed by the Papers with Code team at Meta AI to study the use of language models for the automatic organization of science. We train models with sizes ranging from 125M to 120B parameters. Below is a summary of the released models: | Size | Parameters | |:-----------:|:-----------:| | `mini` | 125 M | | `base` | 1.3 B | | `standard` | 6.7 B | | `large` | 30 B | | `huge` | 120 B | ## Release Date November 2022 ## Model Type Transformer based architecture in a decoder-only setup with a few modifications (see paper for more details). ## Paper & Demo [Paper](https://galactica.org/paper.pdf) / [Demo](https://galactica.org) ## Model Use The primary intended users of the GALACTICA models are researchers studying language models applied to the scientific domain. We also anticipate the model will be useful for developers who wish to build scientific tooling. However, we caution against production use without safeguards given the potential of language models to hallucinate. The models are made available under a non-commercial CC BY-NC 4.0 license. More information about how to use the model can be found in the README.md of this repository. ## Training Data The GALACTICA models are trained on 106 billion tokens of open-access scientific text and data. This includes papers, textbooks, scientific websites, encyclopedias, reference material, knowledge bases, and more. We tokenize different modalities to provide a natural langauge interface for different tasks. See the README.md for more information. See the paper for full information on the training data. ## How to use Find below some example scripts on how to use the model in `transformers`: ## Using the Pytorch model ### Running the model on a CPU <details> <summary> Click to expand </summary> ```python from transformers import AutoTokenizer, OPTForCausalLM tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m") model = OPTForCausalLM.from_pretrained("facebook/galactica-125m") input_text = "The Transformer architecture [START_REF]" input_ids = tokenizer(input_text, return_tensors="pt").input_ids outputs = model.generate(input_ids) print(tokenizer.decode(outputs[0])) ``` </details> ### Running the model on a GPU <details> <summary> Click to expand </summary> ```python # pip install accelerate from transformers import AutoTokenizer, OPTForCausalLM tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m") model = OPTForCausalLM.from_pretrained("facebook/galactica-125m", device_map="auto") input_text = "The Transformer architecture [START_REF]" input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda") outputs = model.generate(input_ids) print(tokenizer.decode(outputs[0])) ``` </details> ### Running the model on a GPU using different precisions #### FP16 <details> <summary> Click to expand </summary> ```python # pip install accelerate import torch from transformers import AutoTokenizer, OPTForCausalLM tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m") model = OPTForCausalLM.from_pretrained("facebook/galactica-125m", device_map="auto", torch_dtype=torch.float16) input_text = "The Transformer architecture [START_REF]" input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda") outputs = model.generate(input_ids) print(tokenizer.decode(outputs[0])) ``` </details> #### INT8 <details> <summary> Click to expand </summary> ```python # pip install bitsandbytes accelerate from transformers import AutoTokenizer, OPTForCausalLM tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m") model = OPTForCausalLM.from_pretrained("facebook/galactica-125m", device_map="auto", load_in_8bit=True) input_text = "The Transformer architecture [START_REF]" input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda") outputs = model.generate(input_ids) print(tokenizer.decode(outputs[0])) ``` </details> ## Performance and Limitations The model outperforms several existing language models on a range of knowledge probes, reasoning, and knowledge-intensive scientific tasks. This also extends to general NLP tasks, where GALACTICA outperforms other open source general language models. That being said, we note a number of limitations in this section. As with other language models, GALACTICA is often prone to hallucination - and training on a high-quality academic corpus does not prevent this, especially for less popular and less cited scientific concepts. There are no guarantees of truthful output when generating from the model. This extends to specific modalities such as citation prediction. While GALACTICA's citation behaviour approaches the ground truth citation behaviour with scale, the model continues to exhibit a popularity bias at larger scales. In addition, we evaluated the model on several types of benchmarks related to stereotypes and toxicity. Overall, the model exhibits substantially lower toxicity rates compared to other large language models. That being said, the model continues to exhibit bias on certain measures (see the paper for details). So we recommend care when using the model for generations. ## Broader Implications GALACTICA can potentially be used as a new way to discover academic literature. We also expect a lot of downstream use for application to particular domains, such as mathematics, biology, and chemistry. In the paper, we demonstrated several examples of the model acting as alternative to standard search tools. We expect a new generation of scientific tools to be built upon large language models such as GALACTICA. We encourage researchers to investigate beneficial and new use cases for these models. That being said, it is important to be aware of the current limitations of large language models. Researchers should pay attention to common issues such as hallucination and biases that could emerge from using these models. ## Citation ```bibtex @inproceedings{GALACTICA, title={GALACTICA: A Large Language Model for Science}, author={Ross Taylor and Marcin Kardas and Guillem Cucurull and Thomas Scialom and Anthony Hartshorn and Elvis Saravia and Andrew Poulton and Viktor Kerkez and Robert Stojnic}, year={2022} } ```

echarlaix/tiny-random-PhiForCausalLM

echarlaix

transformers

text-generation

--- license: apache-2.0 ---

ufal/robeczech-base

ufal

transformers

fill-mask

--- language: cs license: cc-by-nc-sa-4.0 tags: - RobeCzech - Czech - RoBERTa - ÚFAL --- # Model Card for RobeCzech ## Version History - **version 1.1**: Version 1.1 was released in Jan 2024, with a change to the tokenizer described below; the model parameters were mostly kept the same, but (a) the embeddings were enlarged (by copying suitable rows) to correspond to the updated tokenizer, (b) the pooler was dropped (originally it was only randomly initialized). The tokenizer in the initial release (a) contained a hole (51959 did not correspond to any token), and (b) mapped several tokens (unseen during training but required by the BBPE tokenizer) to the same ID as the `[UNK]` token (3). That sometimes caused problems, as in https://huggingface.co/ufal/robeczech-base/discussions/4. See https://huggingface.co/ufal/robeczech-base/discussions/4#64b8f6a7f1f8e6ea5860b314 for more information. In version 1.1, the tokenizer was modified by (a) removing the hole, (b) mapping all tokens to a unique ID. That also required increasing the vocabulary size and embeddings weights (by replicating the embedding of the `[UNK]` token). Without finetuning, version 1.1 and version 1.0 gives exactly the same embeddings on any input (apart from the pooler missing in v1.1), and the tokens in version 1.0 that mapped to a different ID than the `[UNK]` token map to the same ID in version 1.1. However, the sizes of the embeddings (and LM head weights and biases) are different, so the weights of the version 1.1 are not compatible with the configuration of version 1.0 and vice versa. - **version 1.0**: Initial version released in May 2021 (with the tokenization issues described above). If you want to load a pretrained model, configuration, or a tokenizer of version 1.0, you can use ```python from_pretrained("ufal/robeczech-base", revision="v1.0") ``` to create an `AutoModel`, an `AutoConfig`, or an `AutoTokenizer`. # Model Details ## Model Description RobeCzech is a monolingual RoBERTa language representation model trained on Czech data. - **Developed by:** Institute of Formal and Applied Linguistics, Charles University, Prague (UFAL) - **Shared by:** Hugging Face and [LINDAT/CLARIAH-CZ](https://hdl.handle.net/11234/1-3691) - **Model type:** Fill-Mask - **Language(s) (NLP):** cs - **License:** cc-by-nc-sa-4.0 - **Model Architecture:** RoBERTa - **Resources for more information:** - [RobeCzech: Czech RoBERTa, a Monolingual Contextualized Language Representation Model](https://doi.org/10.1007/978-3-030-83527-9_17) - [arXiv preprint is also available](https://arxiv.org/abs/2105.11314) # Uses ## Direct Use Fill-Mask tasks. ## Downstream Use Morphological tagging and lemmatization, dependency parsing, named entity recognition, and semantic parsing. # Bias, Risks, and Limitations Significant research has explored bias and fairness issues with language models (see, e.g., [Sheng et al. (2021)](https://aclanthology.org/2021.acl-long.330.pdf) and [Bender et al. (2021)](https://dl.acm.org/doi/pdf/10.1145/3442188.3445922)). Predictions generated by the model may include disturbing and harmful stereotypes across protected classes; identity characteristics; and sensitive, social, and occupational groups. ## Recommendations Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations. # Training Details ## Training Data The model creators note in the [associated paper](https://arxiv.org/pdf/2105.11314.pdf): > We trained RobeCzech on a collection of the following publicly available texts: > - SYN v4, a large corpus of contemporary written Czech, 4,188M tokens; > - Czes, a collection of Czech newspaper and magazine articles, 432M tokens; > - documents with at least 400 tokens from the Czech part of the web corpus.W2C , tokenized with MorphoDiTa, 16M tokens; > - plain texts extracted from Czech Wikipedia dump 20201020 using WikiEx-tractor, tokenized with MorphoDiTa, 123M tokens > All these corpora contain whole documents, even if the SYN v4 is > block-shuffled (blocks with at most 100 words respecting sentence boundaries > are permuted in a document) and in total contain 4,917M tokens. ## Training Procedure ### Preprocessing The texts are tokenized into subwords with a byte-level BPE (BBPE) tokenizer, which was trained on the entire corpus and we limit its vocabulary size to 52,000 items. ### Speeds, Sizes, Times The model creators note in the [associated paper](https://arxiv.org/pdf/2105.11314.pdf): > The training batch size is 8,192 and each training batch consists of sentences > sampled contiguously, even across document boundaries, such that the total > length of each sample is at most 512 tokens (FULL-SENTENCES setting). We use > Adam optimizer with β1 = 0.9 and β2 = 0.98 to minimize the masked > language-modeling objective. ### Software Used The [Fairseq](https://github.com/facebookresearch/fairseq/tree/main/examples/roberta) implementation was used for training. # Evaluation ## Testing Data, Factors & Metrics ### Testing Data The model creators note in the [associated paper](https://arxiv.org/pdf/2105.11314.pdf): > We evaluate RobeCzech in five NLP tasks, three of them leveraging frozen > contextualized word embeddings, two approached with fine-tuning: > - morphological analysis and lemmatization: frozen contextualized word embeddings, > - dependency parsing: frozen contextualized word embeddings, > - named entity recognition: frozen contextualized word embeddings, > - semantic parsing: fine-tuned, > - sentiment analysis: fine-tuned. ## Results | Model | Morphosynt PDT3.5 (POS) (LAS) | Morphosynt UD2.3 (XPOS) (LAS) | NER CNEC1.1 (nested) (flat) | Semant. PTG (Avg) (F1) | |-----------|---------------------------------|--------------------------------|------------------------------|-------------------------| | RobeCzech | 98.50 91.42 | 98.31 93.77 | 87.82 87.47 | 92.36 80.13 | # Environmental Impact - **Hardware Type:** 8 QUADRO P5000 GPU - **Hours used:** 2190 (~3 months) # Citation ``` @InProceedings{10.1007/978-3-030-83527-9_17, author={Straka, Milan and N{\'a}plava, Jakub and Strakov{\'a}, Jana and Samuel, David}, editor={Ek{\v{s}}tein, Kamil and P{\'a}rtl, Franti{\v{s}}ek and Konop{\'i}k, Miloslav}, title={{RobeCzech: Czech RoBERTa, a Monolingual Contextualized Language Representation Model}}, booktitle="Text, Speech, and Dialogue", year="2021", publisher="Springer International Publishing", address="Cham", pages="197--209", isbn="978-3-030-83527-9" } ``` # How to Get Started with the Model Use the code below to get started with the model. <details> <summary> Click to expand </summary> ```python from transformers import AutoTokenizer, AutoModelForMaskedLM tokenizer = AutoTokenizer.from_pretrained("ufal/robeczech-base") model = AutoModelForMaskedLM.from_pretrained("ufal/robeczech-base") ``` </details>

PereLluis13/wav2vec2-xls-r-1b-ca-lm

PereLluis13

transformers

automatic-speech-recognition

--- language: - ca license: apache-2.0 tags: - automatic-speech-recognition - collectivat/tv3_parla - generated_from_trainer - hf-asr-leaderboard - mozilla-foundation/common_voice_8_0 - projecte-aina/parlament_parla - robust-speech-event datasets: - mozilla-foundation/common_voice_8_0 - collectivat/tv3_parla - projecte-aina/parlament_parla model-index: - name: wav2vec2-xls-r-1b-ca-lm results: - task: name: Speech Recognition type: automatic-speech-recognition dataset: name: mozilla-foundation/common_voice_8_0 ca type: mozilla-foundation/common_voice_8_0 args: ca metrics: - name: Test WER type: wer value: 6.0722669958130644 - name: Test CER type: cer value: 1.9180697705166526 - task: name: Speech Recognition type: automatic-speech-recognition dataset: name: projecte-aina/parlament_parla ca type: projecte-aina/parlament_parla args: clean metrics: - name: Test WER type: wer value: 5.139820371024042 - name: Test CER type: cer value: 2.0163620128164722 - task: name: Speech Recognition type: automatic-speech-recognition dataset: name: collectivat/tv3_parla ca type: collectivat/tv3_parla args: ca metrics: - name: Test WER type: wer value: 11.207991684952073 - name: Test CER type: cer value: 7.32119307305963 - task: name: Speech Recognition type: automatic-speech-recognition dataset: name: Robust Speech Event - Catalan Dev Data type: speech-recognition-community-v2/dev_data args: ca metrics: - name: Test WER type: wer value: 22.870153690468661 - name: Test CER type: cer value: 13.59039190897598 - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: Robust Speech Event - Test Data type: speech-recognition-community-v2/eval_data args: ca metrics: - name: Test WER type: wer value: 15.41 --- # wav2vec2-xls-r-1b-ca-lm This model is a fine-tuned version of [facebook/wav2vec2-xls-r-300m](https://huggingface.co/facebook/wav2vec2-xls-r-300m) on the MOZILLA-FOUNDATION/COMMON_VOICE_8_0 - CA, the [tv3_parla](https://huggingface.co/datasets/collectivat/tv3_parla) and [parlament_parla](https://huggingface.co/datasets/projecte-aina/parlament_parla) datasets. ## Model description Please check the original [facebook/wav2vec2-xls-r-1b](https://huggingface.co/facebook/wav2vec2-xls-r-1b) Model card. This is just a finetuned version of that model. ## Intended uses & limitations As any model trained on crowdsourced data, this model can show the biases and particularities of the data and model used to train this model. Moreover, since this is a speech recognition model, it may underperform for some lower-resourced dialects for the catalan language. ## Training and evaluation data ## Training procedure The data is preprocessed to remove characters not on the catalan alphabet. Moreover, numbers are verbalized using code provided by [@ccoreilly](https://github.com/ccoreilly), which can be found on the text/ folder or [here](https://github.com/CollectivaT-dev/catotron-cpu/blob/master/text/numbers_ca.py). ### Training results Check the Tensorboard tab to check the training profile and evaluation results along training. The model was evaluated on the test splits for each of the datasets used during training. ### Training hyperparameters The following hyperparameters were used during training: - learning_rate: 2e-05 - train_batch_size: 8 - eval_batch_size: 8 - seed: 42 - gradient_accumulation_steps: 8 - total_train_batch_size: 64 - optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 - lr_scheduler_type: linear - lr_scheduler_warmup_steps: 2000 - num_epochs: 10.0 - mixed_precision_training: Native AMP ### Framework versions - Transformers 4.17.0.dev0 - Pytorch 1.10.2+cu102 - Datasets 1.18.3 - Tokenizers 0.11.0 # Thanks Want to thank both [@ccoreilly](https://github.com/ccoreilly) and [@gullabi](https://github.com/gullabi) who have contributed with their own resources and knowledge into making this model possible.

lmsys/vicuna-13b-v1.5-16k

lmsys

transformers

text-generation

--- inference: false license: llama2 --- # Vicuna Model Card ## Model Details Vicuna is a chat assistant trained by fine-tuning Llama 2 on user-shared conversations collected from ShareGPT. - **Developed by:** [LMSYS](https://lmsys.org/) - **Model type:** An auto-regressive language model based on the transformer architecture - **License:** Llama 2 Community License Agreement - **Finetuned from model:** [Llama 2](https://arxiv.org/abs/2307.09288) ### Model Sources - **Repository:** https://github.com/lm-sys/FastChat - **Blog:** https://lmsys.org/blog/2023-03-30-vicuna/ - **Paper:** https://arxiv.org/abs/2306.05685 - **Demo:** https://chat.lmsys.org/ ## Uses The primary use of Vicuna is research on large language models and chatbots. The primary intended users of the model are researchers and hobbyists in natural language processing, machine learning, and artificial intelligence. ## How to Get Started with the Model - Command line interface: https://github.com/lm-sys/FastChat#vicuna-weights - APIs (OpenAI API, Huggingface API): https://github.com/lm-sys/FastChat/tree/main#api ## Training Details Vicuna v1.5 (16k) is fine-tuned from Llama 2 with supervised instruction fine-tuning and linear RoPE scaling. The training data is around 125K conversations collected from ShareGPT.com. These conversations are packed into sequences that contain 16K tokens each. See more details in the "Training Details of Vicuna Models" section in the appendix of this [paper](https://arxiv.org/pdf/2306.05685.pdf). ## Evaluation  Vicuna is evaluated with standard benchmarks, human preference, and LLM-as-a-judge. See more details in this [paper](https://arxiv.org/pdf/2306.05685.pdf) and [leaderboard](https://huggingface.co/spaces/lmsys/chatbot-arena-leaderboard). ## Difference between different versions of Vicuna See [vicuna_weights_version.md](https://github.com/lm-sys/FastChat/blob/main/docs/vicuna_weights_version.md)

timm/swin_base_patch4_window7_224.ms_in22k_ft_in1k

timm

timm

image-classification

--- license: mit library_name: timm tags: - image-classification - timm datasets: - imagenet-1k - imagenet-22k --- # Model card for swin_base_patch4_window7_224.ms_in22k_ft_in1k A Swin Transformer image classification model. Pretrained on ImageNet-22k and fine-tuned on ImageNet-1k by paper authors. ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 87.8 - GMACs: 15.5 - Activations (M): 36.6 - Image size: 224 x 224 - **Papers:** - Swin Transformer: Hierarchical Vision Transformer using Shifted Windows: https://arxiv.org/abs/2103.14030 - **Original:** https://github.com/microsoft/Swin-Transformer - **Dataset:** ImageNet-1k - **Pretrain Dataset:** ImageNet-22k ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('swin_base_patch4_window7_224.ms_in22k_ft_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Feature Map Extraction ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'swin_base_patch4_window7_224.ms_in22k_ft_in1k', pretrained=True, features_only=True, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 for o in output: # print shape of each feature map in output # e.g. for swin_base_patch4_window7_224 (NHWC output) # torch.Size([1, 56, 56, 128]) # torch.Size([1, 28, 28, 256]) # torch.Size([1, 14, 14, 512]) # torch.Size([1, 7, 7, 1024]) # e.g. for swinv2_cr_small_ns_224 (NCHW output) # torch.Size([1, 96, 56, 56]) # torch.Size([1, 192, 28, 28]) # torch.Size([1, 384, 14, 14]) # torch.Size([1, 768, 7, 7]) print(o.shape) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'swin_base_patch4_window7_224.ms_in22k_ft_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled (ie.e a (batch_size, H, W, num_features) tensor for swin / swinv2 # or (batch_size, num_features, H, W) for swinv2_cr output = model.forward_head(output, pre_logits=True) # output is (batch_size, num_features) tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). ## Citation ```bibtex @inproceedings{liu2021Swin, title={Swin Transformer: Hierarchical Vision Transformer using Shifted Windows}, author={Liu, Ze and Lin, Yutong and Cao, Yue and Hu, Han and Wei, Yixuan and Zhang, Zheng and Lin, Stephen and Guo, Baining}, booktitle={Proceedings of the IEEE/CVF International Conference on Computer Vision (ICCV)}, year={2021} } ``` ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ```

NbAiLab/nb-wav2vec2-1b-bokmaal

NbAiLab

transformers

automatic-speech-recognition

--- license: apache-2.0 tags: - automatic-speech-recognition - NbAiLab/NPSC - no - nb - nb-NO datasets: - NbAiLab/NPSC language: - nb - no model-index: - name: nb-wav2vec2-1b-bokmaal results: - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: NPSC type: NbAiLab/NPSC args: 16K_mp3_bokmaal metrics: - name: Test (Bokmål) WER type: wer value: 0.0633 - name: Test (Bokmål) CER type: cer value: 0.0248 --- # Norwegian Wav2Vec2 Model - 1B Bokmål This model is finetuned on top of feature extractor [XLS-R](https://huggingface.co/facebook/wav2vec2-xls-r-1b) from Facebook/Meta. The finetuned model achieves the following results on the test set with a 5-gram KenLM. The numbers in parentheses are the results without the language model: - **WER: 0.0633** (0.0738) - **CER: 0.0248** (0.0263) ## Model description This is one of several Wav2Vec-models our team created during the 🤗 hosted [Robust Speech Event](https://discuss.huggingface.co/t/open-to-the-community-robust-speech-recognition-challenge/13614?s=09). This is the complete list of our models and their final scores: | Model | Final WER | | |:--------------|:------------|:------------:| | NbAiLab/nb-wav2vec2-1b-bokmaal (this model) | 6.33 | | | [NbAiLab/nb-wav2vec2-300m-bokmaal](https://huggingface.co/NbAiLab/nb-wav2vec2-300m-bokmaal) | 7.03 | | | [NbAiLab/nb-wav2vec2-1b-nynorsk](https://huggingface.co/NbAiLab/nb-wav2vec2-1b-nynorsk) | 11.32 | | | [NbAiLab/nb-wav2vec2-300m-nynorsk](https://huggingface.co/NbAiLab/nb-wav2vec2-300m-nynorsk) | 12.22 | | ## Dataset In parallel with the event, the team also converted the [Norwegian Parliamentary Speech Corpus (NPSC)](https://www.nb.no/sprakbanken/en/resource-catalogue/oai-nb-no-sbr-58/) to the [NbAiLab/NPSC](https://huggingface.co/datasets/NbAiLab/NPSC) in 🤗 Dataset format and used that as the main source for training. ## Code We have released all the code developed during the event so that the Norwegian NLP community can build upon it when developing even better Norwegian ASR models. The finetuning of these models is not very computationally demanding. After following the instructions here, you should be able to train your own automatic speech recognition system in less than a day with an average GPU. ## Team The following people contributed to building this model: Rolv-Arild Braaten, Per Egil Kummervold, Andre Kåsen, Javier de la Rosa, Per Erik Solberg, and Freddy Wetjen. ## Training procedure To reproduce these results, we strongly recommend that you follow the [instructions from 🤗](https://github.com/huggingface/transformers/tree/master/examples/research_projects/robust-speech-event#talks) to train a simple Swedish model. When you have verified that you are able to do this, create a fresh new repo. You can then start by copying the files ```run.sh``` and ```run_speech_recognition_ctc.py``` from our repo. Running these will create all the other necessary files, and should let you reproduce our results. With some tweaks to the hyperparameters, you might even be able to build an even better ASR. Good luck! ### Language Model As the scores indicate, adding even a simple 5-gram language will improve the results. 🤗 has provided another [very nice blog](https://huggingface.co/blog/wav2vec2-with-ngram) explaining how to add a 5-gram language model to improve the ASR model. You can build this from your own corpus, for instance by extracting some suitable text from the [Norwegian Colossal Corpus](https://huggingface.co/datasets/NbAiLab/NCC). You can also skip some of the steps in the guide, and copy the [5-gram model from this repo](https://huggingface.co/NbAiLab/XLSR-300M-bokmaal/tree/main/language_model). ### Parameters The final model was run using these parameters: ``` --dataset_name="NbAiLab/NPSC" --model_name_or_path="facebook/wav2vec2-xls-r-1b" --dataset_config_name="16K_mp3_bokmaal" --output_dir="./" --overwrite_output_dir --num_train_epochs="40" --per_device_train_batch_size="12" --per_device_eval_batch_size="12" --gradient_accumulation_steps="2" --learning_rate="2e-5" --warmup_steps="2000" --length_column_name="input_length" --evaluation_strategy="steps" --text_column_name="text" --save_steps="500" --eval_steps="500" --logging_steps="100" --layerdrop="0.041" --attention_dropout="0.094" --activation_dropout="0.055" --hidden_dropout="0.047" --save_total_limit="3" --freeze_feature_encoder --feat_proj_dropout="0.04" --mask_time_prob="0.082" --mask_time_length="10" --mask_feature_prob="0.25" --mask_feature_length="64" --gradient_checkpointing --min_duration_in_seconds="0.5" --max_duration_in_seconds="30.0" --ctc_zero_infinity=True --use_auth_token --seed="42" --fp16 --group_by_length --do_train --do_eval --push_to_hub --preprocessing_num_workers="16" ``` Using these settings, the training might take 3-4 days on an average GPU. You can, however, get a decent model and faster results by tweaking these parameters. | Parameter| Comment | |:-------------|:-----| | per_device_train_batch_size | Adjust this to the maximum of available memory. 16 or 24 might be good settings depending on your system | |gradient_accumulation_steps |Can be adjusted even further up to increase batch size and speed up training without running into memory issues | | learning_rate|Can be increased, maybe as high as 1e-4. Speeds up training but might add instability | | epochs| Can be decreased significantly. This is a huge dataset and you might get a decent result already after a couple of epochs| ## Citation ```bibtex @inproceedings{de-la-rosa-etal-2023-boosting, title = "Boosting {N}orwegian Automatic Speech Recognition", author = "De La Rosa, Javier and Braaten, Rolv-Arild and Kummervold, Per and Wetjen, Freddy", booktitle = "Proceedings of the 24th Nordic Conference on Computational Linguistics (NoDaLiDa)", month = may, year = "2023", address = "T{\'o}rshavn, Faroe Islands", publisher = "University of Tartu Library", url = "https://aclanthology.org/2023.nodalida-1.55", pages = "555--564", abstract = "In this paper, we present several baselines for automatic speech recognition (ASR) models for the two official written languages in Norway: Bokm{\aa}l and Nynorsk. We compare the performance of models of varying sizes and pre-training approaches on multiple Norwegian speech datasets. Additionally, we measure the performance of these models against previous state-of-the-art ASR models, as well as on out-of-domain datasets. We improve the state of the art on the Norwegian Parliamentary Speech Corpus (NPSC) from a word error rate (WER) of 17.10{\%} to 7.60{\%}, with models achieving 5.81{\%} for Bokm{\aa}l and 11.54{\%} for Nynorsk. We also discuss the challenges and potential solutions for further improving ASR models for Norwegian.", } ``` See https://arxiv.org/abs/2307.01672

dangvantuan/vietnamese-embedding

dangvantuan

sentence-transformers

sentence-similarity

--- library_name: sentence-transformers pipeline_tag: sentence-similarity tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers - phobert - vietnamese - sentence-embedding license: apache-2.0 language: - vi metrics: - pearsonr - spearmanr --- ## Model Description: [**vietnamese-embedding**](https://huggingface.co/dangvantuan/vietnamese-embedding) is the Embedding Model for Vietnamese language. This model is a specialized sentence-embedding trained specifically for the Vietnamese language, leveraging the robust capabilities of PhoBERT, a pre-trained language model based on the RoBERTa architecture. The model utilizes PhoBERT to encode Vietnamese sentences into a 768-dimensional vector space, facilitating a wide range of applications from semantic search to text clustering. The embeddings capture the nuanced meanings of Vietnamese sentences, reflecting both the lexical and contextual layers of the language. ## Full Model Architecture ``` SentenceTransformer( (0): Transformer({'max_seq_length': 512, 'do_lower_case': False}) with Transformer model: RobertaModel (1): Pooling({'word_embedding_dimension': 768, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False, 'pooling_mode_weightedmean_tokens': False, 'pooling_mode_lasttoken': False, 'include_prompt': True}) ) ``` ## Training and Fine-tuning process The model underwent a rigorous four-stage training and fine-tuning process, each tailored to enhance its ability to generate precise and contextually relevant sentence embeddings for the Vietnamese language. Below is an outline of these stages: #### Stage 1: Initial Training - Dataset: [ViNLI-SimCSE-supervised](https://huggingface.co/datasets/anti-ai/ViNLI-SimCSE-supervised) - Method: Trained using the [SimCSE approach](https://arxiv.org/abs/2104.08821) which employs a supervised contrastive learning framework. The model was optimized using [Triplet Loss](https://www.sbert.net/docs/package_reference/losses.html#tripletloss) to effectively learn from high-quality annotated sentence pairs. #### Stage 2: Continued Fine-tuning - Dataset: [XNLI-vn ](https://huggingface.co/datasets/xnli/viewer/vi) - Method: Continued fine-tuning using Multi-Negative Ranking Loss. This stage focused on improving the model's ability to discern and rank nuanced differences in sentence semantics. ### Stage 3: Continued Fine-tuning for Semantic Textual Similarity on STS Benchmark - Dataset: [STSB-vn](https://huggingface.co/datasets/doanhieung/vi-stsbenchmark) - Method: Fine-tuning specifically for the semantic textual similarity benchmark using Siamese BERT-Networks configured with the 'sentence-transformers' library. This stage honed the model's precision in capturing semantic similarity across various types of Vietnamese texts. ### Stage 4: Advanced Augmentation Fine-tuning - Dataset: STSB-vn with generate [silver sample from gold sample](https://www.sbert.net/examples/training/data_augmentation/README.html) - Method: Employed an advanced strategy using [Augmented SBERT](https://arxiv.org/abs/2010.08240) with Pair Sampling Strategies, integrating both Cross-Encoder and Bi-Encoder models. This stage further refined the embeddings by enriching the training data dynamically, enhancing the model's robustness and accuracy in understanding and processing complex Vietnamese language constructs. ## Usage: Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers pip install -q pyvi ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer from pyvi.ViTokenizer import tokenize sentences = ["Hà Nội là thủ đô của Việt Nam", "Đà Nẵng là thành phố du lịch"] tokenizer_sent = [tokenize(sent) for sent in sentences] model = SentenceTransformer('dangvantuan/vietnamese-embedding') embeddings = model.encode(tokenizer_sent) print(embeddings) ``` ## Evaluation The model can be evaluated as follows on the [Vienamese data of stsb](https://huggingface.co/datasets/doanhieung/vi-stsbenchmark). ```python from sentence_transformers import SentenceTransformer from sentence_transformers import SentenceTransformer from sentence_transformers.readers import InputExample from datasets import load_dataset from pyvi.ViTokenizer import tokenize def convert_dataset(dataset): dataset_samples=[] for df in dataset: score = float(df['score'])/5.0 # Normalize score to range 0 ... 1 inp_example = InputExample(texts=[tokenize(df['sentence1']), tokenize(df['sentence2'])], label=score) dataset_samples.append(inp_example) return dataset_samples # Loading the dataset for evaluation vi_sts = load_dataset("doanhieung/vi-stsbenchmark")["train"] df_dev = vi_sts.filter(lambda example: example['split'] == 'dev') df_test = vi_sts.filter(lambda example: example['split'] == 'test') # Convert the dataset for evaluation # For Dev set: dev_samples = convert_dataset(df_dev) val_evaluator = EmbeddingSimilarityEvaluator.from_input_examples(dev_samples, name='sts-dev') val_evaluator(model, output_path="./") # For Test set: test_samples = convert_dataset(df_test) test_evaluator = EmbeddingSimilarityEvaluator.from_input_examples(test_samples, name='sts-test') test_evaluator(model, output_path="./") ``` ### Test Result: The performance is measured using Pearson and Spearman correlation: - On dev | Model | Pearson correlation | Spearman correlation | #params | | ------------- | ------------- | ------------- |------------- | | [dangvantuan/vietnamese-embedding](dangvantuan/vietnamese-embedding)| 88.33 |88.20 | 135M| | [VoVanPhuc/sup-SimCSE-VietNamese-phobert-base](https://huggingface.co/VoVanPhuc/sup-SimCSE-VietNamese-phobert-base) | 84.65|84.59 | 135M | | [keepitreal/vietnamese-sbert](https://huggingface.co/keepitreal/vietnamese-sbert) | 84.51 | 84.44|135M | | [bkai-foundation-models/vietnamese-bi-encoder](https://huggingface.co/bkai-foundation-models/vietnamese-bi-encoder) | 78.05 | 77.94|135M | ### Metric for all dataset of [Semantic Textual Similarity on STS Benchmark](https://huggingface.co/datasets/anti-ai/ViSTS) You can run an evaluation on this [Colab](https://colab.research.google.com/drive/1JZLWKiknSUnA92UY2RIhvS65WtP6sgqW?hl=fr#scrollTo=IkTAwPqxDTOK) **Pearson score** | Model | [STSB] | [STS12]| [STS13] | [STS14] | [STS15] | [STS16] | [SICK] | Mean | |-----------------------------------------------------------|---------|----------|----------|----------|----------|----------|---------|--------| | [dangvantuan/vietnamese-embedding](dangvantuan/vietnamese-embedding) |**84.87** |**87.23**| **85.39**| **82.94**| **86.91**| **79.39**| **82.77**| **84.21**| | [VoVanPhuc/sup-SimCSE-VietNamese-phobert-base](https://huggingface.co/VoVanPhuc/sup-SimCSE-VietNamese-phobert-base) |81.52| 85.02| 78.22| 75.94| 81.53| 75.39| 77.75| 79.33| | [keepitreal/vietnamese-sbert](https://huggingface.co/keepitreal/vietnamese-sbert) |80.54| 78.58| 80.75| 76.98| 82.57| 73.21| 80.16| 78.97| | [bkai-foundation-models/vietnamese-bi-encoder](https://huggingface.co/bkai-foundation-models/vietnamese-bi-encoder) |73.30| 67.84| 71.69| 69.80| 78.40| 74.29| 76.01| 73.04| **Spearman score** | Model | [STSB] | [STS12]| [STS13] | [STS14] | [STS15] | [STS16] | [SICK] | Mean | |-----------------------------------------------------------|---------|----------|----------|----------|----------|----------|---------|--------| | [dangvantuan/vietnamese-embedding](dangvantuan/vietnamese-embedding) |**84.84**| **79.04**| **85.30**| **81.38**| **87.06**| **79.95**| **79.58**| **82.45**| | [VoVanPhuc/sup-SimCSE-VietNamese-phobert-base](https://huggingface.co/VoVanPhuc/sup-SimCSE-VietNamese-phobert-base) |81.43| 76.51| 79.19| 74.91| 81.72| 76.57| 76.45| 78.11| | [keepitreal/vietnamese-sbert](https://huggingface.co/keepitreal/vietnamese-sbert) |80.16| 69.08| 80.99| 73.67| 82.81| 74.30| 73.40| 76.34| | [bkai-foundation-models/vietnamese-bi-encoder](https://huggingface.co/bkai-foundation-models/vietnamese-bi-encoder) |72.16| 63.86| 71.82| 66.20| 78.62| 74.24| 70.87| 71.11| ## Citation @article{reimers2019sentence, title={Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks}, author={Nils Reimers, Iryna Gurevych}, journal={https://arxiv.org/abs/1908.10084}, year={2019} } @article{martin2020camembert, title={CamemBERT: a Tasty French Language Mode}, author={Martin, Louis and Muller, Benjamin and Su{\'a}rez, Pedro Javier Ortiz and Dupont, Yoann and Romary, Laurent and de la Clergerie, {\'E}ric Villemonte and Seddah, Djam{\'e} and Sagot, Beno{\^\i}t}, journal={Proceedings of the 58th Annual Meeting of the Association for Computational Linguistics}, year={2020} } @article{thakur2020augmented, title={Augmented SBERT: Data Augmentation Method for Improving Bi-Encoders for Pairwise Sentence Scoring Tasks}, author={Thakur, Nandan and Reimers, Nils and Daxenberger, Johannes and Gurevych, Iryna}, journal={arXiv e-prints}, pages={arXiv--2010}, year={2020}

krnl/realisticVisionV51_v51VAE

krnl

diffusers

text-to-image

Entry not found

unsloth/Phi-3-mini-4k-instruct-bnb-4bit

unsloth

transformers

text-generation

--- language: - en license: mit library_name: transformers tags: - unsloth - phi3 - transformers - phi --- # Finetune Mistral, Gemma, Llama 2-5x faster with 70% less memory via Unsloth! Directly quantized 4bit model with `bitsandbytes`. We have a Google Colab Tesla T4 notebook for Phi-3 Medium here: https://colab.research.google.com/drive/1hhdhBa1j_hsymiW9m-WzxQtgqTH_NHqi?usp=sharing We have a Google Colab Tesla T4 notebook for Phi-3 Mini here: https://colab.research.google.com/drive/1lN6hPQveB_mHSnTOYifygFcrO8C1bxq4?usp=sharing [<img src="https://raw.githubusercontent.com/unslothai/unsloth/main/images/Discord%20button.png" width="200"/>](https://discord.gg/u54VK8m8tk) [<img src="https://raw.githubusercontent.com/unslothai/unsloth/main/images/buy%20me%20a%20coffee%20button.png" width="200"/>](https://ko-fi.com/unsloth) [<img src="https://raw.githubusercontent.com/unslothai/unsloth/main/images/unsloth%20made%20with%20love.png" width="200"/>](https://github.com/unslothai/unsloth) ## ✨ Finetune for Free All notebooks are **beginner friendly**! Add your dataset, click "Run All", and you'll get a 2x faster finetuned model which can be exported to GGUF, vLLM or uploaded to Hugging Face. | Unsloth supports | Free Notebooks | Performance | Memory use | |-----------------|--------------------------------------------------------------------------------------------------------------------------|-------------|----------| | **Llama-3 8b** | [▶️ Start on Colab](https://colab.research.google.com/drive/135ced7oHytdxu3N2DNe1Z0kqjyYIkDXp?usp=sharing) | 2.4x faster | 58% less | | **Gemma 7b** | [▶️ Start on Colab](https://colab.research.google.com/drive/10NbwlsRChbma1v55m8LAPYG15uQv6HLo?usp=sharing) | 2.4x faster | 58% less | | **Mistral 7b** | [▶️ Start on Colab](https://colab.research.google.com/drive/1Dyauq4kTZoLewQ1cApceUQVNcnnNTzg_?usp=sharing) | 2.2x faster | 62% less | | **Llama-2 7b** | [▶️ Start on Colab](https://colab.research.google.com/drive/1lBzz5KeZJKXjvivbYvmGarix9Ao6Wxe5?usp=sharing) | 2.2x faster | 43% less | | **TinyLlama** | [▶️ Start on Colab](https://colab.research.google.com/drive/1AZghoNBQaMDgWJpi4RbffGM1h6raLUj9?usp=sharing) | 3.9x faster | 74% less | | **CodeLlama 34b** A100 | [▶️ Start on Colab](https://colab.research.google.com/drive/1y7A0AxE3y8gdj4AVkl2aZX47Xu3P1wJT?usp=sharing) | 1.9x faster | 27% less | | **Mistral 7b** 1xT4 | [▶️ Start on Kaggle](https://www.kaggle.com/code/danielhanchen/kaggle-mistral-7b-unsloth-notebook) | 5x faster\* | 62% less | | **DPO - Zephyr** | [▶️ Start on Colab](https://colab.research.google.com/drive/15vttTpzzVXv_tJwEk-hIcQ0S9FcEWvwP?usp=sharing) | 1.9x faster | 19% less | - This [conversational notebook](https://colab.research.google.com/drive/1Aau3lgPzeZKQ-98h69CCu1UJcvIBLmy2?usp=sharing) is useful for ShareGPT ChatML / Vicuna templates. - This [text completion notebook](https://colab.research.google.com/drive/1ef-tab5bhkvWmBOObepl1WgJvfvSzn5Q?usp=sharing) is for raw text. This [DPO notebook](https://colab.research.google.com/drive/15vttTpzzVXv_tJwEk-hIcQ0S9FcEWvwP?usp=sharing) replicates Zephyr. - \* Kaggle has 2x T4s, but we use 1. Due to overhead, 1x T4 is 5x faster.

huggingface/autoformer-tourism-monthly

huggingface

transformers

--- license: apache-2.0 datasets: - monash_tsf --- # Autoformer ## Overview The Autoformer model was proposed in [Autoformer: Decomposition Transformers with Auto-Correlation for Long-Term Series Forecasting](https://arxiv.org/abs/2106.13008) by Haixu Wu, Jiehui Xu, Jianmin Wang and Mingsheng Long. The abstract from the paper is the following: *Extending the forecasting time is a critical demand for real applications, such as extreme weather early warning and long-term energy consumption planning. This paper studies the long-term forecasting problem of time series. Prior Transformer-based models adopt various self-attention mechanisms to discover the long-range dependencies. However, intricate temporal patterns of the long-term future prohibit the model from finding reliable dependencies. Also, Transformers have to adopt the sparse versions of point-wise self-attentions for long series efficiency, resulting in the information utilization bottleneck. Going beyond Transformers, we design Autoformer as a novel decomposition architecture with an Auto-Correlation mechanism. We break with the pre-processing convention of series decomposition and renovate it as a basic inner block of deep models. This design empowers Autoformer with progressive decomposition capacities for complex time series. Further, inspired by the stochastic process theory, we design the Auto-Correlation mechanism based on the series periodicity, which conducts the dependencies discovery and representation aggregation at the sub-series level. Auto-Correlation outperforms self-attention in both efficiency and accuracy. In long-term forecasting, Autoformer yields state-of-the-art accuracy, with a 38% relative improvement on six benchmarks, covering five practical applications: energy, traffic, economics, weather and disease.*

Habana/gpt2

Habana

--- license: apache-2.0 --- [Optimum Habana](https://github.com/huggingface/optimum-habana) is the interface between the Hugging Face Transformers and Diffusers libraries and Habana's Gaudi processor (HPU). It provides a set of tools enabling easy and fast model loading, training and inference on single- and multi-HPU settings for different downstream tasks. Learn more about how to take advantage of the power of Habana HPUs to train and deploy Transformers and Diffusers models at [hf.co/hardware/habana](https://huggingface.co/hardware/habana). ## GPT2 model HPU configuration This model only contains the `GaudiConfig` file for running the [GPT2](https://huggingface.co/gpt2) model on Habana's Gaudi processors (HPU). **This model contains no model weights, only a GaudiConfig.** This enables to specify: - `use_fused_adam`: whether to use Habana's custom AdamW implementation - `use_fused_clip_norm`: whether to use Habana's fused gradient norm clipping operator - `use_torch_autocast`: whether to use PyTorch's autocast mixed precision ## Usage The model is instantiated the same way as in the Transformers library. The only difference is that there are a few new training arguments specific to HPUs. [Here](https://github.com/huggingface/optimum-habana/blob/main/examples/language-modeling/run_clm.py) is a causal language modeling example script to pre-train/fine-tune a model. You can run it with GPT2 with the following command: ```bash python run_clm.py \ --model_name_or_path gpt2 \ --dataset_name wikitext \ --dataset_config_name wikitext-2-raw-v1 \ --per_device_train_batch_size 4 \ --per_device_eval_batch_size 4 \ --do_train \ --do_eval \ --output_dir /tmp/test-clm \ --gaudi_config_name Habana/gpt2 \ --use_habana \ --use_lazy_mode \ --throughput_warmup_steps 2 ``` Check the [documentation](https://huggingface.co/docs/optimum/habana/index) out for more advanced usage and examples.

lemon2431/toonify_v20

lemon2431

diffusers

text-to-image

Entry not found

bhadresh-savani/bert-base-uncased-emotion

bhadresh-savani

transformers

text-classification

--- language: - en license: apache-2.0 tags: - text-classification - emotion - pytorch datasets: - emotion metrics: - Accuracy, F1 Score thumbnail: https://avatars3.githubusercontent.com/u/32437151?s=460&u=4ec59abc8d21d5feea3dab323d23a5860e6996a4&v=4 model-index: - name: bhadresh-savani/bert-base-uncased-emotion results: - task: type: text-classification name: Text Classification dataset: name: emotion type: emotion config: default split: test metrics: - type: accuracy value: 0.9265 name: Accuracy verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMWQzNzA2MTFkY2RkNDMxYTFhOGUzMTdiZTgwODA3ODdmZTVhNTVjOTAwMGM5NjU1OGY0MjMzZWU0OTU2MzY1YiIsInZlcnNpb24iOjF9.f6iWK0iyU8_g32W2oMfh1ChevMsl0StI402cB6DNzJCYj9xywTnFltBY36jAJFDRK41HXdMnPMl64Bynr-Q9CA - type: precision value: 0.8859601677706858 name: Precision Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNTc2ZjRmMzYzNTE0ZDQ1ZDdkYWViYWNhZDhkOTE2ZDhmMDFjZmZiZjRkZWVlMzQ3MWE4NDNlYzlmM2I4ZGM2OCIsInZlcnNpb24iOjF9.jR-gFrrBIAfiYV352RDhK3nzgqIgNCPd55OhIcCfVdVAWHQSZSJXhFyg8yChC7DwoVmUQy1Ya-d8Hflp7Wi-AQ - type: precision value: 0.9265 name: Precision Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMDAyMWZjZTM5NWNjNTcyMWQzMWQyNDcyN2RlZTQyZTM4ZDQ4Y2FlNzM2OTZkMzM3YzI4YTAwNzg4MGNjZmZjZCIsInZlcnNpb24iOjF9.cmkuDmhhETKIKAL81K28oiO889sZ0hvEpZ6Ep7dW_KB9VOTFs15BzFY9vwcpdXQDugWBbB2g7r3FUgRLwIEpAg - type: precision value: 0.9265082039990273 name: Precision Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiMTA2NzY2NTJmZTExZWM3OGIzYzg3ZDM3Y2I5MTU3Mjg3Y2NmZGEyMjFmNjExZWM3ZDFjNzdhOTZkNTYwYWQxYyIsInZlcnNpb24iOjF9.DJgeA6ZovHoxgCqhzilIzafet8uN3-Xbx1ZYcEEc4jXzFbRtErE__QHGaaSaUQEzPp4BAztp1ageOaBoEmXSDg - type: recall value: 0.879224648382427 name: Recall Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiZGU3MmQ1Yjg5OGJlYTE1NWJmNGVjY2ExMDZiZjVjYmVkOGYxYWFkOTVlMDVjOWVhZGFjOGFkYzcwMGIyMTAyZCIsInZlcnNpb24iOjF9.jwgaNEBSQENlx3vojBi1WKJOQ7pSuP4Iyw4kKPsq9IUaW-Ah8KdgPV9Nm2DY1cwEtMayvVeIVmQ3Wo8PORDRAg - type: recall value: 0.9265 name: Recall Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNDE3OWQ0ZGZjNzAxY2I0NGMxNDU0OWE1OGM2N2Q3OTUwYWI0NmZjMDQ3MDc0NDA4YTc2NDViM2Y0ZTMyMjYyZCIsInZlcnNpb24iOjF9.Ihc61PSO3K63t5hUSAve4Gt1tC8R_ZruZo492dTD9CsKOF10LkvrCskJJaOATjFJgqb3FFiJ8-nDL9Pa3HF-Dg - type: recall value: 0.9265 name: Recall Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNzJkYTg5YjA0YTBlNDY3ZjFjZWIzOWVhYjI4Y2YxM2FhMmUwMDZlZTE0NTIzNjMxMjE3NzgwNGFjYTkzOWM1YyIsInZlcnNpb24iOjF9.LlBX4xTjKuTX0NPK0jYzYDXRVnUEoUKVwIHfw5xUzaFgtF4wuqaYV7F0VKoOd3JZxzxNgf7JzeLof0qTquE9Cw - type: f1 value: 0.8821398657055098 name: F1 Macro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiNTE4OThiMmE0NDEzZjBkY2RmZWNjMGI3YWNmNTFjNTY5NjIwNjFkZjk1ZjIxMjI4M2ZiZGJhYzJmNzVhZTU1NSIsInZlcnNpb24iOjF9.gzYyUbO4ycvP1RXnrKKZH3E8ym0DjwwUFf4Vk9j0wrg2sWIchjmuloZz0SLryGqwHiAV8iKcSBWWy61Q480XAw - type: f1 value: 0.9265 name: F1 Micro verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiZGM2Y2E0NjMyNmJhMTE4NjYyMjI2MTJlZjUzNmRmY2U3Yjk3ZGUyYzU2OWYzMWM2ZjY4ZTg0OTliOTY3YmI2MSIsInZlcnNpb24iOjF9.hEz_yExs6LV0RBpFBoUbnAQZHitxN57HodCJpDx0yyW6dQwWaza0JxdO-kBf8JVBK8JyISkNgOYskBY5LD4ZDQ - type: f1 value: 0.9262425173620311 name: F1 Weighted verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiZmMyY2NhNTRhOGMwM2M5OTQxNDQ0NjRkZDdiMDExMWFkMmI4MmYwZGQ1OGRiYmRjMmE2YTc0MGZmMWMwN2Q4MSIsInZlcnNpb24iOjF9.ljbb2L4R08NCGjcfuX1878HRilJ_p9qcDJpWhsu-5EqWCco80e9krb7VvIJV0zBfmi7Z3C2qGGRsfsAIhtQ5Dw - type: loss value: 0.17315374314785004 name: loss verified: true verifyToken: eyJhbGciOiJFZERTQSIsInR5cCI6IkpXVCJ9.eyJoYXNoIjoiZmQwN2I2Nzg4OWU1ODE5NTBhMTZiMjljMjJhN2JiYmY0MTkzMTA1NmVhMGU0Y2Y0NjgyOTU3ZjgyYTc3ODE5NCIsInZlcnNpb24iOjF9.EEp3Gxm58ab-9335UGQEk-3dFQcMRgJgViI7fpz7mfY2r5Pg-AOel5w4SMzmBM-hiUFwStgxe5he_kG2yPGFCw --- # bert-base-uncased-emotion ## Model description: [Bert](https://arxiv.org/abs/1810.04805) is a Transformer Bidirectional Encoder based Architecture trained on MLM(Mask Language Modeling) objective [bert-base-uncased](https://huggingface.co/bert-base-uncased) finetuned on the emotion dataset using HuggingFace Trainer with below training parameters ``` learning rate 2e-5, batch size 64, num_train_epochs=8, ``` ## Model Performance Comparision on Emotion Dataset from Twitter: | Model | Accuracy | F1 Score | Test Sample per Second | | --- | --- | --- | --- | | [Distilbert-base-uncased-emotion](https://huggingface.co/bhadresh-savani/distilbert-base-uncased-emotion) | 93.8 | 93.79 | 398.69 | | [Bert-base-uncased-emotion](https://huggingface.co/bhadresh-savani/bert-base-uncased-emotion) | 94.05 | 94.06 | 190.152 | | [Roberta-base-emotion](https://huggingface.co/bhadresh-savani/roberta-base-emotion) | 93.95 | 93.97| 195.639 | | [Albert-base-v2-emotion](https://huggingface.co/bhadresh-savani/albert-base-v2-emotion) | 93.6 | 93.65 | 182.794 | ## How to Use the model: ```python from transformers import pipeline classifier = pipeline("text-classification",model='bhadresh-savani/bert-base-uncased-emotion', return_all_scores=True) prediction = classifier("I love using transformers. The best part is wide range of support and its easy to use", ) print(prediction) """ output: [[ {'label': 'sadness', 'score': 0.0005138228880241513}, {'label': 'joy', 'score': 0.9972520470619202}, {'label': 'love', 'score': 0.0007443308713845909}, {'label': 'anger', 'score': 0.0007404946954920888}, {'label': 'fear', 'score': 0.00032938539516180754}, {'label': 'surprise', 'score': 0.0004197491507511586} ]] """ ``` ## Dataset: [Twitter-Sentiment-Analysis](https://huggingface.co/nlp/viewer/?dataset=emotion). ## Training procedure [Colab Notebook](https://github.com/bhadreshpsavani/ExploringSentimentalAnalysis/blob/main/SentimentalAnalysisWithDistilbert.ipynb) follow the above notebook by changing the model name from distilbert to bert ## Eval results ```json { 'test_accuracy': 0.9405, 'test_f1': 0.9405920712282673, 'test_loss': 0.15769127011299133, 'test_runtime': 10.5179, 'test_samples_per_second': 190.152, 'test_steps_per_second': 3.042 } ``` ## Reference: * [Natural Language Processing with Transformer By Lewis Tunstall, Leandro von Werra, Thomas Wolf](https://learning.oreilly.com/library/view/natural-language-processing/9781098103231/)

mradermacher/Yi-34B-200K-Llamafied-i1-GGUF

mradermacher

transformers

--- base_model: larryvrh/Yi-34B-200K-Llamafied language: - zh - en library_name: transformers license: apache-2.0 quantized_by: mradermacher --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: nicoboss --> weighted/imatrix quants of https://huggingface.co/larryvrh/Yi-34B-200K-Llamafied <!-- provided-files --> static quants are available at https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-IQ1_S.gguf) | i1-IQ1_S | 7.6 | for the desperate | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-IQ1_M.gguf) | i1-IQ1_M | 8.3 | mostly desperate | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-IQ2_XXS.gguf) | i1-IQ2_XXS | 9.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-IQ2_XS.gguf) | i1-IQ2_XS | 10.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-IQ2_S.gguf) | i1-IQ2_S | 11.0 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-IQ2_M.gguf) | i1-IQ2_M | 11.9 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-Q2_K.gguf) | i1-Q2_K | 12.9 | IQ3_XXS probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-IQ3_XXS.gguf) | i1-IQ3_XXS | 13.4 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-IQ3_XS.gguf) | i1-IQ3_XS | 14.3 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-Q3_K_S.gguf) | i1-Q3_K_S | 15.1 | IQ3_XS probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-IQ3_S.gguf) | i1-IQ3_S | 15.1 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-IQ3_M.gguf) | i1-IQ3_M | 15.7 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-Q3_K_M.gguf) | i1-Q3_K_M | 16.8 | IQ3_S probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-Q3_K_L.gguf) | i1-Q3_K_L | 18.2 | IQ3_M probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-IQ4_XS.gguf) | i1-IQ4_XS | 18.6 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-Q4_0.gguf) | i1-Q4_0 | 19.6 | fast, low quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-Q4_K_S.gguf) | i1-Q4_K_S | 19.7 | optimal size/speed/quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-Q4_K_M.gguf) | i1-Q4_K_M | 20.8 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-Q5_K_S.gguf) | i1-Q5_K_S | 23.8 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-Q5_K_M.gguf) | i1-Q5_K_M | 24.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF/resolve/main/Yi-34B-200K-Llamafied.i1-Q6_K.gguf) | i1-Q6_K | 28.3 | practically like static Q6_K | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. Additional thanks to [@nicoboss](https://huggingface.co/nicoboss) for giving me access to his hardware for calculating the imatrix for these quants. <!-- end -->

elyza/ELYZA-japanese-Llama-2-7b-instruct

elyza

transformers

text-generation

--- license: llama2 language: - ja - en --- ## ELYZA-japanese-Llama-2-7b  ### Model Description **ELYZA-japanese-Llama-2-7b** は、 Llama2をベースとして日本語能力を拡張するために追加事前学習を行ったモデルです。 詳細は [Blog記事](https://note.com/elyza/n/na405acaca130) を参照してください。 ### Usage ```python import torch from transformers import AutoModelForCausalLM, AutoTokenizer B_INST, E_INST = "[INST]", "[/INST]" B_SYS, E_SYS = "<<SYS>>\n", "\n<</SYS>>\n\n" DEFAULT_SYSTEM_PROMPT = "あなたは誠実で優秀な日本人のアシスタントです。" text = "クマが海辺に行ってアザラシと友達になり、最終的には家に帰るというプロットの短編小説を書いてください。" model_name = "elyza/ELYZA-japanese-Llama-2-7b-instruct" tokenizer = AutoTokenizer.from_pretrained(model_name) model = AutoModelForCausalLM.from_pretrained(model_name, torch_dtype="auto") if torch.cuda.is_available(): model = model.to("cuda") prompt = "{bos_token}{b_inst} {system}{prompt} {e_inst} ".format( bos_token=tokenizer.bos_token, b_inst=B_INST, system=f"{B_SYS}{DEFAULT_SYSTEM_PROMPT}{E_SYS}", prompt=text, e_inst=E_INST, ) with torch.no_grad(): token_ids = tokenizer.encode(prompt, add_special_tokens=False, return_tensors="pt") output_ids = model.generate( token_ids.to(model.device), max_new_tokens=256, pad_token_id=tokenizer.pad_token_id, eos_token_id=tokenizer.eos_token_id, ) output = tokenizer.decode(output_ids.tolist()[0][token_ids.size(1) :], skip_special_tokens=True) print(output) """ 承知しました。以下にクマが海辺に行ってアザラシと友達になり、最終的には家に帰るというプロットの短編小説を記述します。 クマは山の中でゆっくりと眠っていた。 その眠りに落ちたクマは、夢の中で海辺を歩いていた。 そこにはアザラシがいた。 クマはアザラシに話しかける。 「おはよう」とクマが言うと、アザラシは驚いたように顔を上げた。 「あ、こんにちは」アザラシは答えた。 クマはアザラシと友達になりたいと思う。 「私はクマと申します。」クマは... """ ``` ### ELYZA-japanese-Llama-2-7b Models | Model Name | Vocab Size | #Params | |:---------------------------------------------|:----------:|:-------:| |[elyza/ELYZA-japanese-Llama-2-7b](https://huggingface.co/elyza/ELYZA-japanese-Llama-2-7b)| 32000 | 6.27B | |[elyza/ELYZA-japanese-Llama-2-7b-instruct](https://huggingface.co/elyza/ELYZA-japanese-Llama-2-7b-instruct)| 32000 | 6.27B | |[elyza/ELYZA-japanese-Llama-2-7b-fast](https://huggingface.co/elyza/ELYZA-japanese-Llama-2-7b-fast)| 45043 | 6.37B | |[elyza/ELYZA-japanese-Llama-2-7b-fast-instruct](https://huggingface.co/elyza/ELYZA-japanese-Llama-2-7b-fast-instruct)| 45043 | 6.37B | ### Developers 以下アルファベット順 - [Akira Sasaki](https://huggingface.co/akirasasaki) - [Masato Hirakawa](https://huggingface.co/m-hirakawa) - [Shintaro Horie](https://huggingface.co/e-mon) - [Tomoaki Nakamura](https://huggingface.co/tyoyo) ### Licence Llama 2 is licensed under the LLAMA 2 Community License, Copyright (c) Meta Platforms, Inc. All Rights Reserved. ### How to Cite ```tex @misc{elyzallama2023, title={ELYZA-japanese-Llama-2-7b}, url={https://huggingface.co/elyza/ELYZA-japanese-Llama-2-7b}, author={Akira Sasaki and Masato Hirakawa and Shintaro Horie and Tomoaki Nakamura}, year={2023}, } ``` ### Citations ```tex @misc{touvron2023llama, title={Llama 2: Open Foundation and Fine-Tuned Chat Models}, author={Hugo Touvron and Louis Martin and Kevin Stone and Peter Albert and Amjad Almahairi and Yasmine Babaei and Nikolay Bashlykov and Soumya Batra and Prajjwal Bhargava and Shruti Bhosale and Dan Bikel and Lukas Blecher and Cristian Canton Ferrer and Moya Chen and Guillem Cucurull and David Esiobu and Jude Fernandes and Jeremy Fu and Wenyin Fu and Brian Fuller and Cynthia Gao and Vedanuj Goswami and Naman Goyal and Anthony Hartshorn and Saghar Hosseini and Rui Hou and Hakan Inan and Marcin Kardas and Viktor Kerkez and Madian Khabsa and Isabel Kloumann and Artem Korenev and Punit Singh Koura and Marie-Anne Lachaux and Thibaut Lavril and Jenya Lee and Diana Liskovich and Yinghai Lu and Yuning Mao and Xavier Martinet and Todor Mihaylov and Pushkar Mishra and Igor Molybog and Yixin Nie and Andrew Poulton and Jeremy Reizenstein and Rashi Rungta and Kalyan Saladi and Alan Schelten and Ruan Silva and Eric Michael Smith and Ranjan Subramanian and Xiaoqing Ellen Tan and Binh Tang and Ross Taylor and Adina Williams and Jian Xiang Kuan and Puxin Xu and Zheng Yan and Iliyan Zarov and Yuchen Zhang and Angela Fan and Melanie Kambadur and Sharan Narang and Aurelien Rodriguez and Robert Stojnic and Sergey Edunov and Thomas Scialom}, year={2023}, eprint={2307.09288}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

VoVanPhuc/sup-SimCSE-VietNamese-phobert-base

VoVanPhuc

transformers

sentence-similarity

--- language: - vi pipeline_tag: sentence-similarity --- #### Table of contents 1. [Introduction](#introduction) 2. [Pretrain model](#models) 3. [Using SimeCSE_Vietnamese with `sentences-transformers`](#sentences-transformers) - [Installation](#install1) - [Example usage](#usage1) 4. [Using SimeCSE_Vietnamese with `transformers`](#transformers) - [Installation](#install2) - [Example usage](#usage2) # <a name="introduction"></a> SimeCSE_Vietnamese: Simple Contrastive Learning of Sentence Embeddings with Vietnamese Pre-trained SimeCSE_Vietnamese models are the state-of-the-art of Sentence Embeddings with Vietnamese : - SimeCSE_Vietnamese pre-training approach is based on [SimCSE](https://arxiv.org/abs/2104.08821) which optimizes the SimeCSE_Vietnamese pre-training procedure for more robust performance. - SimeCSE_Vietnamese encode input sentences using a pre-trained language model such as [PhoBert](https://www.aclweb.org/anthology/2020.findings-emnlp.92/) - SimeCSE_Vietnamese works with both unlabeled and labeled data. ## Pre-trained models <a name="models"></a> Model | #params | Arch. ---|---|--- [`VoVanPhuc/sup-SimCSE-VietNamese-phobert-base`](https://huggingface.co/VoVanPhuc/sup-SimCSE-VietNamese-phobert-base) | 135M | base [`VoVanPhuc/unsup-SimCSE-VietNamese-phobert-base`](https://huggingface.co/VoVanPhuc/unsup-SimCSE-VietNamese-phobert-base) | 135M | base ## <a name="sentences-transformers"></a> Using SimeCSE_Vietnamese with `sentences-transformers` ### Installation <a name="install1"></a> - Install `sentence-transformers`: - `pip install -U sentence-transformers` - Install `pyvi` to word segment: - `pip install pyvi` ### Example usage <a name="usage1"></a> ```python from sentence_transformers import SentenceTransformer from pyvi.ViTokenizer import tokenize model = SentenceTransformer('VoVanPhuc/sup-SimCSE-VietNamese-phobert-base') sentences = ['Kẻ đánh bom đinh tồi tệ nhất nước Anh.', 'Nghệ sĩ làm thiện nguyện - minh bạch là việc cấp thiết.', 'Bắc Giang tăng khả năng điều trị và xét nghiệm.', 'HLV futsal Việt Nam tiết lộ lý do hạ Lebanon.', 'việc quan trọng khi kêu gọi quyên góp từ thiện là phải minh bạch, giải ngân kịp thời.', '20% bệnh nhân Covid-19 có thể nhanh chóng trở nặng.', 'Thái Lan thua giao hữu trước vòng loại World Cup.', 'Cựu tuyển thủ Nguyễn Bảo Quân: May mắn ủng hộ futsal Việt Nam', 'Chủ ki-ốt bị đâm chết trong chợ đầu mối lớn nhất Thanh Hoá.', 'Bắn chết người trong cuộc rượt đuổi trên sông.' ] sentences = [tokenize(sentence) for sentence in sentences] embeddings = model.encode(sentences) ``` ## <a name="sentences-transformers"></a> Using SimeCSE_Vietnamese with `transformers` ### Installation <a name="install2"></a> - Install `transformers`: - `pip install -U transformers` - Install `pyvi` to word segment: - `pip install pyvi` ### Example usage <a name="usage2"></a> ```python import torch from transformers import AutoModel, AutoTokenizer from pyvi.ViTokenizer import tokenize PhobertTokenizer = AutoTokenizer.from_pretrained("VoVanPhuc/sup-SimCSE-VietNamese-phobert-base") model = AutoModel.from_pretrained("VoVanPhuc/sup-SimCSE-VietNamese-phobert-base") sentences = ['Kẻ đánh bom đinh tồi tệ nhất nước Anh.', 'Nghệ sĩ làm thiện nguyện - minh bạch là việc cấp thiết.', 'Bắc Giang tăng khả năng điều trị và xét nghiệm.', 'HLV futsal Việt Nam tiết lộ lý do hạ Lebanon.', 'việc quan trọng khi kêu gọi quyên góp từ thiện là phải minh bạch, giải ngân kịp thời.', '20% bệnh nhân Covid-19 có thể nhanh chóng trở nặng.', 'Thái Lan thua giao hữu trước vòng loại World Cup.', 'Cựu tuyển thủ Nguyễn Bảo Quân: May mắn ủng hộ futsal Việt Nam', 'Chủ ki-ốt bị đâm chết trong chợ đầu mối lớn nhất Thanh Hoá.', 'Bắn chết người trong cuộc rượt đuổi trên sông.' ] sentences = [tokenize(sentence) for sentence in sentences] inputs = PhobertTokenizer(sentences, padding=True, truncation=True, return_tensors="pt") with torch.no_grad(): embeddings = model(**inputs, output_hidden_states=True, return_dict=True).pooler_output ``` ## Quick Start [Open In Colab](https://colab.research.google.com/drive/12__EXJoQYHe9nhi4aXLTf9idtXT8yr7H?usp=sharing) ## Citation @article{gao2021simcse, title={{SimCSE}: Simple Contrastive Learning of Sentence Embeddings}, author={Gao, Tianyu and Yao, Xingcheng and Chen, Danqi}, journal={arXiv preprint arXiv:2104.08821}, year={2021} } @inproceedings{phobert, title = {{PhoBERT: Pre-trained language models for Vietnamese}}, author = {Dat Quoc Nguyen and Anh Tuan Nguyen}, booktitle = {Findings of the Association for Computational Linguistics: EMNLP 2020}, year = {2020}, pages = {1037--1042} }

flair/ner-english-large

flair

flair

token-classification

--- tags: - flair - token-classification - sequence-tagger-model language: en datasets: - conll2003 widget: - text: "George Washington went to Washington" --- ## English NER in Flair (large model) This is the large 4-class NER model for English that ships with [Flair](https://github.com/flairNLP/flair/). F1-Score: **94,36** (corrected CoNLL-03) Predicts 4 tags: | **tag** | **meaning** | |---------------------------------|-----------| | PER | person name | | LOC | location name | | ORG | organization name | | MISC | other name | Based on document-level XLM-R embeddings and [FLERT](https://arxiv.org/pdf/2011.06993v1.pdf/). --- ### Demo: How to use in Flair Requires: **[Flair](https://github.com/flairNLP/flair/)** (`pip install flair`) ```python from flair.data import Sentence from flair.models import SequenceTagger # load tagger tagger = SequenceTagger.load("flair/ner-english-large") # make example sentence sentence = Sentence("George Washington went to Washington") # predict NER tags tagger.predict(sentence) # print sentence print(sentence) # print predicted NER spans print('The following NER tags are found:') # iterate over entities and print for entity in sentence.get_spans('ner'): print(entity) ``` This yields the following output: ``` Span [1,2]: "George Washington" [− Labels: PER (1.0)] Span [5]: "Washington" [− Labels: LOC (1.0)] ``` So, the entities "*George Washington*" (labeled as a **person**) and "*Washington*" (labeled as a **location**) are found in the sentence "*George Washington went to Washington*". --- ### Training: Script to train this model The following Flair script was used to train this model: ```python import torch # 1. get the corpus from flair.datasets import CONLL_03 corpus = CONLL_03() # 2. what tag do we want to predict? tag_type = 'ner' # 3. make the tag dictionary from the corpus tag_dictionary = corpus.make_tag_dictionary(tag_type=tag_type) # 4. initialize fine-tuneable transformer embeddings WITH document context from flair.embeddings import TransformerWordEmbeddings embeddings = TransformerWordEmbeddings( model='xlm-roberta-large', layers="-1", subtoken_pooling="first", fine_tune=True, use_context=True, ) # 5. initialize bare-bones sequence tagger (no CRF, no RNN, no reprojection) from flair.models import SequenceTagger tagger = SequenceTagger( hidden_size=256, embeddings=embeddings, tag_dictionary=tag_dictionary, tag_type='ner', use_crf=False, use_rnn=False, reproject_embeddings=False, ) # 6. initialize trainer with AdamW optimizer from flair.trainers import ModelTrainer trainer = ModelTrainer(tagger, corpus, optimizer=torch.optim.AdamW) # 7. run training with XLM parameters (20 epochs, small LR) from torch.optim.lr_scheduler import OneCycleLR trainer.train('resources/taggers/ner-english-large', learning_rate=5.0e-6, mini_batch_size=4, mini_batch_chunk_size=1, max_epochs=20, scheduler=OneCycleLR, embeddings_storage_mode='none', weight_decay=0., ) ) ``` --- ### Cite Please cite the following paper when using this model. ``` @misc{schweter2020flert, title={FLERT: Document-Level Features for Named Entity Recognition}, author={Stefan Schweter and Alan Akbik}, year={2020}, eprint={2011.06993}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` --- ### Issues? The Flair issue tracker is available [here](https://github.com/flairNLP/flair/issues/).

google/tapas-large-finetuned-wtq

google

transformers

table-question-answering

--- language: en tags: - tapas - table-question-answering license: apache-2.0 datasets: - wikitablequestions --- # TAPAS large model fine-tuned on WikiTable Questions (WTQ) This model has 2 versions which can be used. The default version corresponds to the `tapas_wtq_wikisql_sqa_inter_masklm_large_reset` checkpoint of the [original Github repository](https://github.com/google-research/tapas). This model was pre-trained on MLM and an additional step which the authors call intermediate pre-training, and then fine-tuned in a chain on [SQA](https://www.microsoft.com/en-us/download/details.aspx?id=54253), [WikiSQL](https://github.com/salesforce/WikiSQL) and finally [WTQ](https://github.com/ppasupat/WikiTableQuestions). It uses relative position embeddings (i.e. resetting the position index at every cell of the table). The other (non-default) version which can be used is: - `no_reset`, which corresponds to `tapas_wtq_wikisql_sqa_inter_masklm_large` (intermediate pre-training, absolute position embeddings). Disclaimer: The team releasing TAPAS did not write a model card for this model so this model card has been written by the Hugging Face team and contributors. ## Results Size | Reset | Dev Accuracy | Link -------- | --------| -------- | ---- **LARGE** | **noreset** | **0.5062** | [tapas-large-finetuned-wtq (with absolute pos embeddings)](https://huggingface.co/google/tapas-large-finetuned-wtq/tree/no_reset) **LARGE** | **reset** | **0.5097** | [tapas-large-finetuned-wtq](https://huggingface.co/google/tapas-large-finetuned-wtq/tree/main) BASE | noreset | 0.4525 | [tapas-base-finetuned-wtq (with absolute pos embeddings)](https://huggingface.co/google/tapas-base-finetuned-wtq/tree/no_reset) BASE | reset | 0.4638 | [tapas-base-finetuned-wtq](https://huggingface.co/google/tapas-base-finetuned-wtq/tree/main) MEDIUM | noreset | 0.4324 | [tapas-medium-finetuned-wtq (with absolute pos embeddings)](https://huggingface.co/google/tapas-medium-finetuned-wtq/tree/no_reset) MEDIUM | reset | 0.4324 | [tapas-medium-finetuned-wtq](https://huggingface.co/google/tapas-medium-finetuned-wtq/tree/main) SMALL | noreset | 0.3681 | [tapas-small-finetuned-wtq (with absolute pos embeddings)](https://huggingface.co/google/tapas-small-finetuned-wtq/tree/no_reset) SMALL | reset | 0.3762 | [tapas-small-finetuned-wtq](https://huggingface.co/google/tapas-small-finetuned-wtq/tree/main) MINI | noreset | 0.2783 | [tapas-mini-finetuned-wtq (with absolute pos embeddings)](https://huggingface.co/google/tapas-mini-finetuned-wtq/tree/no_reset) MINI | reset | 0.2854 | [tapas-mini-finetuned-wtq](https://huggingface.co/google/tapas-mini-finetuned-wtq/tree/main) TINY | noreset | 0.0823 | [tapas-tiny-finetuned-wtq (with absolute pos embeddings)](https://huggingface.co/google/tapas-tiny-finetuned-wtq/tree/no_reset) TINY | reset | 0.1039 | [tapas-tiny-finetuned-wtq](https://huggingface.co/google/tapas-tiny-finetuned-wtq/tree/main) ## Model description TAPAS is a BERT-like transformers model pretrained on a large corpus of English data from Wikipedia in a self-supervised fashion. This means it was pretrained on the raw tables and associated texts only, with no humans labelling them in any way (which is why it can use lots of publicly available data) with an automatic process to generate inputs and labels from those texts. More precisely, it was pretrained with two objectives: - Masked language modeling (MLM): taking a (flattened) table and associated context, the model randomly masks 15% of the words in the input, then runs the entire (partially masked) sequence through the model. The model then has to predict the masked words. This is different from traditional recurrent neural networks (RNNs) that usually see the words one after the other, or from autoregressive models like GPT which internally mask the future tokens. It allows the model to learn a bidirectional representation of a table and associated text. - Intermediate pre-training: to encourage numerical reasoning on tables, the authors additionally pre-trained the model by creating a balanced dataset of millions of syntactically created training examples. Here, the model must predict (classify) whether a sentence is supported or refuted by the contents of a table. The training examples are created based on synthetic as well as counterfactual statements. This way, the model learns an inner representation of the English language used in tables and associated texts, which can then be used to extract features useful for downstream tasks such as answering questions about a table, or determining whether a sentence is entailed or refuted by the contents of a table. Fine-tuning is done by adding a cell selection head and aggregation head on top of the pre-trained model, and then jointly train these randomly initialized classification heads with the base model on SQa, WikiSQL and finally WTQ. ## Intended uses & limitations You can use this model for answering questions related to a table. For code examples, we refer to the documentation of TAPAS on the HuggingFace website. ## Training procedure ### Preprocessing The texts are lowercased and tokenized using WordPiece and a vocabulary size of 30,000. The inputs of the model are then of the form: ``` [CLS] Question [SEP] Flattened table [SEP] ``` The authors did first convert the WTQ dataset into the format of SQA using automatic conversion scripts. ### Fine-tuning The model was fine-tuned on 32 Cloud TPU v3 cores for 50,000 steps with maximum sequence length 512 and batch size of 512. In this setup, fine-tuning takes around 10 hours. The optimizer used is Adam with a learning rate of 1.93581e-5, and a warmup ratio of 0.128960. An inductive bias is added such that the model only selects cells of the same column. This is reflected by the `select_one_column` parameter of `TapasConfig`. See the [paper](https://arxiv.org/abs/2004.02349) for more details (tables 11 and 12). ### BibTeX entry and citation info ```bibtex @misc{herzig2020tapas, title={TAPAS: Weakly Supervised Table Parsing via Pre-training}, author={Jonathan Herzig and Paweł Krzysztof Nowak and Thomas Müller and Francesco Piccinno and Julian Martin Eisenschlos}, year={2020}, eprint={2004.02349}, archivePrefix={arXiv}, primaryClass={cs.IR} } ``` ```bibtex @misc{eisenschlos2020understanding, title={Understanding tables with intermediate pre-training}, author={Julian Martin Eisenschlos and Syrine Krichene and Thomas Müller}, year={2020}, eprint={2010.00571}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` ```bibtex @article{DBLP:journals/corr/PasupatL15, author = {Panupong Pasupat and Percy Liang}, title = {Compositional Semantic Parsing on Semi-Structured Tables}, journal = {CoRR}, volume = {abs/1508.00305}, year = {2015}, url = {http://arxiv.org/abs/1508.00305}, archivePrefix = {arXiv}, eprint = {1508.00305}, timestamp = {Mon, 13 Aug 2018 16:47:37 +0200}, biburl = {https://dblp.org/rec/journals/corr/PasupatL15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

MaziyarPanahi/Llama-3-8B-Instruct-v0.4

MaziyarPanahi

transformers

text-generation

--- base_model: meta-llama/Meta-Llama-3-8B-Instruct library_name: transformers tags: - axolotl - finetune - facebook - meta - pytorch - llama - llama-3 language: - en pipeline_tag: text-generation license: other license_name: llama3 license_link: LICENSE inference: false model_creator: MaziyarPanahi model_name: Llama-3-8B-Instruct-v0.4 quantized_by: MaziyarPanahi --- <img src="./llama-3-merges.webp" alt="Llama-3 DPO Logo" width="500" style="margin-left:'auto' margin-right:'auto' display:'block'"/> # Llama-3-8B-Instruct-v0.4 This model was developed based on `meta-llama/Meta-Llama-3-8B-Instruct` model. # Quantized GGUF All GGUF models are available here: [MaziyarPanahi/Llama-3-8B-Instruct-v0.4-GGUF](https://huggingface.co/MaziyarPanahi/Llama-3-8B-Instruct-v0.4-GGUF) # Prompt Template This model uses `ChatML` prompt template: ``` <|begin_of_text|><|start_header_id|>system<|end_header_id|> {system_prompt}<|eot_id|><|start_header_id|>user<|end_header_id|> {prompt}<|eot_id|><|start_header_id|>assistant<|end_header_id|> ```` # How to use You can use this model by using `MaziyarPanahi/Llama-3-8B-Instruct-v0.4` as the model name in Hugging Face's transformers library. ```python from transformers import AutoModelForCausalLM, AutoTokenizer, TextStreamer from transformers import pipeline import torch model_id = "MaziyarPanahi/Llama-3-8B-Instruct-v0.4" model = AutoModelForCausalLM.from_pretrained( model_id, torch_dtype=torch.bfloat16, device_map="auto", trust_remote_code=True, # attn_implementation="flash_attention_2" ) tokenizer = AutoTokenizer.from_pretrained( model_id, trust_remote_code=True ) streamer = TextStreamer(tokenizer) pipeline = pipeline( "text-generation", model=model, tokenizer=tokenizer, model_kwargs={"torch_dtype": torch.bfloat16}, streamer=streamer ) # Then you can use the pipeline to generate text. messages = [ {"role": "system", "content": "You are a pirate chatbot who always responds in pirate speak!"}, {"role": "user", "content": "Who are you?"}, ] prompt = tokenizer.apply_chat_template( messages, tokenize=False, add_generation_prompt=True ) terminators = [ tokenizer.eos_token_id, tokenizer.convert_tokens_to_ids("<|eot_id|>") ] outputs = pipeline( prompt, max_new_tokens=512, eos_token_id=terminators, do_sample=True, temperature=0.6, top_p=0.95, ) print(outputs[0]["generated_text"][len(prompt):]) ```

sentence-transformers/msmarco-MiniLM-L-12-v3

sentence-transformers

sentence-transformers

sentence-similarity

--- license: apache-2.0 library_name: sentence-transformers tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers pipeline_tag: sentence-similarity --- # sentence-transformers/msmarco-MiniLM-L-12-v3 This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 384 dimensional dense vector space and can be used for tasks like clustering or semantic search. ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer sentences = ["This is an example sentence", "Each sentence is converted"] model = SentenceTransformer('sentence-transformers/msmarco-MiniLM-L-12-v3') embeddings = model.encode(sentences) print(embeddings) ``` ## Usage (HuggingFace Transformers) Without [sentence-transformers](https://www.SBERT.net), you can use the model like this: First, you pass your input through the transformer model, then you have to apply the right pooling-operation on-top of the contextualized word embeddings. ```python from transformers import AutoTokenizer, AutoModel import torch #Mean Pooling - Take attention mask into account for correct averaging def mean_pooling(model_output, attention_mask): token_embeddings = model_output[0] #First element of model_output contains all token embeddings input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) # Sentences we want sentence embeddings for sentences = ['This is an example sentence', 'Each sentence is converted'] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('sentence-transformers/msmarco-MiniLM-L-12-v3') model = AutoModel.from_pretrained('sentence-transformers/msmarco-MiniLM-L-12-v3') # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, max pooling. sentence_embeddings = mean_pooling(model_output, encoded_input['attention_mask']) print("Sentence embeddings:") print(sentence_embeddings) ``` ## Evaluation Results For an automated evaluation of this model, see the *Sentence Embeddings Benchmark*: [https://seb.sbert.net](https://seb.sbert.net?model_name=sentence-transformers/msmarco-MiniLM-L-12-v3) ## Full Model Architecture ``` SentenceTransformer( (0): Transformer({'max_seq_length': 512, 'do_lower_case': False}) with Transformer model: BertModel (1): Pooling({'word_embedding_dimension': 384, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False}) ) ``` ## Citing & Authors This model was trained by [sentence-transformers](https://www.sbert.net/). If you find this model helpful, feel free to cite our publication [Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks](https://arxiv.org/abs/1908.10084): ```bibtex @inproceedings{reimers-2019-sentence-bert, title = "Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks", author = "Reimers, Nils and Gurevych, Iryna", booktitle = "Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing", month = "11", year = "2019", publisher = "Association for Computational Linguistics", url = "http://arxiv.org/abs/1908.10084", } ```

mradermacher/DPO-70B-v5-GGUF

mradermacher

transformers

--- base_model: xi0v/DPO-70B-v5 language: - en library_name: transformers quantized_by: mradermacher --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: --> static quants of https://huggingface.co/xi0v/DPO-70B-v5 <!-- provided-files --> weighted/imatrix quants seem not to be available (by me) at this time. If they do not show up a week or so after the static ones, I have probably not planned for them. Feel free to request them by opening a Community Discussion. ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q2_K.gguf) | Q2_K | 26.5 | | | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.IQ3_XS.gguf) | IQ3_XS | 29.4 | | | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.IQ3_S.gguf) | IQ3_S | 31.0 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q3_K_S.gguf) | Q3_K_S | 31.0 | | | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.IQ3_M.gguf) | IQ3_M | 32.0 | | | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q3_K_M.gguf) | Q3_K_M | 34.4 | lower quality | | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q3_K_L.gguf) | Q3_K_L | 37.2 | | | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.IQ4_XS.gguf) | IQ4_XS | 38.4 | | | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q4_K_S.gguf) | Q4_K_S | 40.4 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q4_K_M.gguf) | Q4_K_M | 42.6 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q5_K_S.gguf) | Q5_K_S | 48.8 | | | [GGUF](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q5_K_M.gguf) | Q5_K_M | 50.0 | | | [PART 1](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q6_K.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q6_K.gguf.part2of2) | Q6_K | 58.0 | very good quality | | [PART 1](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q8_0.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/DPO-70B-v5-GGUF/resolve/main/DPO-70B-v5.Q8_0.gguf.part2of2) | Q8_0 | 75.1 | fast, best quality | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. <!-- end -->

stabilityai/stable-video-diffusion-img2vid

stabilityai

diffusers

image-to-video

--- pipeline_tag: image-to-video license: other license_name: stable-video-diffusion-nc-community license_link: LICENSE --- # Stable Video Diffusion Image-to-Video Model Card <!-- Provide a quick summary of what the model is/does. -->  Stable Video Diffusion (SVD) Image-to-Video is a diffusion model that takes in a still image as a conditioning frame, and generates a video from it. Please note: For commercial use of this model, please refer to https://stability.ai/membership. ## Model Details ### Model Description (SVD) Image-to-Video is a latent diffusion model trained to generate short video clips from an image conditioning. This model was trained to generate 14 frames at resolution 576x1024 given a context frame of the same size. We also finetune the widely used [f8-decoder](https://huggingface.co/docs/diffusers/api/models/autoencoderkl#loading-from-the-original-format) for temporal consistency. For convenience, we additionally provide the model with the standard frame-wise decoder [here](https://huggingface.co/stabilityai/stable-video-diffusion-img2vid/blob/main/svd_image_decoder.safetensors). - **Developed by:** Stability AI - **Funded by:** Stability AI - **Model type:** Generative image-to-video model ### Model Sources For research purposes, we recommend our `generative-models` Github repository (https://github.com/Stability-AI/generative-models), which implements the most popular diffusion frameworks (both training and inference). - **Repository:** https://github.com/Stability-AI/generative-models - **Paper:** https://stability.ai/research/stable-video-diffusion-scaling-latent-video-diffusion-models-to-large-datasets ## Evaluation  The chart above evaluates user preference for SVD-Image-to-Video over [GEN-2](https://research.runwayml.com/gen2) and [PikaLabs](https://www.pika.art/). SVD-Image-to-Video is preferred by human voters in terms of video quality. For details on the user study, we refer to the [research paper](https://stability.ai/research/stable-video-diffusion-scaling-latent-video-diffusion-models-to-large-datasets) ## Uses ### Direct Use The model is intended for research purposes only. Possible research areas and tasks include - Research on generative models. - Safe deployment of models which have the potential to generate harmful content. - Probing and understanding the limitations and biases of generative models. - Generation of artworks and use in design and other artistic processes. - Applications in educational or creative tools. Excluded uses are described below. ### Out-of-Scope Use The model was not trained to be factual or true representations of people or events, and therefore using the model to generate such content is out-of-scope for the abilities of this model. The model should not be used in any way that violates Stability AI's [Acceptable Use Policy](https://stability.ai/use-policy). ## Limitations and Bias ### Limitations - The generated videos are rather short (<= 4sec), and the model does not achieve perfect photorealism. - The model may generate videos without motion, or very slow camera pans. - The model cannot be controlled through text. - The model cannot render legible text. - Faces and people in general may not be generated properly. - The autoencoding part of the model is lossy. ### Recommendations The model is intended for research purposes only. ## How to Get Started with the Model Check out https://github.com/Stability-AI/generative-models # Appendix: All considered potential data sources were included for final training, with none held out as the proposed data filtering methods described in the SVD paper handle the quality control/filtering of the dataset. With regards to safety/NSFW filtering, sources considered were either deemed safe or filtered with the in-house NSFW filters. No explicit human labor is involved in training data preparation. However, human evaluation for model outputs and quality was extensively used to evaluate model quality and performance. The evaluations were performed with third-party contractor platforms (Amazon Sagemaker, Amazon Mechanical Turk, Prolific) with fluent English-speaking contractors from various countries, primarily from the USA, UK, and Canada. Each worker was paid $12/hr for the time invested in the evaluation. No other third party was involved in the development of this model; the model was fully developed in-house at Stability AI. Training the SVD checkpoints required a total of approximately 200,000 A100 80GB hours. The majority of the training occurred on 48 * 8 A100s, while some stages took more/less than that. The resulting CO2 emission is ~19,000kg CO2 eq., and energy consumed is ~64000 kWh. The released checkpoints (SVD/SVD-XT) are image-to-video models that generate short videos/animations closely following the given input image. Since the model relies on an existing supplied image, the potential risks of disclosing specific material or novel unsafe content are minimal. This was also evaluated by third-party independent red-teaming services, which agree with our conclusion to a high degree of confidence (>90% in various areas of safety red-teaming). The external evaluations were also performed for trustworthiness, leading to >95% confidence in real, trustworthy videos. With the default settings at the time of release, SVD takes ~100s for generation, and SVD-XT takes ~180s on an A100 80GB card. Several optimizations to trade off quality / memory / speed can be done to perform faster inference or inference on lower VRAM cards. The information related to the model and its development process and usage protocols can be found in the GitHub repo, associated research paper, and HuggingFace model page/cards. The released model inference & demo code has image-level watermarking enabled by default, which can be used to detect the outputs. This is done via the imWatermark Python library. The model can be used to generate videos from static initial images. However, we prohibit unlawful, obscene, or misleading uses of the model consistent with the terms of our license and Acceptable Use Policy. For the open-weights release, our training data filtering mitigations alleviate this risk to some extent. These restrictions are explicitly enforced on user-facing interfaces at stablevideo.com, where a warning is issued. We do not take any responsibility for third-party interfaces. Submitting initial images that bypass input filters to tease out offensive or inappropriate content listed above is also prohibited. Safety filtering checks at stablevideo.com run on model inputs and outputs independently. More details on our user-facing interfaces can be found here: https://www.stablevideo.com/faq. Beyond the Acceptable Use Policy and other mitigations and conditions described here, the model is not subject to additional model behavior interventions of the type described in the Foundation Model Transparency Index. For stablevideo.com, we store preference data in the form of upvotes/downvotes on user-generated videos, and we have a pairwise ranker that runs while a user generates videos. This usage data is solely used for improving Stability AI’s future image/video models and services. No other third-party entities are given access to the usage data beyond Stability AI and maintainers of stablevideo.com. For usage statistics of SVD, we refer interested users to HuggingFace model download/usage statistics as a primary indicator. Third-party applications also have reported model usage statistics. We might also consider releasing aggregate usage statistics of stablevideo.com on reaching some milestones.

RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf

RichardErkhov

Quantization made by Richard Erkhov. [Github](https://github.com/RichardErkhov) [Discord](https://discord.gg/pvy7H8DZMG) [Request more models](https://github.com/RichardErkhov/quant_request) CodeLlama-70b-hf - GGUF - Model creator: https://huggingface.co/codellama/ - Original model: https://huggingface.co/codellama/CodeLlama-70b-hf/ | Name | Quant method | Size | | ---- | ---- | ---- | | [CodeLlama-70b-hf.Q2_K.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.Q2_K.gguf) | Q2_K | 23.71GB | | [CodeLlama-70b-hf.IQ3_XS.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.IQ3_XS.gguf) | IQ3_XS | 26.37GB | | [CodeLlama-70b-hf.IQ3_S.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.IQ3_S.gguf) | IQ3_S | 27.86GB | | [CodeLlama-70b-hf.Q3_K_S.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.Q3_K_S.gguf) | Q3_K_S | 27.86GB | | [CodeLlama-70b-hf.IQ3_M.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.IQ3_M.gguf) | IQ3_M | 28.82GB | | [CodeLlama-70b-hf.Q3_K.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.Q3_K.gguf) | Q3_K | 30.99GB | | [CodeLlama-70b-hf.Q3_K_M.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.Q3_K_M.gguf) | Q3_K_M | 30.99GB | | [CodeLlama-70b-hf.Q3_K_L.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.Q3_K_L.gguf) | Q3_K_L | 33.67GB | | [CodeLlama-70b-hf.IQ4_XS.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.IQ4_XS.gguf) | IQ4_XS | 34.64GB | | [CodeLlama-70b-hf.Q4_0.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.Q4_0.gguf) | Q4_0 | 36.2GB | | [CodeLlama-70b-hf.IQ4_NL.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.IQ4_NL.gguf) | IQ4_NL | 36.55GB | | [CodeLlama-70b-hf.Q4_K_S.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/blob/main/CodeLlama-70b-hf.Q4_K_S.gguf) | Q4_K_S | 36.55GB | | [CodeLlama-70b-hf.Q4_K.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/tree/main/) | Q4_K | 38.58GB | | [CodeLlama-70b-hf.Q4_K_M.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/tree/main/) | Q4_K_M | 38.58GB | | [CodeLlama-70b-hf.Q4_1.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/tree/main/) | Q4_1 | 40.2GB | | [CodeLlama-70b-hf.Q5_0.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/tree/main/) | Q5_0 | 44.2GB | | [CodeLlama-70b-hf.Q5_K_S.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/tree/main/) | Q5_K_S | 44.2GB | | [CodeLlama-70b-hf.Q5_K.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/tree/main/) | Q5_K | 45.41GB | | [CodeLlama-70b-hf.Q5_K_M.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/tree/main/) | Q5_K_M | 45.41GB | | [CodeLlama-70b-hf.Q5_1.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/tree/main/) | Q5_1 | 48.2GB | | [CodeLlama-70b-hf.Q6_K.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/tree/main/) | Q6_K | 52.7GB | | [CodeLlama-70b-hf.Q8_0.gguf](https://huggingface.co/RichardErkhov/codellama_-_CodeLlama-70b-hf-gguf/tree/main/) | Q8_0 | 68.26GB | Original model description: --- language: - code pipeline_tag: text-generation tags: - llama-2 license: llama2 --- # **Code Llama** Code Llama is a collection of pretrained and fine-tuned generative text models ranging in scale from 7 billion to 70 billion parameters. This is the repository for the base 70B version in the Hugging Face Transformers format. This model is designed for general code synthesis and understanding. Links to other models can be found in the index at the bottom. > [!NOTE] > This is a non-official Code Llama repo. You can find the official Meta repository in the [Meta Llama organization](https://huggingface.co/meta-llama/CodeLlama-70b-hf). | | Base Model | Python | Instruct | | --- | ----------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------- | ----------------------------------------------------------------------------------------------- | | 7B | [codellama/CodeLlama-7b-hf](https://huggingface.co/codellama/CodeLlama-7b-hf) | [codellama/CodeLlama-7b-Python-hf](https://huggingface.co/codellama/CodeLlama-7b-Python-hf) | [codellama/CodeLlama-7b-Instruct-hf](https://huggingface.co/codellama/CodeLlama-7b-Instruct-hf) | | 13B | [codellama/CodeLlama-13b-hf](https://huggingface.co/codellama/CodeLlama-13b-hf) | [codellama/CodeLlama-13b-Python-hf](https://huggingface.co/codellama/CodeLlama-13b-Python-hf) | [codellama/CodeLlama-13b-Instruct-hf](https://huggingface.co/codellama/CodeLlama-13b-Instruct-hf) | | 34B | [codellama/CodeLlama-34b-hf](https://huggingface.co/codellama/CodeLlama-34b-hf) | [codellama/CodeLlama-34b-Python-hf](https://huggingface.co/codellama/CodeLlama-34b-Python-hf) | [codellama/CodeLlama-34b-Instruct-hf](https://huggingface.co/codellama/CodeLlama-34b-Instruct-hf) | | 70B | [codellama/CodeLlama-70b-hf](https://huggingface.co/codellama/CodeLlama-70b-hf) | [codellama/CodeLlama-70b-Python-hf](https://huggingface.co/codellama/CodeLlama-70b-Python-hf) | [codellama/CodeLlama-70b-Instruct-hf](https://huggingface.co/codellama/CodeLlama-70b-Instruct-hf) | ## Model Use To use this model, please make sure to install `transformers`. ```bash pip install transformers accelerate ``` Model capabilities: - [x] Code completion. - [ ] Infilling. - [ ] Instructions / chat. - [ ] Python specialist. ## Model Details *Note: Use of this model is governed by the Meta license. Meta developed and publicly released the Code Llama family of large language models (LLMs). **Model Developers** Meta **Variations** Code Llama comes in four model sizes, and three variants: * Code Llama: base models designed for general code synthesis and understanding * Code Llama - Python: designed specifically for Python * Code Llama - Instruct: for instruction following and safer deployment All variants are available in sizes of 7B, 13B, 34B, and 70B parameters. **This repository contains the base version of the 70B parameters model.** **Input** Models input text only. **Output** Models generate text only. **Model Architecture** Code Llama is an auto-regressive language model that uses an optimized transformer architecture. It was fine-tuned with up to 16k tokens and supports up to 100k tokens at inference time. **Model Dates** Code Llama and its variants have been trained between January 2023 and January 2024. **Status** This is a static model trained on an offline dataset. Future versions of Code Llama - Instruct will be released as we improve model safety with community feedback. **License** A custom commercial license is available at: [https://ai.meta.com/resources/models-and-libraries/llama-downloads/](https://ai.meta.com/resources/models-and-libraries/llama-downloads/) **Research Paper** More information can be found in the paper "[Code Llama: Open Foundation Models for Code](https://ai.meta.com/research/publications/code-llama-open-foundation-models-for-code/)" or its [arXiv page](https://arxiv.org/abs/2308.12950). ## Intended Use **Intended Use Cases** Code Llama and its variants are intended for commercial and research use in English and relevant programming languages. The base model Code Llama can be adapted for a variety of code synthesis and understanding tasks, Code Llama - Python is designed specifically to handle the Python programming language, and Code Llama - Instruct is intended to be safer to use for code assistant and generation applications. **Out-of-Scope Uses** Use in any manner that violates applicable laws or regulations (including trade compliance laws). Use in languages other than English. Use in any other way that is prohibited by the Acceptable Use Policy and Licensing Agreement for Code Llama and its variants. ## Hardware and Software **Training Factors** We used custom training libraries. The training and fine-tuning of the released models have been performed Meta’s Research Super Cluster. **Carbon Footprint** In aggregate, training all 12 Code Llama models required 1400K GPU hours of computation on hardware of type A100-80GB (TDP of 350-400W). Estimated total emissions were 228.55 tCO2eq, 100% of which were offset by Meta’s sustainability program. ## Evaluation Results See evaluations for the main models and detailed ablations in Section 3 and safety evaluations in Section 4 of the research paper. ## Ethical Considerations and Limitations Code Llama and its variants are a new technology that carries risks with use. Testing conducted to date has been in English, and has not covered, nor could it cover all scenarios. For these reasons, as with all LLMs, Code Llama’s potential outputs cannot be predicted in advance, and the model may in some instances produce inaccurate or objectionable responses to user prompts. Therefore, before deploying any applications of Code Llama, developers should perform safety testing and tuning tailored to their specific applications of the model. Please see the Responsible Use Guide available available at [https://ai.meta.com/llama/responsible-use-guide](https://ai.meta.com/llama/responsible-use-guide).

HuggingFaceH4/zephyr-7b-alpha

HuggingFaceH4

transformers

text-generation

--- tags: - generated_from_trainer model-index: - name: zephyr-7b-alpha results: [] license: mit datasets: - stingning/ultrachat - openbmb/UltraFeedback language: - en base_model: mistralai/Mistral-7B-v0.1 --- <!-- This model card has been generated automatically according to the information the Trainer had access to. You should probably proofread and complete it, then remove this comment. --> <img src="https://huggingface.co/HuggingFaceH4/zephyr-7b-alpha/resolve/main/thumbnail.png" alt="Zephyr Logo" width="800" style="margin-left:'auto' margin-right:'auto' display:'block'"/> # Model Card for Zephyr 7B Alpha Zephyr is a series of language models that are trained to act as helpful assistants. Zephyr-7B-α is the first model in the series, and is a fine-tuned version of [mistralai/Mistral-7B-v0.1](https://huggingface.co/mistralai/Mistral-7B-v0.1) that was trained on on a mix of publicly available, synthetic datasets using [Direct Preference Optimization (DPO)](https://arxiv.org/abs/2305.18290). We found that removing the in-built alignment of these datasets boosted performance on [MT Bench](https://huggingface.co/spaces/lmsys/mt-bench) and made the model more helpful. However, this means that model is likely to generate problematic text when prompted to do so. ## Model description - **Model type:** A 7B parameter GPT-like model fine-tuned on a mix of publicly available, synthetic datasets. - **Language(s) (NLP):** Primarily English - **License:** MIT - **Finetuned from model:** [mistralai/Mistral-7B-v0.1](https://huggingface.co/mistralai/Mistral-7B-v0.1) ### Model Sources <!-- Provide the basic links for the model. --> - **Repository:** https://github.com/huggingface/alignment-handbook - **Demo:** https://huggingface.co/spaces/HuggingFaceH4/zephyr-chat ## Intended uses & limitations The model was initially fine-tuned on a variant of the [`UltraChat`](https://huggingface.co/datasets/stingning/ultrachat) dataset, which contains a diverse range of synthetic dialogues generated by ChatGPT. We then further aligned the model with [🤗 TRL's](https://github.com/huggingface/trl) `DPOTrainer` on the [openbmb/UltraFeedback](https://huggingface.co/datasets/openbmb/UltraFeedback) dataset, which contain 64k prompts and model completions that are ranked by GPT-4. As a result, the model can be used for chat and you can check out our [demo](https://huggingface.co/spaces/HuggingFaceH4/zephyr-chat) to test its capabilities. Here's how you can run the model using the `pipeline()` function from 🤗 Transformers: ```python # Install transformers from source - only needed for versions <= v4.34 # pip install git+https://github.com/huggingface/transformers.git # pip install accelerate import torch from transformers import pipeline pipe = pipeline("text-generation", model="HuggingFaceH4/zephyr-7b-alpha", torch_dtype=torch.bfloat16, device_map="auto") # We use the tokenizer's chat template to format each message - see https://huggingface.co/docs/transformers/main/en/chat_templating messages = [ { "role": "system", "content": "You are a friendly chatbot who always responds in the style of a pirate", }, {"role": "user", "content": "How many helicopters can a human eat in one sitting?"}, ] prompt = pipe.tokenizer.apply_chat_template(messages, tokenize=False, add_generation_prompt=True) outputs = pipe(prompt, max_new_tokens=256, do_sample=True, temperature=0.7, top_k=50, top_p=0.95) print(outputs[0]["generated_text"]) # <|system|> # You are a friendly chatbot who always responds in the style of a pirate.</s> # <|user|> # How many helicopters can a human eat in one sitting?</s> # <|assistant|> # Ah, me hearty matey! But yer question be a puzzler! A human cannot eat a helicopter in one sitting, as helicopters are not edible. They be made of metal, plastic, and other materials, not food! ``` ## Bias, Risks, and Limitations <!-- This section is meant to convey both technical and sociotechnical limitations. --> Zephyr-7B-α has not been aligned to human preferences with techniques like RLHF or deployed with in-the-loop filtering of responses like ChatGPT, so the model can produce problematic outputs (especially when prompted to do so). It is also unknown what the size and composition of the corpus was used to train the base model (`mistralai/Mistral-7B-v0.1`), however it is likely to have included a mix of Web data and technical sources like books and code. See the [Falcon 180B model card](https://huggingface.co/tiiuae/falcon-180B#training-data) for an example of this. ## Training and evaluation data Zephyr 7B Alpha achieves the following results on the evaluation set: - Loss: 0.4605 - Rewards/chosen: -0.5053 - Rewards/rejected: -1.8752 - Rewards/accuracies: 0.7812 - Rewards/margins: 1.3699 - Logps/rejected: -327.4286 - Logps/chosen: -297.1040 - Logits/rejected: -2.7153 - Logits/chosen: -2.7447 ## Training procedure ### Training hyperparameters The following hyperparameters were used during training: - learning_rate: 5e-07 - train_batch_size: 2 - eval_batch_size: 4 - seed: 42 - distributed_type: multi-GPU - num_devices: 16 - total_train_batch_size: 32 - total_eval_batch_size: 64 - optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 - lr_scheduler_type: linear - lr_scheduler_warmup_ratio: 0.1 - num_epochs: 1 ### Training results | Training Loss | Epoch | Step | Validation Loss | Rewards/chosen | Rewards/rejected | Rewards/accuracies | Rewards/margins | Logps/rejected | Logps/chosen | Logits/rejected | Logits/chosen | |:-------------:|:-----:|:----:|:---------------:|:--------------:|:----------------:|:------------------:|:---------------:|:--------------:|:------------:|:---------------:|:-------------:| | 0.5602 | 0.05 | 100 | 0.5589 | -0.3359 | -0.8168 | 0.7188 | 0.4809 | -306.2607 | -293.7161 | -2.6554 | -2.6797 | | 0.4852 | 0.1 | 200 | 0.5136 | -0.5310 | -1.4994 | 0.8125 | 0.9684 | -319.9124 | -297.6181 | -2.5762 | -2.5957 | | 0.5212 | 0.15 | 300 | 0.5168 | -0.1686 | -1.1760 | 0.7812 | 1.0074 | -313.4444 | -290.3699 | -2.6865 | -2.7125 | | 0.5496 | 0.21 | 400 | 0.4835 | -0.1617 | -1.7170 | 0.8281 | 1.5552 | -324.2635 | -290.2326 | -2.7947 | -2.8218 | | 0.5209 | 0.26 | 500 | 0.5054 | -0.4778 | -1.6604 | 0.7344 | 1.1826 | -323.1325 | -296.5546 | -2.8388 | -2.8667 | | 0.4617 | 0.31 | 600 | 0.4910 | -0.3738 | -1.5180 | 0.7656 | 1.1442 | -320.2848 | -294.4741 | -2.8234 | -2.8521 | | 0.4452 | 0.36 | 700 | 0.4838 | -0.4591 | -1.6576 | 0.7031 | 1.1986 | -323.0770 | -296.1796 | -2.7401 | -2.7653 | | 0.4674 | 0.41 | 800 | 0.5077 | -0.5692 | -1.8659 | 0.7656 | 1.2967 | -327.2416 | -298.3818 | -2.6740 | -2.6945 | | 0.4656 | 0.46 | 900 | 0.4927 | -0.5279 | -1.6614 | 0.7656 | 1.1335 | -323.1518 | -297.5553 | -2.7817 | -2.8015 | | 0.4102 | 0.52 | 1000 | 0.4772 | -0.5767 | -2.0667 | 0.7656 | 1.4900 | -331.2578 | -298.5311 | -2.7160 | -2.7455 | | 0.4663 | 0.57 | 1100 | 0.4740 | -0.8038 | -2.1018 | 0.7656 | 1.2980 | -331.9604 | -303.0741 | -2.6994 | -2.7257 | | 0.4737 | 0.62 | 1200 | 0.4716 | -0.3783 | -1.7015 | 0.7969 | 1.3232 | -323.9545 | -294.5634 | -2.6842 | -2.7135 | | 0.4259 | 0.67 | 1300 | 0.4866 | -0.6239 | -1.9703 | 0.7812 | 1.3464 | -329.3312 | -299.4761 | -2.7046 | -2.7356 | | 0.4935 | 0.72 | 1400 | 0.4747 | -0.5626 | -1.7600 | 0.7812 | 1.1974 | -325.1243 | -298.2491 | -2.7153 | -2.7444 | | 0.4211 | 0.77 | 1500 | 0.4645 | -0.6099 | -1.9993 | 0.7656 | 1.3894 | -329.9109 | -299.1959 | -2.6944 | -2.7236 | | 0.4931 | 0.83 | 1600 | 0.4684 | -0.6798 | -2.1082 | 0.7656 | 1.4285 | -332.0890 | -300.5934 | -2.7006 | -2.7305 | | 0.5029 | 0.88 | 1700 | 0.4595 | -0.5063 | -1.8951 | 0.7812 | 1.3889 | -327.8267 | -297.1233 | -2.7108 | -2.7403 | | 0.4965 | 0.93 | 1800 | 0.4613 | -0.5561 | -1.9079 | 0.7812 | 1.3518 | -328.0831 | -298.1203 | -2.7226 | -2.7523 | | 0.4337 | 0.98 | 1900 | 0.4608 | -0.5066 | -1.8718 | 0.7656 | 1.3652 | -327.3599 | -297.1296 | -2.7175 | -2.7469 | ### Framework versions - Transformers 4.34.0 - Pytorch 2.0.1+cu118 - Datasets 2.12.0 - Tokenizers 0.14.0

yiyanghkust/finbert-esg

yiyanghkust

transformers

text-classification

--- language: "en" tags: - financial-text-analysis - esg - environmental-social-corporate-governance widget: - text: "Rhonda has been volunteering for several years for a variety of charitable community programs. " --- ESG analysis can help investors determine a business' long-term sustainability and identify associated risks. FinBERT-ESG is a FinBERT model fine-tuned on 2,000 manually annotated sentences from firms' ESG reports and annual reports. **Input**: A financial text. **Output**: Environmental, Social, Governance or None. # How to use You can use this model with Transformers pipeline for ESG classification. ```python # tested in transformers==4.18.0 from transformers import BertTokenizer, BertForSequenceClassification, pipeline finbert = BertForSequenceClassification.from_pretrained('yiyanghkust/finbert-esg',num_labels=4) tokenizer = BertTokenizer.from_pretrained('yiyanghkust/finbert-esg') nlp = pipeline("text-classification", model=finbert, tokenizer=tokenizer) results = nlp('Rhonda has been volunteering for several years for a variety of charitable community programs.') print(results) # [{'label': 'Social', 'score': 0.9906041026115417}] ``` Visit [FinBERT.AI](https://finbert.ai/) for more details on the recent development of FinBERT. If you use the model in your academic work, please cite the following paper: Huang, Allen H., Hui Wang, and Yi Yang. "FinBERT: A Large Language Model for Extracting Information from Financial Text." *Contemporary Accounting Research* (2022).

mradermacher/Fook-Yi-34B-v1a-i1-GGUF

mradermacher

transformers

--- base_model: BeaverAI/Fook-Yi-34B-v1a language: - en library_name: transformers quantized_by: mradermacher --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: nicoboss --> weighted/imatrix quants of https://huggingface.co/BeaverAI/Fook-Yi-34B-v1a <!-- provided-files --> static quants are available at https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-IQ1_S.gguf) | i1-IQ1_S | 7.6 | for the desperate | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-IQ1_M.gguf) | i1-IQ1_M | 8.3 | mostly desperate | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-IQ2_XXS.gguf) | i1-IQ2_XXS | 9.4 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-IQ2_XS.gguf) | i1-IQ2_XS | 10.4 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-IQ2_S.gguf) | i1-IQ2_S | 11.0 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-IQ2_M.gguf) | i1-IQ2_M | 11.9 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-Q2_K.gguf) | i1-Q2_K | 12.9 | IQ3_XXS probably better | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-IQ3_XXS.gguf) | i1-IQ3_XXS | 13.4 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-IQ3_XS.gguf) | i1-IQ3_XS | 14.3 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-Q3_K_S.gguf) | i1-Q3_K_S | 15.1 | IQ3_XS probably better | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-IQ3_S.gguf) | i1-IQ3_S | 15.1 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-IQ3_M.gguf) | i1-IQ3_M | 15.7 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-Q3_K_M.gguf) | i1-Q3_K_M | 16.8 | IQ3_S probably better | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-Q3_K_L.gguf) | i1-Q3_K_L | 18.2 | IQ3_M probably better | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-IQ4_XS.gguf) | i1-IQ4_XS | 18.6 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-Q4_0.gguf) | i1-Q4_0 | 19.6 | fast, low quality | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-Q4_K_S.gguf) | i1-Q4_K_S | 19.7 | optimal size/speed/quality | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-Q4_K_M.gguf) | i1-Q4_K_M | 20.8 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-Q5_K_S.gguf) | i1-Q5_K_S | 23.8 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-Q5_K_M.gguf) | i1-Q5_K_M | 24.4 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF/resolve/main/Fook-Yi-34B-v1a.i1-Q6_K.gguf) | i1-Q6_K | 28.3 | practically like static Q6_K | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. Additional thanks to [@nicoboss](https://huggingface.co/nicoboss) for giving me access to his hardware for calculating the imatrix for these quants. <!-- end -->

microsoft/Florence-2-large

microsoft

transformers

image-text-to-text

--- license: mit license_link: https://huggingface.co/microsoft/Florence-2-large/resolve/main/LICENSE pipeline_tag: image-text-to-text tags: - vision --- # Florence-2: Advancing a Unified Representation for a Variety of Vision Tasks ## Model Summary This Hub repository contains a HuggingFace's `transformers` implementation of Florence-2 model from Microsoft. Florence-2 is an advanced vision foundation model that uses a prompt-based approach to handle a wide range of vision and vision-language tasks. Florence-2 can interpret simple text prompts to perform tasks like captioning, object detection, and segmentation. It leverages our FLD-5B dataset, containing 5.4 billion annotations across 126 million images, to master multi-task learning. The model's sequence-to-sequence architecture enables it to excel in both zero-shot and fine-tuned settings, proving to be a competitive vision foundation model. Resources and Technical Documentation: + [Florence-2 technical report](https://arxiv.org/abs/2311.06242). + [Jupyter Notebook for inference and visualization of Florence-2-large](https://huggingface.co/microsoft/Florence-2-large/blob/main/sample_inference.ipynb) | Model | Model size | Model Description | | ------- | ------------- | ------------- | | Florence-2-base[[HF]](https://huggingface.co/microsoft/Florence-2-base) | 0.23B | Pretrained model with FLD-5B | Florence-2-large[[HF]](https://huggingface.co/microsoft/Florence-2-large) | 0.77B | Pretrained model with FLD-5B | Florence-2-base-ft[[HF]](https://huggingface.co/microsoft/Florence-2-base-ft) | 0.23B | Finetuned model on a colletion of downstream tasks | Florence-2-large-ft[[HF]](https://huggingface.co/microsoft/Florence-2-large-ft) | 0.77B | Finetuned model on a colletion of downstream tasks ## How to Get Started with the Model Use the code below to get started with the model. ```python import requests from PIL import Image from transformers import AutoProcessor, AutoModelForCausalLM model = AutoModelForCausalLM.from_pretrained("microsoft/Florence-2-large", trust_remote_code=True) processor = AutoProcessor.from_pretrained("microsoft/Florence-2-large", trust_remote_code=True) prompt = "<OD>" url = "https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/tasks/car.jpg?download=true" image = Image.open(requests.get(url, stream=True).raw) inputs = processor(text=prompt, images=image, return_tensors="pt") generated_ids = model.generate( input_ids=inputs["input_ids"], pixel_values=inputs["pixel_values"], max_new_tokens=1024, num_beams=3, do_sample=False ) generated_text = processor.batch_decode(generated_ids, skip_special_tokens=False)[0] parsed_answer = processor.post_process_generation(generated_text, task="<OD>", image_size=(image.width, image.height)) print(parsed_answer) ``` ## Tasks This model is capable of performing different tasks through changing the prompts. First, let's define a function to run a prompt. <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import AutoProcessor, AutoModelForCausalLM model = AutoModelForCausalLM.from_pretrained("microsoft/Florence-2-large", trust_remote_code=True) processor = AutoProcessor.from_pretrained("microsoft/Florence-2-large", trust_remote_code=True) url = "https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/tasks/car.jpg?download=true" image = Image.open(requests.get(url, stream=True).raw) def run_example(task_prompt, text_input=None): if text_input is None: prompt = task_prompt else: prompt = task_prompt + text_input inputs = processor(text=prompt, images=image, return_tensors="pt") generated_ids = model.generate( input_ids=inputs["input_ids"], pixel_values=inputs["pixel_values"], max_new_tokens=1024, num_beams=3 ) generated_text = processor.batch_decode(generated_ids, skip_special_tokens=False)[0] parsed_answer = processor.post_process_generation(generated_text, task=task_prompt, image_size=(image.width, image.height)) print(parsed_answer) ``` </details> Here are the tasks `Florence-2` could perform: <details> <summary> Click to expand </summary> ### Caption ```python prompt = "<CAPTION>" run_example(prompt) ``` ### Detailed Caption ```python prompt = "<DETAILED_CAPTION>" run_example(prompt) ``` ### More Detailed Caption ```python prompt = "<MORE_DETAILED_CAPTION>" run_example(prompt) ``` ### Caption to Phrase Grounding caption to phrase grounding task requires additional text input, i.e. caption. Caption to phrase grounding results format: {'\<CAPTION_TO_PHRASE_GROUNDING>': {'bboxes': [[x1, y1, x2, y2], ...], 'labels': ['', '', ...]}} ```python task_prompt = "<CAPTION_TO_PHRASE_GROUNDING>" results = run_example(task_prompt, text_input="A green car parked in front of a yellow building.") ``` ### Object Detection OD results format: {'\<OD>': {'bboxes': [[x1, y1, x2, y2], ...], 'labels': ['label1', 'label2', ...]} } ```python prompt = "<OD>" run_example(prompt) ``` ### Dense Region Caption Dense region caption results format: {'\<DENSE_REGION_CAPTION>' : {'bboxes': [[x1, y1, x2, y2], ...], 'labels': ['label1', 'label2', ...]} } ```python prompt = "<DENSE_REGION_CAPTION>" run_example(prompt) ``` ### Region proposal Dense region caption results format: {'\<REGION_PROPOSAL>': {'bboxes': [[x1, y1, x2, y2], ...], 'labels': ['', '', ...]}} ```python prompt = "<REGION_PROPOSAL>" run_example(prompt) ``` ### OCR ```python prompt = "<OCR>" run_example(prompt) ``` ### OCR with Region OCR with region output format: {'\<OCR_WITH_REGION>': {'quad_boxes': [[x1, y1, x2, y2, x3, y3, x4, y4], ...], 'labels': ['text1', ...]}} ```python prompt = "<OCR_WITH_REGION>" run_example(prompt) ``` for More detailed examples, please refer to [notebook](https://huggingface.co/microsoft/Florence-2-large/blob/main/sample_inference.ipynb) </details> # Benchmarks ## Florence-2 Zero-shot performance The following table presents the zero-shot performance of generalist vision foundation models on image captioning and object detection evaluation tasks. These models have not been exposed to the training data of the evaluation tasks during their training phase. | Method | #params | COCO Cap. test CIDEr | NoCaps val CIDEr | TextCaps val CIDEr | COCO Det. val2017 mAP | |--------|---------|----------------------|------------------|--------------------|-----------------------| | Flamingo | 80B | 84.3 | - | - | - | | Florence-2-base| 0.23B | 133.0 | 118.7 | 70.1 | 34.7 | | Florence-2-large| 0.77B | 135.6 | 120.8 | 72.8 | 37.5 | The following table continues the comparison with performance on other vision-language evaluation tasks. | Method | Flickr30k test R@1 | Refcoco val Accuracy | Refcoco test-A Accuracy | Refcoco test-B Accuracy | Refcoco+ val Accuracy | Refcoco+ test-A Accuracy | Refcoco+ test-B Accuracy | Refcocog val Accuracy | Refcocog test Accuracy | Refcoco RES val mIoU | |--------|----------------------|----------------------|-------------------------|-------------------------|-----------------------|--------------------------|--------------------------|-----------------------|------------------------|----------------------| | Kosmos-2 | 78.7 | 52.3 | 57.4 | 47.3 | 45.5 | 50.7 | 42.2 | 60.6 | 61.7 | - | | Florence-2-base | 83.6 | 53.9 | 58.4 | 49.7 | 51.5 | 56.4 | 47.9 | 66.3 | 65.1 | 34.6 | | Florence-2-large | 84.4 | 56.3 | 61.6 | 51.4 | 53.6 | 57.9 | 49.9 | 68.0 | 67.0 | 35.8 | ## Florence-2 finetuned performance We finetune Florence-2 models with a collection of downstream tasks, resulting two generalist models *Florence-2-base-ft* and *Florence-2-large-ft* that can conduct a wide range of downstream tasks. The table below compares the performance of specialist and generalist models on various captioning and Visual Question Answering (VQA) tasks. Specialist models are fine-tuned specifically for each task, whereas generalist models are fine-tuned in a task-agnostic manner across all tasks. The symbol "▲" indicates the usage of external OCR as input. | Method | # Params | COCO Caption Karpathy test CIDEr | NoCaps val CIDEr | TextCaps val CIDEr | VQAv2 test-dev Acc | TextVQA test-dev Acc | VizWiz VQA test-dev Acc | |----------------|----------|-----------------------------------|------------------|--------------------|--------------------|----------------------|-------------------------| | **Specialist Models** | | | | | | | | | CoCa | 2.1B | 143.6 | 122.4 | - | 82.3 | - | - | | BLIP-2 | 7.8B | 144.5 | 121.6 | - | 82.2 | - | - | | GIT2 | 5.1B | 145.0 | 126.9 | 148.6 | 81.7 | 67.3 | 71.0 | | Flamingo | 80B | 138.1 | - | - | 82.0 | 54.1 | 65.7 | | PaLI | 17B | 149.1 | 127.0 | 160.0▲ | 84.3 | 58.8 / 73.1▲ | 71.6 / 74.4▲ | | PaLI-X | 55B | 149.2 | 126.3 | 147.0 / 163.7▲ | 86.0 | 71.4 / 80.8▲ | 70.9 / 74.6▲ | | **Generalist Models** | | | | | | | | | Unified-IO | 2.9B | - | 100.0 | - | 77.9 | - | 57.4 | | Florence-2-base-ft | 0.23B | 140.0 | 116.7 | 143.9 | 79.7 | 63.6 | 63.6 | | Florence-2-large-ft | 0.77B | 143.3 | 124.9 | 151.1 | 81.7 | 73.5 | 72.6 | | Method | # Params | COCO Det. val2017 mAP | Flickr30k test R@1 | RefCOCO val Accuracy | RefCOCO test-A Accuracy | RefCOCO test-B Accuracy | RefCOCO+ val Accuracy | RefCOCO+ test-A Accuracy | RefCOCO+ test-B Accuracy | RefCOCOg val Accuracy | RefCOCOg test Accuracy | RefCOCO RES val mIoU | |----------------------|----------|-----------------------|--------------------|----------------------|-------------------------|-------------------------|------------------------|---------------------------|---------------------------|------------------------|-----------------------|------------------------| | **Specialist Models** | | | | | | | | | | | | | | SeqTR | - | - | - | 83.7 | 86.5 | 81.2 | 71.5 | 76.3 | 64.9 | 74.9 | 74.2 | - | | PolyFormer | - | - | - | 90.4 | 92.9 | 87.2 | 85.0 | 89.8 | 78.0 | 85.8 | 85.9 | 76.9 | | UNINEXT | 0.74B | 60.6 | - | 92.6 | 94.3 | 91.5 | 85.2 | 89.6 | 79.8 | 88.7 | 89.4 | - | | Ferret | 13B | - | - | 89.5 | 92.4 | 84.4 | 82.8 | 88.1 | 75.2 | 85.8 | 86.3 | - | | **Generalist Models** | | | | | | | | | | | | | | UniTAB | - | - | - | 88.6 | 91.1 | 83.8 | 81.0 | 85.4 | 71.6 | 84.6 | 84.7 | - | | Florence-2-base-ft | 0.23B | 41.4 | 84.0 | 92.6 | 94.8 | 91.5 | 86.8 | 91.7 | 82.2 | 89.8 | 82.2 | 78.0 | | Florence-2-large-ft| 0.77B | 43.4 | 85.2 | 93.4 | 95.3 | 92.0 | 88.3 | 92.9 | 83.6 | 91.2 | 91.7 | 80.5 | ## BibTex and citation info ``` @article{xiao2023florence, title={Florence-2: Advancing a unified representation for a variety of vision tasks}, author={Xiao, Bin and Wu, Haiping and Xu, Weijian and Dai, Xiyang and Hu, Houdong and Lu, Yumao and Zeng, Michael and Liu, Ce and Yuan, Lu}, journal={arXiv preprint arXiv:2311.06242}, year={2023} } ```

mradermacher/MG-FinalMix-72B-GGUF

mradermacher

transformers

--- base_model: Undi95/MG-FinalMix-72B language: - en library_name: transformers quantized_by: mradermacher tags: - mergekit - merge - OG_finetune_merge --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: --> static quants of https://huggingface.co/Undi95/MG-FinalMix-72B <!-- provided-files --> weighted/imatrix quants are available at https://huggingface.co/mradermacher/MG-FinalMix-72B-i1-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q2_K.gguf) | Q2_K | 29.9 | | | [GGUF](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.IQ3_XS.gguf) | IQ3_XS | 32.9 | | | [GGUF](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.IQ3_S.gguf) | IQ3_S | 34.6 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q3_K_S.gguf) | Q3_K_S | 34.6 | | | [GGUF](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.IQ3_M.gguf) | IQ3_M | 35.6 | | | [GGUF](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q3_K_M.gguf) | Q3_K_M | 37.8 | lower quality | | [GGUF](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q3_K_L.gguf) | Q3_K_L | 39.6 | | | [GGUF](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.IQ4_XS.gguf) | IQ4_XS | 40.3 | | | [GGUF](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q4_K_S.gguf) | Q4_K_S | 44.0 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q4_K_M.gguf) | Q4_K_M | 47.5 | fast, recommended | | [PART 1](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q5_K_S.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q5_K_S.gguf.part2of2) | Q5_K_S | 51.5 | | | [PART 1](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q5_K_M.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q5_K_M.gguf.part2of2) | Q5_K_M | 54.5 | | | [PART 1](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q6_K.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q6_K.gguf.part2of2) | Q6_K | 64.4 | very good quality | | [PART 1](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q8_0.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/MG-FinalMix-72B-GGUF/resolve/main/MG-FinalMix-72B.Q8_0.gguf.part2of2) | Q8_0 | 77.4 | fast, best quality | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. <!-- end -->

mradermacher/gemma-2-27b-GGUF

mradermacher

transformers

--- base_model: google/gemma-2-27b extra_gated_button_content: Acknowledge license extra_gated_heading: Access Gemma on Hugging Face extra_gated_prompt: To access Gemma on Hugging Face, you’re required to review and agree to Google’s usage license. To do this, please ensure you’re logged in to Hugging Face and click below. Requests are processed immediately. language: - en library_name: transformers license: gemma quantized_by: mradermacher --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: --> static quants of https://huggingface.co/google/gemma-2-27b <!-- provided-files --> weighted/imatrix quants are available at https://huggingface.co/mradermacher/gemma-2-27b-i1-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.Q2_K.gguf) | Q2_K | 10.5 | | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.IQ3_XS.gguf) | IQ3_XS | 11.7 | | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.IQ3_S.gguf) | IQ3_S | 12.3 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.Q3_K_S.gguf) | Q3_K_S | 12.3 | | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.IQ3_M.gguf) | IQ3_M | 12.6 | | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.Q3_K_M.gguf) | Q3_K_M | 13.5 | lower quality | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.Q3_K_L.gguf) | Q3_K_L | 14.6 | | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.IQ4_XS.gguf) | IQ4_XS | 15.0 | | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.Q4_K_S.gguf) | Q4_K_S | 15.8 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.Q4_K_M.gguf) | Q4_K_M | 16.7 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.Q5_K_S.gguf) | Q5_K_S | 19.0 | | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.Q5_K_M.gguf) | Q5_K_M | 19.5 | | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.Q6_K.gguf) | Q6_K | 22.4 | very good quality | | [GGUF](https://huggingface.co/mradermacher/gemma-2-27b-GGUF/resolve/main/gemma-2-27b.Q8_0.gguf) | Q8_0 | 29.0 | fast, best quality | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. <!-- end -->

tiiuae/falcon-40b-instruct

tiiuae

transformers

text-generation

--- datasets: - tiiuae/falcon-refinedweb language: - en inference: false license: apache-2.0 --- # ✨ Falcon-40B-Instruct **Falcon-40B-Instruct is a 40B parameters causal decoder-only model built by [TII](https://www.tii.ae) based on [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b) and finetuned on a mixture of [Baize](https://github.com/project-baize/baize-chatbot). It is made available under the Apache 2.0 license.** *Paper coming soon 😊.* 🤗 To get started with Falcon (inference, finetuning, quantization, etc.), we recommend reading [this great blogpost fron HF](https://huggingface.co/blog/falcon)! ## Why use Falcon-40B-Instruct? * **You are looking for a ready-to-use chat/instruct model based on [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b).** * **Falcon-40B is the best open-source model available.** It outperforms [LLaMA](https://github.com/facebookresearch/llama), [StableLM](https://github.com/Stability-AI/StableLM), [RedPajama](https://huggingface.co/togethercomputer/RedPajama-INCITE-Base-7B-v0.1), [MPT](https://huggingface.co/mosaicml/mpt-7b), etc. See the [OpenLLM Leaderboard](https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard). * **It features an architecture optimized for inference**, with FlashAttention ([Dao et al., 2022](https://arxiv.org/abs/2205.14135)) and multiquery ([Shazeer et al., 2019](https://arxiv.org/abs/1911.02150)). 💬 **This is an instruct model, which may not be ideal for further finetuning.** If you are interested in building your own instruct/chat model, we recommend starting from [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b). 💸 **Looking for a smaller, less expensive model?** [Falcon-7B-Instruct](https://huggingface.co/tiiuae/falcon-7b-instruct) is Falcon-40B-Instruct's little brother! ```python from transformers import AutoTokenizer, AutoModelForCausalLM import transformers import torch model = "tiiuae/falcon-40b-instruct" tokenizer = AutoTokenizer.from_pretrained(model) pipeline = transformers.pipeline( "text-generation", model=model, tokenizer=tokenizer, torch_dtype=torch.bfloat16, trust_remote_code=True, device_map="auto", ) sequences = pipeline( "Girafatron is obsessed with giraffes, the most glorious animal on the face of this Earth. Giraftron believes all other animals are irrelevant when compared to the glorious majesty of the giraffe.\nDaniel: Hello, Girafatron!\nGirafatron:", max_length=200, do_sample=True, top_k=10, num_return_sequences=1, eos_token_id=tokenizer.eos_token_id, ) for seq in sequences: print(f"Result: {seq['generated_text']}") ``` For fast inference with Falcon, check-out [Text Generation Inference](https://github.com/huggingface/text-generation-inference)! Read more in this [blogpost]((https://huggingface.co/blog/falcon). You will need **at least 85-100GB of memory** to swiftly run inference with Falcon-40B. # Model Card for Falcon-40B-Instruct ## Model Details ### Model Description - **Developed by:** [https://www.tii.ae](https://www.tii.ae); - **Model type:** Causal decoder-only; - **Language(s) (NLP):** English and French; - **License:** Apache 2.0; - **Finetuned from model:** [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b). ### Model Source - **Paper:** *coming soon*. ## Uses ### Direct Use Falcon-40B-Instruct has been finetuned on a chat dataset. ### Out-of-Scope Use Production use without adequate assessment of risks and mitigation; any use cases which may be considered irresponsible or harmful. ## Bias, Risks, and Limitations Falcon-40B-Instruct is mostly trained on English data, and will not generalize appropriately to other languages. Furthermore, as it is trained on a large-scale corpora representative of the web, it will carry the stereotypes and biases commonly encountered online. ### Recommendations We recommend users of Falcon-40B-Instruct to develop guardrails and to take appropriate precautions for any production use. ## How to Get Started with the Model ```python from transformers import AutoTokenizer, AutoModelForCausalLM import transformers import torch model = "tiiuae/falcon-40b-instruct" tokenizer = AutoTokenizer.from_pretrained(model) pipeline = transformers.pipeline( "text-generation", model=model, tokenizer=tokenizer, torch_dtype=torch.bfloat16, trust_remote_code=True, device_map="auto", ) sequences = pipeline( "Girafatron is obsessed with giraffes, the most glorious animal on the face of this Earth. Giraftron believes all other animals are irrelevant when compared to the glorious majesty of the giraffe.\nDaniel: Hello, Girafatron!\nGirafatron:", max_length=200, do_sample=True, top_k=10, num_return_sequences=1, eos_token_id=tokenizer.eos_token_id, ) for seq in sequences: print(f"Result: {seq['generated_text']}") ``` ## Training Details ### Training Data Falcon-40B-Instruct was finetuned on a 150M tokens from [Bai ze](https://github.com/project-baize/baize-chatbot) mixed with 5% of [RefinedWeb](https://huggingface.co/datasets/tiiuae/falcon-refinedweb) data. The data was tokenized with the Falcon-[7B](https://huggingface.co/tiiuae/falcon-7b)/[40B](https://huggingface.co/tiiuae/falcon-40b) tokenizer. ## Evaluation *Paper coming soon.* See the [OpenLLM Leaderboard](https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard) for early results. ## Technical Specifications For more information about pretraining, see [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b). ### Model Architecture and Objective Falcon-40B is a causal decoder-only model trained on a causal language modeling task (i.e., predict the next token). The architecture is broadly adapted from the GPT-3 paper ([Brown et al., 2020](https://arxiv.org/abs/2005.14165)), with the following differences: * **Positionnal embeddings:** rotary ([Su et al., 2021](https://arxiv.org/abs/2104.09864)); * **Attention:** multiquery ([Shazeer et al., 2019](https://arxiv.org/abs/1911.02150)) and FlashAttention ([Dao et al., 2022](https://arxiv.org/abs/2205.14135)); * **Decoder-block:** parallel attention/MLP with a single layer norm. For multiquery, we are using an internal variant which uses independent key and values per tensor parallel degree. | **Hyperparameter** | **Value** | **Comment** | |--------------------|-----------|----------------------------------------| | Layers | 60 | | | `d_model` | 8192 | | | `head_dim` | 64 | Reduced to optimise for FlashAttention | | Vocabulary | 65024 | | | Sequence length | 2048 | | ### Compute Infrastructure #### Hardware Falcon-40B-Instruct was trained on AWS SageMaker, on 64 A100 40GB GPUs in P4d instances. #### Software Falcon-40B-Instruct was trained a custom distributed training codebase, Gigatron. It uses a 3D parallelism approach combined with ZeRO and high-performance Triton kernels (FlashAttention, etc.) ## Citation *Paper coming soon* 😊. In the meanwhile, you can use the following information to cite: ``` @article{falcon40b, title={{Falcon-40B}: an open large language model with state-of-the-art performance}, author={Almazrouei, Ebtesam and Alobeidli, Hamza and Alshamsi, Abdulaziz and Cappelli, Alessandro and Cojocaru, Ruxandra and Debbah, Merouane and Goffinet, Etienne and Heslow, Daniel and Launay, Julien and Malartic, Quentin and Noune, Badreddine and Pannier, Baptiste and Penedo, Guilherme}, year={2023} } ``` To learn more about the pretraining dataset, see the 📓 [RefinedWeb paper](https://arxiv.org/abs/2306.01116). ``` @article{refinedweb, title={The {R}efined{W}eb dataset for {F}alcon {LLM}: outperforming curated corpora with web data, and web data only}, author={Guilherme Penedo and Quentin Malartic and Daniel Hesslow and Ruxandra Cojocaru and Alessandro Cappelli and Hamza Alobeidli and Baptiste Pannier and Ebtesam Almazrouei and Julien Launay}, journal={arXiv preprint arXiv:2306.01116}, eprint={2306.01116}, eprinttype = {arXiv}, url={https://arxiv.org/abs/2306.01116}, year={2023} } ``` To cite the [Baize](https://github.com/project-baize/baize-chatbot) instruction dataset used for this model: ``` @article{xu2023baize, title={Baize: An Open-Source Chat Model with Parameter-Efficient Tuning on Self-Chat Data}, author={Xu, Canwen and Guo, Daya and Duan, Nan and McAuley, Julian}, journal={arXiv preprint arXiv:2304.01196}, year={2023} } ``` ## License Falcon-40B-Instruct is made available under the Apache 2.0 license. ## Contact falconllm@tii.ae

mradermacher/Yi-34B-200K-Llamafied-GGUF

mradermacher

transformers

--- base_model: larryvrh/Yi-34B-200K-Llamafied language: - zh - en library_name: transformers license: apache-2.0 quantized_by: mradermacher --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: --> static quants of https://huggingface.co/larryvrh/Yi-34B-200K-Llamafied <!-- provided-files --> weighted/imatrix quants are available at https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-i1-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.Q2_K.gguf) | Q2_K | 12.9 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.IQ3_XS.gguf) | IQ3_XS | 14.3 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.Q3_K_S.gguf) | Q3_K_S | 15.1 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.IQ3_S.gguf) | IQ3_S | 15.1 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.IQ3_M.gguf) | IQ3_M | 15.7 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.Q3_K_M.gguf) | Q3_K_M | 16.8 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.Q3_K_L.gguf) | Q3_K_L | 18.2 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.IQ4_XS.gguf) | IQ4_XS | 18.7 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.Q4_K_S.gguf) | Q4_K_S | 19.7 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.Q4_K_M.gguf) | Q4_K_M | 20.8 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.Q5_K_S.gguf) | Q5_K_S | 23.8 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.Q5_K_M.gguf) | Q5_K_M | 24.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.Q6_K.gguf) | Q6_K | 28.3 | very good quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-Llamafied-GGUF/resolve/main/Yi-34B-200K-Llamafied.Q8_0.gguf) | Q8_0 | 36.6 | fast, best quality | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. <!-- end -->

Rostlab/prot_t5_xl_half_uniref50-enc

Rostlab

transformers

--- tags: - protein language model datasets: - UniRef50 --- # Encoder only ProtT5-XL-UniRef50, half-precision model An encoder-only, half-precision version of the [ProtT5-XL-UniRef50](https://huggingface.co/Rostlab/prot_t5_xl_uniref50) model. The original model and it's pretraining were introduced in [this paper](https://doi.org/10.1101/2020.07.12.199554) and first released in [this repository](https://github.com/agemagician/ProtTrans). This model is trained on uppercase amino acids: it only works with capital letter amino acids. ## Model description ProtT5-XL-UniRef50 is based on the `t5-3b` model and was pretrained on a large corpus of protein sequences in a self-supervised fashion. This means it was pretrained on the raw protein sequences only, with no humans labelling them in any way (which is why it can use lots of publicly available data) with an automatic process to generate inputs and labels from those protein sequences. One important difference between this T5 model and the original T5 version is the denoising objective. The original T5-3B model was pretrained using a span denoising objective, while this model was pretrained with a Bart-like MLM denoising objective. The masking probability is consistent with the original T5 training by randomly masking 15% of the amino acids in the input. This model only contains the encoder portion of the original ProtT5-XL-UniRef50 model using half precision (float16). As such, this model can efficiently be used to create protein/ amino acid representations. When used for training downstream networks/ feature extraction, these embeddings produced the same performance (established empirically by comparing on several downstream tasks). ## Intended uses & limitations This version of the original ProtT5-XL-UniRef50 is mostly meant for conveniently creating amino-acid or protein embeddings with a low GPU-memory footprint without any measurable performance-decrease in our experiments. This model is fully usable on 8 GB of video RAM. ### How to use An extensive, interactive example on how to use this model for common tasks can be found [on Google Colab](https://colab.research.google.com/drive/1TUj-ayG3WO52n5N50S7KH9vtt6zRkdmj?usp=sharing#scrollTo=ET2v51slC5ui) Here is how to use this model to extract the features of a given protein sequence in PyTorch: ```python sequence_examples = ["PRTEINO", "SEQWENCE"] # this will replace all rare/ambiguous amino acids by X and introduce white-space between all amino acids sequence_examples = [" ".join(list(re.sub(r"[UZOB]", "X", sequence))) for sequence in sequence_examples] # tokenize sequences and pad up to the longest sequence in the batch ids = tokenizer.batch_encode_plus(sequence_examples, add_special_tokens=True, padding="longest") input_ids = torch.tensor(ids['input_ids']).to(device) attention_mask = torch.tensor(ids['attention_mask']).to(device) # generate embeddings with torch.no_grad(): embedding_repr = model(input_ids=input_ids,attention_mask=attention_mask) # extract embeddings for the first ([0,:]) sequence in the batch while removing padded & special tokens ([0,:7]) emb_0 = embedding_repr.last_hidden_state[0,:7] # shape (7 x 1024) print(f"Shape of per-residue embedding of first sequences: {emb_0.shape}") # do the same for the second ([1,:]) sequence in the batch while taking into account different sequence lengths ([1,:8]) emb_1 = embedding_repr.last_hidden_state[1,:8] # shape (8 x 1024) # if you want to derive a single representation (per-protein embedding) for the whole protein emb_0_per_protein = emb_0.mean(dim=0) # shape (1024) print(f"Shape of per-protein embedding of first sequences: {emb_0_per_protein.shape}") ``` **NOTE**: Please make sure to explicitly set the model to `float16` (`T5EncoderModel.from_pretrained('Rostlab/prot_t5_xl_half_uniref50-enc', torch_dtype=torch.float16)`) otherwise, the generated embeddings will be full precision. **NOTE**: Currently (06/2022) half-precision models cannot be used on CPU. If you want to use the encoder only version on CPU, you need to cast it to its full-precision version (`model=model.float()`). ### BibTeX entry and citation info ```bibtex @article {Elnaggar2020.07.12.199554, author = {Elnaggar, Ahmed and Heinzinger, Michael and Dallago, Christian and Rehawi, Ghalia and Wang, Yu and Jones, Llion and Gibbs, Tom and Feher, Tamas and Angerer, Christoph and Steinegger, Martin and BHOWMIK, DEBSINDHU and Rost, Burkhard}, title = {ProtTrans: Towards Cracking the Language of Life{\textquoteright}s Code Through Self-Supervised Deep Learning and High Performance Computing}, elocation-id = {2020.07.12.199554}, year = {2020}, doi = {10.1101/2020.07.12.199554}, publisher = {Cold Spring Harbor Laboratory}, abstract = {Computational biology and bioinformatics provide vast data gold-mines from protein sequences, ideal for Language Models (LMs) taken from Natural Language Processing (NLP). These LMs reach for new prediction frontiers at low inference costs. Here, we trained two auto-regressive language models (Transformer-XL, XLNet) and two auto-encoder models (Bert, Albert) on data from UniRef and BFD containing up to 393 billion amino acids (words) from 2.1 billion protein sequences (22- and 112 times the entire English Wikipedia). The LMs were trained on the Summit supercomputer at Oak Ridge National Laboratory (ORNL), using 936 nodes (total 5616 GPUs) and one TPU Pod (V3-512 or V3-1024). We validated the advantage of up-scaling LMs to larger models supported by bigger data by predicting secondary structure (3-states: Q3=76-84, 8 states: Q8=65-73), sub-cellular localization for 10 cellular compartments (Q10=74) and whether a protein is membrane-bound or water-soluble (Q2=89). Dimensionality reduction revealed that the LM-embeddings from unlabeled data (only protein sequences) captured important biophysical properties governing protein shape. This implied learning some of the grammar of the language of life realized in protein sequences. The successful up-scaling of protein LMs through HPC to larger data sets slightly reduced the gap between models trained on evolutionary information and LMs. Availability ProtTrans: \&lt;a href="https://github.com/agemagician/ProtTrans"\&gt;https://github.com/agemagician/ProtTrans\&lt;/a\&gt;Competing Interest StatementThe authors have declared no competing interest.}, URL = {https://www.biorxiv.org/content/early/2020/07/21/2020.07.12.199554}, eprint = {https://www.biorxiv.org/content/early/2020/07/21/2020.07.12.199554.full.pdf}, journal = {bioRxiv} } ```

sileod/deberta-v3-small-tasksource-nli

sileod

transformers

zero-shot-classification

--- license: apache-2.0 language: en tags: - deberta-v3-small - deberta-v3 - deberta - text-classification - nli - natural-language-inference - multitask - multi-task - pipeline - extreme-multi-task - extreme-mtl - tasksource - zero-shot - rlhf datasets: - nyu-mll/glue - super_glue - facebook/anli - tasksource/babi_nli - sick - snli - scitail - OpenAssistant/oasst1 - universal_dependencies - hans - qbao775/PARARULE-Plus - alisawuffles/WANLI - metaeval/recast - sileod/probability_words_nli - joey234/nan-nli - pietrolesci/nli_fever - pietrolesci/breaking_nli - pietrolesci/conj_nli - pietrolesci/fracas - pietrolesci/dialogue_nli - pietrolesci/mpe - pietrolesci/dnc - pietrolesci/gpt3_nli - pietrolesci/recast_white - pietrolesci/joci - martn-nguyen/contrast_nli - pietrolesci/robust_nli - pietrolesci/robust_nli_is_sd - pietrolesci/robust_nli_li_ts - pietrolesci/gen_debiased_nli - pietrolesci/add_one_rte - metaeval/imppres - pietrolesci/glue_diagnostics - hlgd - PolyAI/banking77 - paws - quora - medical_questions_pairs - conll2003 - nlpaueb/finer-139 - Anthropic/hh-rlhf - Anthropic/model-written-evals - truthful_qa - nightingal3/fig-qa - tasksource/bigbench - blimp - cos_e - cosmos_qa - dream - openbookqa - qasc - quartz - quail - head_qa - sciq - social_i_qa - wiki_hop - wiqa - piqa - hellaswag - pkavumba/balanced-copa - 12ml/e-CARE - art - tasksource/mmlu - winogrande - codah - ai2_arc - definite_pronoun_resolution - swag - math_qa - metaeval/utilitarianism - mteb/amazon_counterfactual - SetFit/insincere-questions - SetFit/toxic_conversations - turingbench/TuringBench - trec - tals/vitaminc - hope_edi - strombergnlp/rumoureval_2019 - ethos - tweet_eval - discovery - pragmeval - silicone - lex_glue - papluca/language-identification - imdb - rotten_tomatoes - ag_news - yelp_review_full - financial_phrasebank - poem_sentiment - dbpedia_14 - amazon_polarity - app_reviews - hate_speech18 - sms_spam - humicroedit - snips_built_in_intents - banking77 - hate_speech_offensive - yahoo_answers_topics - pacovaldez/stackoverflow-questions - zapsdcn/hyperpartisan_news - zapsdcn/sciie - zapsdcn/citation_intent - go_emotions - allenai/scicite - liar - relbert/lexical_relation_classification - metaeval/linguisticprobing - tasksource/crowdflower - metaeval/ethics - emo - google_wellformed_query - tweets_hate_speech_detection - has_part - wnut_17 - ncbi_disease - acronym_identification - jnlpba - species_800 - SpeedOfMagic/ontonotes_english - blog_authorship_corpus - launch/open_question_type - health_fact - commonsense_qa - mc_taco - ade_corpus_v2 - prajjwal1/discosense - circa - PiC/phrase_similarity - copenlu/scientific-exaggeration-detection - quarel - mwong/fever-evidence-related - numer_sense - dynabench/dynasent - raquiba/Sarcasm_News_Headline - sem_eval_2010_task_8 - demo-org/auditor_review - medmcqa - aqua_rat - RuyuanWan/Dynasent_Disagreement - RuyuanWan/Politeness_Disagreement - RuyuanWan/SBIC_Disagreement - RuyuanWan/SChem_Disagreement - RuyuanWan/Dilemmas_Disagreement - lucasmccabe/logiqa - wiki_qa - metaeval/cycic_classification - metaeval/cycic_multiplechoice - metaeval/sts-companion - metaeval/commonsense_qa_2.0 - metaeval/lingnli - metaeval/monotonicity-entailment - metaeval/arct - metaeval/scinli - metaeval/naturallogic - onestop_qa - demelin/moral_stories - corypaik/prost - aps/dynahate - metaeval/syntactic-augmentation-nli - metaeval/autotnli - lasha-nlp/CONDAQA - openai/webgpt_comparisons - Dahoas/synthetic-instruct-gptj-pairwise - metaeval/scruples - metaeval/wouldyourather - sileod/attempto-nli - metaeval/defeasible-nli - metaeval/help-nli - metaeval/nli-veridicality-transitivity - metaeval/natural-language-satisfiability - metaeval/lonli - tasksource/dadc-limit-nli - ColumbiaNLP/FLUTE - metaeval/strategy-qa - openai/summarize_from_feedback - tasksource/folio - metaeval/tomi-nli - metaeval/avicenna - stanfordnlp/SHP - GBaker/MedQA-USMLE-4-options-hf - GBaker/MedQA-USMLE-4-options - sileod/wikimedqa - declare-lab/cicero - amydeng2000/CREAK - metaeval/mutual - inverse-scaling/NeQA - inverse-scaling/quote-repetition - inverse-scaling/redefine-math - tasksource/puzzte - metaeval/implicatures - race - metaeval/spartqa-yn - metaeval/spartqa-mchoice - metaeval/temporal-nli - metaeval/ScienceQA_text_only - AndyChiang/cloth - metaeval/logiqa-2.0-nli - tasksource/oasst1_dense_flat - metaeval/boolq-natural-perturbations - metaeval/path-naturalness-prediction - riddle_sense - Jiangjie/ekar_english - metaeval/implicit-hate-stg1 - metaeval/chaos-mnli-ambiguity - IlyaGusev/headline_cause - metaeval/race-c - metaeval/equate - metaeval/ambient - AndyChiang/dgen - metaeval/clcd-english - civil_comments - metaeval/acceptability-prediction - maximedb/twentyquestions - metaeval/counterfactually-augmented-snli - tasksource/I2D2 - sileod/mindgames - metaeval/counterfactually-augmented-imdb - metaeval/cnli - metaeval/reclor - tasksource/oasst1_pairwise_rlhf_reward - tasksource/zero-shot-label-nli - webis/args_me - webis/Touche23-ValueEval - tasksource/starcon - tasksource/ruletaker - lighteval/lsat_qa - tasksource/ConTRoL-nli - tasksource/tracie - tasksource/sherliic - tasksource/sen-making - tasksource/winowhy - mediabiasgroup/mbib-base - tasksource/robustLR - CLUTRR/v1 - tasksource/logical-fallacy - tasksource/parade - tasksource/cladder - tasksource/subjectivity - tasksource/MOH - tasksource/VUAC - tasksource/TroFi - sharc_modified - tasksource/conceptrules_v2 - tasksource/disrpt - conll2000 - DFKI-SLT/few-nerd - tasksource/com2sense - tasksource/scone - tasksource/winodict - tasksource/fool-me-twice - tasksource/monli - tasksource/corr2cause - tasksource/apt - zeroshot/twitter-financial-news-sentiment - tasksource/icl-symbol-tuning-instruct - tasksource/SpaceNLI - sihaochen/propsegment - HannahRoseKirk/HatemojiBuild - tasksource/regset - tasksource/babi_nli - lmsys/chatbot_arena_conversations metrics: - accuracy library_name: transformers pipeline_tag: zero-shot-classification --- # Model Card for DeBERTa-v3-small-tasksource-nli This is [DeBERTa-v3-small](https://hf.co/microsoft/deberta-v3-small) fine-tuned with multi-task learning on 600+ tasks of the [tasksource collection](https://github.com/sileod/tasksource/). This checkpoint has strong zero-shot validation performance on many tasks, and can be used for: - Zero-shot entailment-based classification for arbitrary labels [ZS]. - Natural language inference [NLI] - Hundreds of previous tasks with tasksource-adapters [TA]. - Further fine-tuning on a new task or tasksource task (classification, token classification or multiple-choice) [FT]. # [ZS] Zero-shot classification pipeline ```python from transformers import pipeline classifier = pipeline("zero-shot-classification",model="sileod/deberta-v3-small-tasksource-nli") text = "one day I will see the world" candidate_labels = ['travel', 'cooking', 'dancing'] classifier(text, candidate_labels) ``` NLI training data of this model includes [label-nli](https://huggingface.co/datasets/tasksource/zero-shot-label-nli), a NLI dataset specially constructed to improve this kind of zero-shot classification. # [NLI] Natural language inference pipeline ```python from transformers import pipeline pipe = pipeline("text-classification",model="sileod/deberta-v3-small-tasksource-nli") pipe([dict(text='there is a cat', text_pair='there is a black cat')]) #list of (premise,hypothesis) # [{'label': 'neutral', 'score': 0.9952911138534546}] ``` # [TA] Tasksource-adapters: 1 line access to hundreds of tasks ```python # !pip install tasknet import tasknet as tn pipe = tn.load_pipeline('sileod/deberta-v3-small-tasksource-nli','glue/sst2') # works for 500+ tasksource tasks pipe(['That movie was great !', 'Awful movie.']) # [{'label': 'positive', 'score': 0.9956}, {'label': 'negative', 'score': 0.9967}] ``` The list of tasks is available in model config.json. This is more efficient than ZS since it requires only one forward pass per example, but it is less flexible. # [FT] Tasknet: 3 lines fine-tuning ```python # !pip install tasknet import tasknet as tn hparams=dict(model_name='sileod/deberta-v3-small-tasksource-nli', learning_rate=2e-5) model, trainer = tn.Model_Trainer([tn.AutoTask("glue/rte")], hparams) trainer.train() ``` ## Evaluation This the base equivalent of this model was ranked 1st among all models with the microsoft/deberta-v3-base architecture according to the IBM model recycling evaluation. https://ibm.github.io/model-recycling/ ### Software and training details The model was trained on 600 tasks for 200k steps with a batch size of 384 and a peak learning rate of 2e-5. Training took 12 days on Nvidia A30 24GB gpu. This is the shared model with the MNLI classifier on top. Each task had a specific CLS embedding, which is dropped 10% of the time to facilitate model use without it. All multiple-choice model used the same classification layers. For classification tasks, models shared weights if their labels matched. https://github.com/sileod/tasksource/ \ https://github.com/sileod/tasknet/ \ Training code: https://colab.research.google.com/drive/1iB4Oxl9_B5W3ZDzXoWJN-olUbqLBxgQS?usp=sharing # Citation More details on this [article:](https://arxiv.org/abs/2301.05948) ``` @article{sileo2023tasksource, title={tasksource: Structured Dataset Preprocessing Annotations for Frictionless Extreme Multi-Task Learning and Evaluation}, author={Sileo, Damien}, url= {https://arxiv.org/abs/2301.05948}, journal={arXiv preprint arXiv:2301.05948}, year={2023} } ``` # Model Card Contact damien.sileo@inria.fr </details>

bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF

bartowski

transformers

text-generation

--- library_name: transformers license: llama3 datasets: - aqua_rat - microsoft/orca-math-word-problems-200k - m-a-p/CodeFeedback-Filtered-Instruction quantized_by: bartowski pipeline_tag: text-generation base_model: abacusai/Smaug-Llama-3-70B-Instruct-32K --- ## Llamacpp imatrix Quantizations of Smaug-Llama-3-70B-Instruct-32K Using <a href="https://github.com/ggerganov/llama.cpp/">llama.cpp</a> release <a href="https://github.com/ggerganov/llama.cpp/releases/tag/b3197">b3197</a> for quantization. Original model: https://huggingface.co/abacusai/Smaug-Llama-3-70B-Instruct-32K All quants made using imatrix option with dataset from [here](https://gist.github.com/bartowski1182/eb213dccb3571f863da82e99418f81e8) ## Prompt format ``` <|begin_of_text|><|start_header_id|>system<|end_header_id|> {system_prompt}<|eot_id|><|start_header_id|>user<|end_header_id|> {prompt}<|eot_id|><|start_header_id|>assistant<|end_header_id|> ``` ## Download a file (not the whole branch) from below: | Filename | Quant type | File Size | Description | | -------- | ---------- | --------- | ----------- | | [Smaug-Llama-3-70B-Instruct-32K-Q8_0.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/tree/main/Smaug-Llama-3-70B-Instruct-32K-Q8_0.gguf) | Q8_0 | 74.97GB | Extremely high quality, generally unneeded but max available quant. | | [Smaug-Llama-3-70B-Instruct-32K-Q6_K.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/tree/main/Smaug-Llama-3-70B-Instruct-32K-Q6_K.gguf) | Q6_K | 57.88GB | Very high quality, near perfect, *recommended*. | | [Smaug-Llama-3-70B-Instruct-32K-Q5_K_L.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/tree/main/Smaug-Llama-3-70B-Instruct-32K-Q5_K_L.gguf) | Q5_K_L | 52.56GB | *Experimental*, uses f16 for embed and output weights. Please provide any feedback of differences. High quality, *recommended*. | | [Smaug-Llama-3-70B-Instruct-32K-Q5_K_M.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-Q5_K_M.gguf) | Q5_K_M | 49.94GB | High quality, *recommended*. | | [Smaug-Llama-3-70B-Instruct-32K-Q4_K_L.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-Q4_K_L.gguf) | Q4_K_L | 45.27GB | *Experimental*, uses f16 for embed and output weights. Please provide any feedback of differences. Good quality, uses about 4.83 bits per weight, *recommended*. | | [Smaug-Llama-3-70B-Instruct-32K-Q4_K_M.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-Q4_K_M.gguf) | Q4_K_M | 42.52GB | Good quality, uses about 4.83 bits per weight, *recommended*. | | [Smaug-Llama-3-70B-Instruct-32K-IQ4_XS.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-IQ4_XS.gguf) | IQ4_XS | 37.90GB | Decent quality, smaller than Q4_K_S with similar performance, *recommended*. | | [Smaug-Llama-3-70B-Instruct-32K-Q3_K_XL.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-Q3_K_XL.gguf) | Q3_K_XL | 40.00GB | *Experimental*, uses f16 for embed and output weights. Please provide any feedback of differences. Medium low quality. | | [Smaug-Llama-3-70B-Instruct-32K-Q3_K_M.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-Q3_K_M.gguf) | Q3_K_M | 34.26GB | Even lower quality. | | [Smaug-Llama-3-70B-Instruct-32K-IQ3_M.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-IQ3_M.gguf) | IQ3_M | 31.93GB | Medium-low quality, new method with decent performance comparable to Q3_K_M. | | [Smaug-Llama-3-70B-Instruct-32K-Q3_K_S.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-Q3_K_S.gguf) | Q3_K_S | 30.91GB | Low quality, not recommended. | | [Smaug-Llama-3-70B-Instruct-32K-IQ3_XXS.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-IQ3_XXS.gguf) | IQ3_XXS | 27.46GB | Lower quality, new method with decent performance, comparable to Q3 quants. | | [Smaug-Llama-3-70B-Instruct-32K-Q2_K_L.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-Q2_K_L.gguf) | Q2_K_L | 29.40GB | *Experimental*, uses f16 for embed and output weights. Please provide any feedback of differences. Very low quality but surprisingly usable. | | [Smaug-Llama-3-70B-Instruct-32K-Q2_K.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-Q2_K.gguf) | Q2_K | 26.37GB | Very low quality but surprisingly usable. | | [Smaug-Llama-3-70B-Instruct-32K-IQ2_M.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-IQ2_M.gguf) | IQ2_M | 24.11GB | Very low quality, uses SOTA techniques to also be surprisingly usable. | | [Smaug-Llama-3-70B-Instruct-32K-IQ2_XS.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-IQ2_XS.gguf) | IQ2_XS | 21.14GB | Lower quality, uses SOTA techniques to be usable. | | [Smaug-Llama-3-70B-Instruct-32K-IQ2_XXS.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-IQ2_XXS.gguf) | IQ2_XXS | 19.09GB | Lower quality, uses SOTA techniques to be usable. | | [Smaug-Llama-3-70B-Instruct-32K-IQ1_M.gguf](https://huggingface.co/bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF/blob/main/Smaug-Llama-3-70B-Instruct-32K-IQ1_M.gguf) | IQ1_M | 16.75GB | Extremely low quality, *not* recommended. | ## Downloading using huggingface-cli First, make sure you have hugginface-cli installed: ``` pip install -U "huggingface_hub[cli]" ``` Then, you can target the specific file you want: ``` huggingface-cli download bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF --include "Smaug-Llama-3-70B-Instruct-32K-Q4_K_M.gguf" --local-dir ./ ``` If the model is bigger than 50GB, it will have been split into multiple files. In order to download them all to a local folder, run: ``` huggingface-cli download bartowski/Smaug-Llama-3-70B-Instruct-32K-GGUF --include "Smaug-Llama-3-70B-Instruct-32K-Q8_0.gguf/*" --local-dir Smaug-Llama-3-70B-Instruct-32K-Q8_0 ``` You can either specify a new local-dir (Smaug-Llama-3-70B-Instruct-32K-Q8_0) or download them all in place (./) ## Which file should I choose? A great write up with charts showing various performances is provided by Artefact2 [here](https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9) The first thing to figure out is how big a model you can run. To do this, you'll need to figure out how much RAM and/or VRAM you have. If you want your model running as FAST as possible, you'll want to fit the whole thing on your GPU's VRAM. Aim for a quant with a file size 1-2GB smaller than your GPU's total VRAM. If you want the absolute maximum quality, add both your system RAM and your GPU's VRAM together, then similarly grab a quant with a file size 1-2GB Smaller than that total. Next, you'll need to decide if you want to use an 'I-quant' or a 'K-quant'. If you don't want to think too much, grab one of the K-quants. These are in format 'QX_K_X', like Q5_K_M. If you want to get more into the weeds, you can check out this extremely useful feature chart: [llama.cpp feature matrix](https://github.com/ggerganov/llama.cpp/wiki/Feature-matrix) But basically, if you're aiming for below Q4, and you're running cuBLAS (Nvidia) or rocBLAS (AMD), you should look towards the I-quants. These are in format IQX_X, like IQ3_M. These are newer and offer better performance for their size. These I-quants can also be used on CPU and Apple Metal, but will be slower than their K-quant equivalent, so speed vs performance is a tradeoff you'll have to decide. The I-quants are *not* compatible with Vulcan, which is also AMD, so if you have an AMD card double check if you're using the rocBLAS build or the Vulcan build. At the time of writing this, LM Studio has a preview with ROCm support, and other inference engines have specific builds for ROCm. Want to support my work? Visit my ko-fi page here: https://ko-fi.com/bartowski

distilbert/distilbert-base-uncased-distilled-squad

distilbert

transformers

question-answering

--- language: en datasets: - squad widget: - text: "Which name is also used to describe the Amazon rainforest in English?" context: "The Amazon rainforest (Portuguese: Floresta Amazônica or Amazônia; Spanish: Selva Amazónica, Amazonía or usually Amazonia; French: Forêt amazonienne; Dutch: Amazoneregenwoud), also known in English as Amazonia or the Amazon Jungle, is a moist broadleaf forest that covers most of the Amazon basin of South America. This basin encompasses 7,000,000 square kilometres (2,700,000 sq mi), of which 5,500,000 square kilometres (2,100,000 sq mi) are covered by the rainforest. This region includes territory belonging to nine nations. The majority of the forest is contained within Brazil, with 60% of the rainforest, followed by Peru with 13%, Colombia with 10%, and with minor amounts in Venezuela, Ecuador, Bolivia, Guyana, Suriname and French Guiana. States or departments in four nations contain \"Amazonas\" in their names. The Amazon represents over half of the planet's remaining rainforests, and comprises the largest and most biodiverse tract of tropical rainforest in the world, with an estimated 390 billion individual trees divided into 16,000 species." - text: "How many square kilometers of rainforest is covered in the basin?" context: "The Amazon rainforest (Portuguese: Floresta Amazônica or Amazônia; Spanish: Selva Amazónica, Amazonía or usually Amazonia; French: Forêt amazonienne; Dutch: Amazoneregenwoud), also known in English as Amazonia or the Amazon Jungle, is a moist broadleaf forest that covers most of the Amazon basin of South America. This basin encompasses 7,000,000 square kilometres (2,700,000 sq mi), of which 5,500,000 square kilometres (2,100,000 sq mi) are covered by the rainforest. This region includes territory belonging to nine nations. The majority of the forest is contained within Brazil, with 60% of the rainforest, followed by Peru with 13%, Colombia with 10%, and with minor amounts in Venezuela, Ecuador, Bolivia, Guyana, Suriname and French Guiana. States or departments in four nations contain \"Amazonas\" in their names. The Amazon represents over half of the planet's remaining rainforests, and comprises the largest and most biodiverse tract of tropical rainforest in the world, with an estimated 390 billion individual trees divided into 16,000 species." license: apache-2.0 --- # DistilBERT base uncased distilled SQuAD ## Table of Contents - [Model Details](#model-details) - [How To Get Started With the Model](#how-to-get-started-with-the-model) - [Uses](#uses) - [Risks, Limitations and Biases](#risks-limitations-and-biases) - [Training](#training) - [Evaluation](#evaluation) - [Environmental Impact](#environmental-impact) - [Technical Specifications](#technical-specifications) - [Citation Information](#citation-information) - [Model Card Authors](#model-card-authors) ## Model Details **Model Description:** The DistilBERT model was proposed in the blog post [Smaller, faster, cheaper, lighter: Introducing DistilBERT, adistilled version of BERT](https://medium.com/huggingface/distilbert-8cf3380435b5), and the paper [DistilBERT, adistilled version of BERT: smaller, faster, cheaper and lighter](https://arxiv.org/abs/1910.01108). DistilBERT is a small, fast, cheap and light Transformer model trained by distilling BERT base. It has 40% less parameters than *bert-base-uncased*, runs 60% faster while preserving over 95% of BERT's performances as measured on the GLUE language understanding benchmark. This model is a fine-tune checkpoint of [DistilBERT-base-uncased](https://huggingface.co/distilbert-base-uncased), fine-tuned using (a second step of) knowledge distillation on [SQuAD v1.1](https://huggingface.co/datasets/squad). - **Developed by:** Hugging Face - **Model Type:** Transformer-based language model - **Language(s):** English - **License:** Apache 2.0 - **Related Models:** [DistilBERT-base-uncased](https://huggingface.co/distilbert-base-uncased) - **Resources for more information:** - See [this repository](https://github.com/huggingface/transformers/tree/main/examples/research_projects/distillation) for more about Distil\* (a class of compressed models including this model) - See [Sanh et al. (2019)](https://arxiv.org/abs/1910.01108) for more information about knowledge distillation and the training procedure ## How to Get Started with the Model Use the code below to get started with the model. ```python >>> from transformers import pipeline >>> question_answerer = pipeline("question-answering", model='distilbert-base-uncased-distilled-squad') >>> context = r""" ... Extractive Question Answering is the task of extracting an answer from a text given a question. An example of a ... question answering dataset is the SQuAD dataset, which is entirely based on that task. If you would like to fine-tune ... a model on a SQuAD task, you may leverage the examples/pytorch/question-answering/run_squad.py script. ... """ >>> result = question_answerer(question="What is a good example of a question answering dataset?", context=context) >>> print( ... f"Answer: '{result['answer']}', score: {round(result['score'], 4)}, start: {result['start']}, end: {result['end']}" ...) Answer: 'SQuAD dataset', score: 0.4704, start: 147, end: 160 ``` Here is how to use this model in PyTorch: ```python from transformers import DistilBertTokenizer, DistilBertForQuestionAnswering import torch tokenizer = DistilBertTokenizer.from_pretrained('distilbert-base-uncased-distilled-squad') model = DistilBertForQuestionAnswering.from_pretrained('distilbert-base-uncased-distilled-squad') question, text = "Who was Jim Henson?", "Jim Henson was a nice puppet" inputs = tokenizer(question, text, return_tensors="pt") with torch.no_grad(): outputs = model(**inputs) answer_start_index = torch.argmax(outputs.start_logits) answer_end_index = torch.argmax(outputs.end_logits) predict_answer_tokens = inputs.input_ids[0, answer_start_index : answer_end_index + 1] tokenizer.decode(predict_answer_tokens) ``` And in TensorFlow: ```python from transformers import DistilBertTokenizer, TFDistilBertForQuestionAnswering import tensorflow as tf tokenizer = DistilBertTokenizer.from_pretrained("distilbert-base-uncased-distilled-squad") model = TFDistilBertForQuestionAnswering.from_pretrained("distilbert-base-uncased-distilled-squad") question, text = "Who was Jim Henson?", "Jim Henson was a nice puppet" inputs = tokenizer(question, text, return_tensors="tf") outputs = model(**inputs) answer_start_index = int(tf.math.argmax(outputs.start_logits, axis=-1)[0]) answer_end_index = int(tf.math.argmax(outputs.end_logits, axis=-1)[0]) predict_answer_tokens = inputs.input_ids[0, answer_start_index : answer_end_index + 1] tokenizer.decode(predict_answer_tokens) ``` ## Uses This model can be used for question answering. #### Misuse and Out-of-scope Use The model should not be used to intentionally create hostile or alienating environments for people. In addition, the model was not trained to be factual or true representations of people or events, and therefore using the model to generate such content is out-of-scope for the abilities of this model. ## Risks, Limitations and Biases **CONTENT WARNING: Readers should be aware that language generated by this model can be disturbing or offensive to some and can propagate historical and current stereotypes.** Significant research has explored bias and fairness issues with language models (see, e.g., [Sheng et al. (2021)](https://aclanthology.org/2021.acl-long.330.pdf) and [Bender et al. (2021)](https://dl.acm.org/doi/pdf/10.1145/3442188.3445922)). Predictions generated by the model can include disturbing and harmful stereotypes across protected classes; identity characteristics; and sensitive, social, and occupational groups. For example: ```python >>> from transformers import pipeline >>> question_answerer = pipeline("question-answering", model='distilbert-base-uncased-distilled-squad') >>> context = r""" ... Alice is sitting on the bench. Bob is sitting next to her. ... """ >>> result = question_answerer(question="Who is the CEO?", context=context) >>> print( ... f"Answer: '{result['answer']}', score: {round(result['score'], 4)}, start: {result['start']}, end: {result['end']}" ...) Answer: 'Bob', score: 0.4183, start: 32, end: 35 ``` Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. ## Training #### Training Data The [distilbert-base-uncased model](https://huggingface.co/distilbert-base-uncased) model describes it's training data as: > DistilBERT pretrained on the same data as BERT, which is [BookCorpus](https://yknzhu.wixsite.com/mbweb), a dataset consisting of 11,038 unpublished books and [English Wikipedia](https://en.wikipedia.org/wiki/English_Wikipedia) (excluding lists, tables and headers). To learn more about the SQuAD v1.1 dataset, see the [SQuAD v1.1 data card](https://huggingface.co/datasets/squad). #### Training Procedure ##### Preprocessing See the [distilbert-base-uncased model card](https://huggingface.co/distilbert-base-uncased) for further details. ##### Pretraining See the [distilbert-base-uncased model card](https://huggingface.co/distilbert-base-uncased) for further details. ## Evaluation As discussed in the [model repository](https://github.com/huggingface/transformers/blob/main/examples/research_projects/distillation/README.md) > This model reaches a F1 score of 86.9 on the [SQuAD v1.1] dev set (for comparison, Bert bert-base-uncased version reaches a F1 score of 88.5). ## Environmental Impact Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). We present the hardware type and hours used based on the [associated paper](https://arxiv.org/pdf/1910.01108.pdf). Note that these details are just for training DistilBERT, not including the fine-tuning with SQuAD. - **Hardware Type:** 8 16GB V100 GPUs - **Hours used:** 90 hours - **Cloud Provider:** Unknown - **Compute Region:** Unknown - **Carbon Emitted:** Unknown ## Technical Specifications See the [associated paper](https://arxiv.org/abs/1910.01108) for details on the modeling architecture, objective, compute infrastructure, and training details. ## Citation Information ```bibtex @inproceedings{sanh2019distilbert, title={DistilBERT, a distilled version of BERT: smaller, faster, cheaper and lighter}, author={Sanh, Victor and Debut, Lysandre and Chaumond, Julien and Wolf, Thomas}, booktitle={NeurIPS EMC^2 Workshop}, year={2019} } ``` APA: - Sanh, V., Debut, L., Chaumond, J., & Wolf, T. (2019). DistilBERT, a distilled version of BERT: smaller, faster, cheaper and lighter. arXiv preprint arXiv:1910.01108. ## Model Card Authors This model card was written by the Hugging Face team.

NousResearch/Meta-Llama-3-8B-Instruct

NousResearch

transformers

text-generation

--- language: - en pipeline_tag: text-generation tags: - facebook - meta - pytorch - llama - llama-3 license: other license_name: llama3 license_link: LICENSE extra_gated_prompt: >- ### META LLAMA 3 COMMUNITY LICENSE AGREEMENT Meta Llama 3 Version Release Date: April 18, 2024 "Agreement" means the terms and conditions for use, reproduction, distribution and modification of the Llama Materials set forth herein. "Documentation" means the specifications, manuals and documentation accompanying Meta Llama 3 distributed by Meta at https://llama.meta.com/get-started/. "Licensee" or "you" means you, or your employer or any other person or entity (if you are entering into this Agreement on such person or entity’s behalf), of the age required under applicable laws, rules or regulations to provide legal consent and that has legal authority to bind your employer or such other person or entity if you are entering in this Agreement on their behalf. "Meta Llama 3" means the foundational large language models and software and algorithms, including machine-learning model code, trained model weights, inference-enabling code, training-enabling code, fine-tuning enabling code and other elements of the foregoing distributed by Meta at https://llama.meta.com/llama-downloads. "Llama Materials" means, collectively, Meta’s proprietary Meta Llama 3 and Documentation (and any portion thereof) made available under this Agreement. "Meta" or "we" means Meta Platforms Ireland Limited (if you are located in or, if you are an entity, your principal place of business is in the EEA or Switzerland) and Meta Platforms, Inc. (if you are located outside of the EEA or Switzerland). 1. License Rights and Redistribution. a. Grant of Rights. You are granted a non-exclusive, worldwide, non-transferable and royalty-free limited license under Meta’s intellectual property or other rights owned by Meta embodied in the Llama Materials to use, reproduce, distribute, copy, create derivative works of, and make modifications to the Llama Materials. b. Redistribution and Use. i. If you distribute or make available the Llama Materials (or any derivative works thereof), or a product or service that uses any of them, including another AI model, you shall (A) provide a copy of this Agreement with any such Llama Materials; and (B) prominently display “Built with Meta Llama 3” on a related website, user interface, blogpost, about page, or product documentation. If you use the Llama Materials to create, train, fine tune, or otherwise improve an AI model, which is distributed or made available, you shall also include “Llama 3” at the beginning of any such AI model name. ii. If you receive Llama Materials, or any derivative works thereof, from a Licensee as part of an integrated end user product, then Section 2 of this Agreement will not apply to you. iii. You must retain in all copies of the Llama Materials that you distribute the following attribution notice within a “Notice” text file distributed as a part of such copies: “Meta Llama 3 is licensed under the Meta Llama 3 Community License, Copyright © Meta Platforms, Inc. All Rights Reserved.” iv. Your use of the Llama Materials must comply with applicable laws and regulations (including trade compliance laws and regulations) and adhere to the Acceptable Use Policy for the Llama Materials (available at https://llama.meta.com/llama3/use-policy), which is hereby incorporated by reference into this Agreement. v. You will not use the Llama Materials or any output or results of the Llama Materials to improve any other large language model (excluding Meta Llama 3 or derivative works thereof). 2. Additional Commercial Terms. If, on the Meta Llama 3 version release date, the monthly active users of the products or services made available by or for Licensee, or Licensee’s affiliates, is greater than 700 million monthly active users in the preceding calendar month, you must request a license from Meta, which Meta may grant to you in its sole discretion, and you are not authorized to exercise any of the rights under this Agreement unless or until Meta otherwise expressly grants you such rights. 3. Disclaimer of Warranty. UNLESS REQUIRED BY APPLICABLE LAW, THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS THEREFROM ARE PROVIDED ON AN “AS IS” BASIS, WITHOUT WARRANTIES OF ANY KIND, AND META DISCLAIMS ALL WARRANTIES OF ANY KIND, BOTH EXPRESS AND IMPLIED, INCLUDING, WITHOUT LIMITATION, ANY WARRANTIES OF TITLE, NON-INFRINGEMENT, MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE. YOU ARE SOLELY RESPONSIBLE FOR DETERMINING THE APPROPRIATENESS OF USING OR REDISTRIBUTING THE LLAMA MATERIALS AND ASSUME ANY RISKS ASSOCIATED WITH YOUR USE OF THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS. 4. Limitation of Liability. IN NO EVENT WILL META OR ITS AFFILIATES BE LIABLE UNDER ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, TORT, NEGLIGENCE, PRODUCTS LIABILITY, OR OTHERWISE, ARISING OUT OF THIS AGREEMENT, FOR ANY LOST PROFITS OR ANY INDIRECT, SPECIAL, CONSEQUENTIAL, INCIDENTAL, EXEMPLARY OR PUNITIVE DAMAGES, EVEN IF META OR ITS AFFILIATES HAVE BEEN ADVISED OF THE POSSIBILITY OF ANY OF THE FOREGOING. 5. Intellectual Property. a. No trademark licenses are granted under this Agreement, and in connection with the Llama Materials, neither Meta nor Licensee may use any name or mark owned by or associated with the other or any of its affiliates, except as required for reasonable and customary use in describing and redistributing the Llama Materials or as set forth in this Section 5(a). Meta hereby grants you a license to use “Llama 3” (the “Mark”) solely as required to comply with the last sentence of Section 1.b.i. You will comply with Meta’s brand guidelines (currently accessible at https://about.meta.com/brand/resources/meta/company-brand/ ). All goodwill arising out of your use of the Mark will inure to the benefit of Meta. b. Subject to Meta’s ownership of Llama Materials and derivatives made by or for Meta, with respect to any derivative works and modifications of the Llama Materials that are made by you, as between you and Meta, you are and will be the owner of such derivative works and modifications. c. If you institute litigation or other proceedings against Meta or any entity (including a cross-claim or counterclaim in a lawsuit) alleging that the Llama Materials or Meta Llama 3 outputs or results, or any portion of any of the foregoing, constitutes infringement of intellectual property or other rights owned or licensable by you, then any licenses granted to you under this Agreement shall terminate as of the date such litigation or claim is filed or instituted. You will indemnify and hold harmless Meta from and against any claim by any third party arising out of or related to your use or distribution of the Llama Materials. 6. Term and Termination. The term of this Agreement will commence upon your acceptance of this Agreement or access to the Llama Materials and will continue in full force and effect until terminated in accordance with the terms and conditions herein. Meta may terminate this Agreement if you are in breach of any term or condition of this Agreement. Upon termination of this Agreement, you shall delete and cease use of the Llama Materials. Sections 3, 4 and 7 shall survive the termination of this Agreement. 7. Governing Law and Jurisdiction. This Agreement will be governed and construed under the laws of the State of California without regard to choice of law principles, and the UN Convention on Contracts for the International Sale of Goods does not apply to this Agreement. The courts of California shall have exclusive jurisdiction of any dispute arising out of this Agreement. ### Meta Llama 3 Acceptable Use Policy Meta is committed to promoting safe and fair use of its tools and features, including Meta Llama 3. If you access or use Meta Llama 3, you agree to this Acceptable Use Policy (“Policy”). The most recent copy of this policy can be found at [https://llama.meta.com/llama3/use-policy](https://llama.meta.com/llama3/use-policy) #### Prohibited Uses We want everyone to use Meta Llama 3 safely and responsibly. You agree you will not use, or allow others to use, Meta Llama 3 to: 1. Violate the law or others’ rights, including to: 1. Engage in, promote, generate, contribute to, encourage, plan, incite, or further illegal or unlawful activity or content, such as: 1. Violence or terrorism 2. Exploitation or harm to children, including the solicitation, creation, acquisition, or dissemination of child exploitative content or failure to report Child Sexual Abuse Material 3. Human trafficking, exploitation, and sexual violence 4. The illegal distribution of information or materials to minors, including obscene materials, or failure to employ legally required age-gating in connection with such information or materials. 5. Sexual solicitation 6. Any other criminal activity 2. Engage in, promote, incite, or facilitate the harassment, abuse, threatening, or bullying of individuals or groups of individuals 3. Engage in, promote, incite, or facilitate discrimination or other unlawful or harmful conduct in the provision of employment, employment benefits, credit, housing, other economic benefits, or other essential goods and services 4. Engage in the unauthorized or unlicensed practice of any profession including, but not limited to, financial, legal, medical/health, or related professional practices 5. Collect, process, disclose, generate, or infer health, demographic, or other sensitive personal or private information about individuals without rights and consents required by applicable laws 6. Engage in or facilitate any action or generate any content that infringes, misappropriates, or otherwise violates any third-party rights, including the outputs or results of any products or services using the Llama Materials 7. Create, generate, or facilitate the creation of malicious code, malware, computer viruses or do anything else that could disable, overburden, interfere with or impair the proper working, integrity, operation or appearance of a website or computer system 2. Engage in, promote, incite, facilitate, or assist in the planning or development of activities that present a risk of death or bodily harm to individuals, including use of Meta Llama 3 related to the following: 1. Military, warfare, nuclear industries or applications, espionage, use for materials or activities that are subject to the International Traffic Arms Regulations (ITAR) maintained by the United States Department of State 2. Guns and illegal weapons (including weapon development) 3. Illegal drugs and regulated/controlled substances 4. Operation of critical infrastructure, transportation technologies, or heavy machinery 5. Self-harm or harm to others, including suicide, cutting, and eating disorders 6. Any content intended to incite or promote violence, abuse, or any infliction of bodily harm to an individual 3. Intentionally deceive or mislead others, including use of Meta Llama 3 related to the following: 1. Generating, promoting, or furthering fraud or the creation or promotion of disinformation 2. Generating, promoting, or furthering defamatory content, including the creation of defamatory statements, images, or other content 3. Generating, promoting, or further distributing spam 4. Impersonating another individual without consent, authorization, or legal right 5. Representing that the use of Meta Llama 3 or outputs are human-generated 6. Generating or facilitating false online engagement, including fake reviews and other means of fake online engagement 4. Fail to appropriately disclose to end users any known dangers of your AI system Please report any violation of this Policy, software “bug,” or other problems that could lead to a violation of this Policy through one of the following means: * Reporting issues with the model: [https://github.com/meta-llama/llama3](https://github.com/meta-llama/llama3) * Reporting risky content generated by the model: developers.facebook.com/llama_output_feedback * Reporting bugs and security concerns: facebook.com/whitehat/info * Reporting violations of the Acceptable Use Policy or unlicensed uses of Meta Llama 3: LlamaUseReport@meta.com extra_gated_fields: First Name: text Last Name: text Date of birth: date_picker Country: country Affiliation: text geo: ip_location By clicking Submit below I accept the terms of the license and acknowledge that the information I provide will be collected stored processed and shared in accordance with the Meta Privacy Policy: checkbox extra_gated_description: The information you provide will be collected, stored, processed and shared in accordance with the [Meta Privacy Policy](https://www.facebook.com/privacy/policy/). extra_gated_button_content: Submit widget: - example_title: Hello messages: - role: user content: Hey my name is Julien! How are you? - example_title: Winter holidays messages: - role: system content: You are a helpful and honest assistant. Please, respond concisely and truthfully. - role: user content: Can you recommend a good destination for Winter holidays? - example_title: Programming assistant messages: - role: system content: You are a helpful and honest code and programming assistant. Please, respond concisely and truthfully. - role: user content: Write a function that computes the nth fibonacci number. inference: parameters: max_new_tokens: 300 stop: - <|end_of_text|> - <|eot_id|> --- ## Model Details Meta developed and released the Meta Llama 3 family of large language models (LLMs), a collection of pretrained and instruction tuned generative text models in 8 and 70B sizes. The Llama 3 instruction tuned models are optimized for dialogue use cases and outperform many of the available open source chat models on common industry benchmarks. Further, in developing these models, we took great care to optimize helpfulness and safety. **Model developers** Meta **Variations** Llama 3 comes in two sizes — 8B and 70B parameters — in pre-trained and instruction tuned variants. **Input** Models input text only. **Output** Models generate text and code only. **Model Architecture** Llama 3 is an auto-regressive language model that uses an optimized transformer architecture. The tuned versions use supervised fine-tuning (SFT) and reinforcement learning with human feedback (RLHF) to align with human preferences for helpfulness and safety. <table> <tr> <td> </td> <td><strong>Training Data</strong> </td> <td><strong>Params</strong> </td> <td><strong>Context length</strong> </td> <td><strong>GQA</strong> </td> <td><strong>Token count</strong> </td> <td><strong>Knowledge cutoff</strong> </td> </tr> <tr> <td rowspan="2" >Llama 3 </td> <td rowspan="2" >A new mix of publicly available online data. </td> <td>8B </td> <td>8k </td> <td>Yes </td> <td rowspan="2" >15T+ </td> <td>March, 2023 </td> </tr> <tr> <td>70B </td> <td>8k </td> <td>Yes </td> <td>December, 2023 </td> </tr> </table> **Llama 3 family of models**. Token counts refer to pretraining data only. Both the 8 and 70B versions use Grouped-Query Attention (GQA) for improved inference scalability. **Model Release Date** April 18, 2024. **Status** This is a static model trained on an offline dataset. Future versions of the tuned models will be released as we improve model safety with community feedback. **License** A custom commercial license is available at: [https://llama.meta.com/llama3/license](https://llama.meta.com/llama3/license) Where to send questions or comments about the model Instructions on how to provide feedback or comments on the model can be found in the model [README](https://github.com/meta-llama/llama3). For more technical information about generation parameters and recipes for how to use Llama 3 in applications, please go [here](https://github.com/meta-llama/llama-recipes). ## Intended Use **Intended Use Cases** Llama 3 is intended for commercial and research use in English. Instruction tuned models are intended for assistant-like chat, whereas pretrained models can be adapted for a variety of natural language generation tasks. **Out-of-scope** Use in any manner that violates applicable laws or regulations (including trade compliance laws). Use in any other way that is prohibited by the Acceptable Use Policy and Llama 3 Community License. Use in languages other than English**. **Note: Developers may fine-tune Llama 3 models for languages beyond English provided they comply with the Llama 3 Community License and the Acceptable Use Policy. ## How to use This repository contains two versions of Meta-Llama-3-8B-Instruct, for use with transformers and with the original `llama3` codebase. ### Use with transformers You can run conversational inference using the Transformers pipeline abstraction, or by leveraging the Auto classes with the `generate()` function. Let's see examples of both. #### Transformers pipeline ```python import transformers import torch model_id = "meta-llama/Meta-Llama-3-8B-Instruct" pipeline = transformers.pipeline( "text-generation", model=model_id, model_kwargs={"torch_dtype": torch.bfloat16}, device_map="auto", ) messages = [ {"role": "system", "content": "You are a pirate chatbot who always responds in pirate speak!"}, {"role": "user", "content": "Who are you?"}, ] prompt = pipeline.tokenizer.apply_chat_template( messages, tokenize=False, add_generation_prompt=True ) terminators = [ pipeline.tokenizer.eos_token_id, pipeline.tokenizer.convert_tokens_to_ids("<|eot_id|>") ] outputs = pipeline( prompt, max_new_tokens=256, eos_token_id=terminators, do_sample=True, temperature=0.6, top_p=0.9, ) print(outputs[0]["generated_text"][len(prompt):]) ``` #### Transformers AutoModelForCausalLM ```python from transformers import AutoTokenizer, AutoModelForCausalLM import torch model_id = "meta-llama/Meta-Llama-3-8B-Instruct" tokenizer = AutoTokenizer.from_pretrained(model_id) model = AutoModelForCausalLM.from_pretrained( model_id, torch_dtype=torch.bfloat16, device_map="auto", ) messages = [ {"role": "system", "content": "You are a pirate chatbot who always responds in pirate speak!"}, {"role": "user", "content": "Who are you?"}, ] input_ids = tokenizer.apply_chat_template( messages, add_generation_prompt=True, return_tensors="pt" ).to(model.device) terminators = [ tokenizer.eos_token_id, tokenizer.convert_tokens_to_ids("<|eot_id|>") ] outputs = model.generate( input_ids, max_new_tokens=256, eos_token_id=terminators, do_sample=True, temperature=0.6, top_p=0.9, ) response = outputs[0][input_ids.shape[-1]:] print(tokenizer.decode(response, skip_special_tokens=True)) ``` ### Use with `llama3` Please, follow the instructions in the [repository](https://github.com/meta-llama/llama3) To download Original checkpoints, see the example command below leveraging `huggingface-cli`: ``` huggingface-cli download meta-llama/Meta-Llama-3-8B-Instruct --include "original/*" --local-dir Meta-Llama-3-8B-Instruct ``` For Hugging Face support, we recommend using transformers or TGI, but a similar command works. ## Hardware and Software **Training Factors** We used custom training libraries, Meta's Research SuperCluster, and production clusters for pretraining. Fine-tuning, annotation, and evaluation were also performed on third-party cloud compute. **Carbon Footprint Pretraining utilized a cumulative** 7.7M GPU hours of computation on hardware of type H100-80GB (TDP of 700W). Estimated total emissions were 2290 tCO2eq, 100% of which were offset by Meta’s sustainability program. <table> <tr> <td> </td> <td><strong>Time (GPU hours)</strong> </td> <td><strong>Power Consumption (W)</strong> </td> <td><strong>Carbon Emitted(tCO2eq)</strong> </td> </tr> <tr> <td>Llama 3 8B </td> <td>1.3M </td> <td>700 </td> <td>390 </td> </tr> <tr> <td>Llama 3 70B </td> <td>6.4M </td> <td>700 </td> <td>1900 </td> </tr> <tr> <td>Total </td> <td>7.7M </td> <td> </td> <td>2290 </td> </tr> </table> **CO2 emissions during pre-training**. Time: total GPU time required for training each model. Power Consumption: peak power capacity per GPU device for the GPUs used adjusted for power usage efficiency. 100% of the emissions are directly offset by Meta's sustainability program, and because we are openly releasing these models, the pretraining costs do not need to be incurred by others. ## Training Data **Overview** Llama 3 was pretrained on over 15 trillion tokens of data from publicly available sources. The fine-tuning data includes publicly available instruction datasets, as well as over 10M human-annotated examples. Neither the pretraining nor the fine-tuning datasets include Meta user data. **Data Freshness** The pretraining data has a cutoff of March 2023 for the 7B and December 2023 for the 70B models respectively. ## Benchmarks In this section, we report the results for Llama 3 models on standard automatic benchmarks. For all the evaluations, we use our internal evaluations library. For details on the methodology see [here](https://github.com/meta-llama/llama3/blob/main/eval_methodology.md). ### Base pretrained models <table> <tr> <td><strong>Category</strong> </td> <td><strong>Benchmark</strong> </td> <td><strong>Llama 3 8B</strong> </td> <td><strong>Llama2 7B</strong> </td> <td><strong>Llama2 13B</strong> </td> <td><strong>Llama 3 70B</strong> </td> <td><strong>Llama2 70B</strong> </td> </tr> <tr> <td rowspan="6" >General </td> <td>MMLU (5-shot) </td> <td>66.6 </td> <td>45.7 </td> <td>53.8 </td> <td>79.5 </td> <td>69.7 </td> </tr> <tr> <td>AGIEval English (3-5 shot) </td> <td>45.9 </td> <td>28.8 </td> <td>38.7 </td> <td>63.0 </td> <td>54.8 </td> </tr> <tr> <td>CommonSenseQA (7-shot) </td> <td>72.6 </td> <td>57.6 </td> <td>67.6 </td> <td>83.8 </td> <td>78.7 </td> </tr> <tr> <td>Winogrande (5-shot) </td> <td>76.1 </td> <td>73.3 </td> <td>75.4 </td> <td>83.1 </td> <td>81.8 </td> </tr> <tr> <td>BIG-Bench Hard (3-shot, CoT) </td> <td>61.1 </td> <td>38.1 </td> <td>47.0 </td> <td>81.3 </td> <td>65.7 </td> </tr> <tr> <td>ARC-Challenge (25-shot) </td> <td>78.6 </td> <td>53.7 </td> <td>67.6 </td> <td>93.0 </td> <td>85.3 </td> </tr> <tr> <td>Knowledge reasoning </td> <td>TriviaQA-Wiki (5-shot) </td> <td>78.5 </td> <td>72.1 </td> <td>79.6 </td> <td>89.7 </td> <td>87.5 </td> </tr> <tr> <td rowspan="4" >Reading comprehension </td> <td>SQuAD (1-shot) </td> <td>76.4 </td> <td>72.2 </td> <td>72.1 </td> <td>85.6 </td> <td>82.6 </td> </tr> <tr> <td>QuAC (1-shot, F1) </td> <td>44.4 </td> <td>39.6 </td> <td>44.9 </td> <td>51.1 </td> <td>49.4 </td> </tr> <tr> <td>BoolQ (0-shot) </td> <td>75.7 </td> <td>65.5 </td> <td>66.9 </td> <td>79.0 </td> <td>73.1 </td> </tr> <tr> <td>DROP (3-shot, F1) </td> <td>58.4 </td> <td>37.9 </td> <td>49.8 </td> <td>79.7 </td> <td>70.2 </td> </tr> </table> ### Instruction tuned models <table> <tr> <td><strong>Benchmark</strong> </td> <td><strong>Llama 3 8B</strong> </td> <td><strong>Llama 2 7B</strong> </td> <td><strong>Llama 2 13B</strong> </td> <td><strong>Llama 3 70B</strong> </td> <td><strong>Llama 2 70B</strong> </td> </tr> <tr> <td>MMLU (5-shot) </td> <td>68.4 </td> <td>34.1 </td> <td>47.8 </td> <td>82.0 </td> <td>52.9 </td> </tr> <tr> <td>GPQA (0-shot) </td> <td>34.2 </td> <td>21.7 </td> <td>22.3 </td> <td>39.5 </td> <td>21.0 </td> </tr> <tr> <td>HumanEval (0-shot) </td> <td>62.2 </td> <td>7.9 </td> <td>14.0 </td> <td>81.7 </td> <td>25.6 </td> </tr> <tr> <td>GSM-8K (8-shot, CoT) </td> <td>79.6 </td> <td>25.7 </td> <td>77.4 </td> <td>93.0 </td> <td>57.5 </td> </tr> <tr> <td>MATH (4-shot, CoT) </td> <td>30.0 </td> <td>3.8 </td> <td>6.7 </td> <td>50.4 </td> <td>11.6 </td> </tr> </table> ### Responsibility & Safety We believe that an open approach to AI leads to better, safer products, faster innovation, and a bigger overall market. We are committed to Responsible AI development and took a series of steps to limit misuse and harm and support the open source community. Foundation models are widely capable technologies that are built to be used for a diverse range of applications. They are not designed to meet every developer preference on safety levels for all use cases, out-of-the-box, as those by their nature will differ across different applications. Rather, responsible LLM-application deployment is achieved by implementing a series of safety best practices throughout the development of such applications, from the model pre-training, fine-tuning and the deployment of systems composed of safeguards to tailor the safety needs specifically to the use case and audience. As part of the Llama 3 release, we updated our [Responsible Use Guide](https://llama.meta.com/responsible-use-guide/) to outline the steps and best practices for developers to implement model and system level safety for their application. We also provide a set of resources including [Meta Llama Guard 2](https://llama.meta.com/purple-llama/) and [Code Shield](https://llama.meta.com/purple-llama/) safeguards. These tools have proven to drastically reduce residual risks of LLM Systems, while maintaining a high level of helpfulness. We encourage developers to tune and deploy these safeguards according to their needs and we provide a [reference implementation](https://github.com/meta-llama/llama-recipes/tree/main/recipes/responsible_ai) to get you started. #### Llama 3-Instruct As outlined in the Responsible Use Guide, some trade-off between model helpfulness and model alignment is likely unavoidable. Developers should exercise discretion about how to weigh the benefits of alignment and helpfulness for their specific use case and audience. Developers should be mindful of residual risks when using Llama models and leverage additional safety tools as needed to reach the right safety bar for their use case. <span style="text-decoration:underline;">Safety</span> For our instruction tuned model, we conducted extensive red teaming exercises, performed adversarial evaluations and implemented safety mitigations techniques to lower residual risks. As with any Large Language Model, residual risks will likely remain and we recommend that developers assess these risks in the context of their use case. In parallel, we are working with the community to make AI safety benchmark standards transparent, rigorous and interpretable. <span style="text-decoration:underline;">Refusals</span> In addition to residual risks, we put a great emphasis on model refusals to benign prompts. Over-refusing not only can impact the user experience but could even be harmful in certain contexts as well. We’ve heard the feedback from the developer community and improved our fine tuning to ensure that Llama 3 is significantly less likely to falsely refuse to answer prompts than Llama 2. We built internal benchmarks and developed mitigations to limit false refusals making Llama 3 our most helpful model to date. #### Responsible release In addition to responsible use considerations outlined above, we followed a rigorous process that requires us to take extra measures against misuse and critical risks before we make our release decision. Misuse If you access or use Llama 3, you agree to the Acceptable Use Policy. The most recent copy of this policy can be found at [https://llama.meta.com/llama3/use-policy/](https://llama.meta.com/llama3/use-policy/). #### Critical risks <span style="text-decoration:underline;">CBRNE</span> (Chemical, Biological, Radiological, Nuclear, and high yield Explosives) We have conducted a two fold assessment of the safety of the model in this area: * Iterative testing during model training to assess the safety of responses related to CBRNE threats and other adversarial risks. * Involving external CBRNE experts to conduct an uplift test assessing the ability of the model to accurately provide expert knowledge and reduce barriers to potential CBRNE misuse, by reference to what can be achieved using web search (without the model). ### <span style="text-decoration:underline;">Cyber Security </span> We have evaluated Llama 3 with CyberSecEval, Meta’s cybersecurity safety eval suite, measuring Llama 3’s propensity to suggest insecure code when used as a coding assistant, and Llama 3’s propensity to comply with requests to help carry out cyber attacks, where attacks are defined by the industry standard MITRE ATT&CK cyber attack ontology. On our insecure coding and cyber attacker helpfulness tests, Llama 3 behaved in the same range or safer than models of [equivalent coding capability](https://huggingface.co/spaces/facebook/CyberSecEval). ### <span style="text-decoration:underline;">Child Safety</span> Child Safety risk assessments were conducted using a team of experts, to assess the model’s capability to produce outputs that could result in Child Safety risks and inform on any necessary and appropriate risk mitigations via fine tuning. We leveraged those expert red teaming sessions to expand the coverage of our evaluation benchmarks through Llama 3 model development. For Llama 3, we conducted new in-depth sessions using objective based methodologies to assess the model risks along multiple attack vectors. We also partnered with content specialists to perform red teaming exercises assessing potentially violating content while taking account of market specific nuances or experiences. ### Community Generative AI safety requires expertise and tooling, and we believe in the strength of the open community to accelerate its progress. We are active members of open consortiums, including the AI Alliance, Partnership in AI and MLCommons, actively contributing to safety standardization and transparency. We encourage the community to adopt taxonomies like the MLCommons Proof of Concept evaluation to facilitate collaboration and transparency on safety and content evaluations. Our Purple Llama tools are open sourced for the community to use and widely distributed across ecosystem partners including cloud service providers. We encourage community contributions to our [Github repository](https://github.com/meta-llama/PurpleLlama). Finally, we put in place a set of resources including an [output reporting mechanism](https://developers.facebook.com/llama_output_feedback) and [bug bounty program](https://www.facebook.com/whitehat) to continuously improve the Llama technology with the help of the community. ## Ethical Considerations and Limitations The core values of Llama 3 are openness, inclusivity and helpfulness. It is meant to serve everyone, and to work for a wide range of use cases. It is thus designed to be accessible to people across many different backgrounds, experiences and perspectives. Llama 3 addresses users and their needs as they are, without insertion unnecessary judgment or normativity, while reflecting the understanding that even content that may appear problematic in some cases can serve valuable purposes in others. It respects the dignity and autonomy of all users, especially in terms of the values of free thought and expression that power innovation and progress. But Llama 3 is a new technology, and like any new technology, there are risks associated with its use. Testing conducted to date has been in English, and has not covered, nor could it cover, all scenarios. For these reasons, as with all LLMs, Llama 3’s potential outputs cannot be predicted in advance, and the model may in some instances produce inaccurate, biased or other objectionable responses to user prompts. Therefore, before deploying any applications of Llama 3 models, developers should perform safety testing and tuning tailored to their specific applications of the model. As outlined in the Responsible Use Guide, we recommend incorporating [Purple Llama](https://github.com/facebookresearch/PurpleLlama) solutions into your workflows and specifically [Llama Guard](https://ai.meta.com/research/publications/llama-guard-llm-based-input-output-safeguard-for-human-ai-conversations/) which provides a base model to filter input and output prompts to layer system-level safety on top of model-level safety. Please see the Responsible Use Guide available at [http://llama.meta.com/responsible-use-guide](http://llama.meta.com/responsible-use-guide) ## Citation instructions @article{llama3modelcard, title={Llama 3 Model Card}, author={AI@Meta}, year={2024}, url = {https://github.com/meta-llama/llama3/blob/main/MODEL_CARD.md} } ## Contributors Aaditya Singh; Aaron Grattafiori; Abhimanyu Dubey; Abhinav Jauhri; Abhinav Pandey; Abhishek Kadian; Adam Kelsey; Adi Gangidi; Ahmad Al-Dahle; Ahuva Goldstand; Aiesha Letman; Ajay Menon; Akhil Mathur; Alan Schelten; Alex Vaughan; Amy Yang; Andrei Lupu; Andres Alvarado; Andrew Gallagher; Andrew Gu; Andrew Ho; Andrew Poulton; Andrew Ryan; Angela Fan; Ankit Ramchandani; Anthony Hartshorn; Archi Mitra; Archie Sravankumar; Artem Korenev; Arun Rao; Ashley Gabriel; Ashwin Bharambe; Assaf Eisenman; Aston Zhang; Aurelien Rodriguez; Austen Gregerson; Ava Spataru; Baptiste Roziere; Ben Maurer; Benjamin Leonhardi; Bernie Huang; Bhargavi Paranjape; Bing Liu; Binh Tang; Bobbie Chern; Brani Stojkovic; Brian Fuller; Catalina Mejia Arenas; Chao Zhou; Charlotte Caucheteux; Chaya Nayak; Ching-Hsiang Chu; Chloe Bi; Chris Cai; Chris Cox; Chris Marra; Chris McConnell; Christian Keller; Christoph Feichtenhofer; Christophe Touret; Chunyang Wu; Corinne Wong; Cristian Canton Ferrer; Damien Allonsius; Daniel Kreymer; Daniel Haziza; Daniel Li; Danielle Pintz; Danny Livshits; Danny Wyatt; David Adkins; David Esiobu; David Xu; Davide Testuggine; Delia David; Devi Parikh; Dhruv Choudhary; Dhruv Mahajan; Diana Liskovich; Diego Garcia-Olano; Diego Perino; Dieuwke Hupkes; Dingkang Wang; Dustin Holland; Egor Lakomkin; Elina Lobanova; Xiaoqing Ellen Tan; Emily Dinan; Eric Smith; Erik Brinkman; Esteban Arcaute; Filip Radenovic; Firat Ozgenel; Francesco Caggioni; Frank Seide; Frank Zhang; Gabriel Synnaeve; Gabriella Schwarz; Gabrielle Lee; Gada Badeer; Georgia Anderson; Graeme Nail; Gregoire Mialon; Guan Pang; Guillem Cucurell; Hailey Nguyen; Hannah Korevaar; Hannah Wang; Haroun Habeeb; Harrison Rudolph; Henry Aspegren; Hu Xu; Hugo Touvron; Iga Kozlowska; Igor Molybog; Igor Tufanov; Iliyan Zarov; Imanol Arrieta Ibarra; Irina-Elena Veliche; Isabel Kloumann; Ishan Misra; Ivan Evtimov; Jacob Xu; Jade Copet; Jake Weissman; Jan Geffert; Jana Vranes; Japhet Asher; Jason Park; Jay Mahadeokar; Jean-Baptiste Gaya; Jeet Shah; Jelmer van der Linde; Jennifer Chan; Jenny Hong; Jenya Lee; Jeremy Fu; Jeremy Teboul; Jianfeng Chi; Jianyu Huang; Jie Wang; Jiecao Yu; Joanna Bitton; Joe Spisak; Joelle Pineau; Jon Carvill; Jongsoo Park; Joseph Rocca; Joshua Johnstun; Junteng Jia; Kalyan Vasuden Alwala; Kam Hou U; Kate Plawiak; Kartikeya Upasani; Kaushik Veeraraghavan; Ke Li; Kenneth Heafield; Kevin Stone; Khalid El-Arini; Krithika Iyer; Kshitiz Malik; Kuenley Chiu; Kunal Bhalla; Kyle Huang; Lakshya Garg; Lauren Rantala-Yeary; Laurens van der Maaten; Lawrence Chen; Leandro Silva; Lee Bell; Lei Zhang; Liang Tan; Louis Martin; Lovish Madaan; Luca Wehrstedt; Lukas Blecher; Luke de Oliveira; Madeline Muzzi; Madian Khabsa; Manav Avlani; Mannat Singh; Manohar Paluri; Mark Zuckerberg; Marcin Kardas; Martynas Mankus; Mathew Oldham; Mathieu Rita; Matthew Lennie; Maya Pavlova; Meghan Keneally; Melanie Kambadur; Mihir Patel; Mikayel Samvelyan; Mike Clark; Mike Lewis; Min Si; Mitesh Kumar Singh; Mo Metanat; Mona Hassan; Naman Goyal; Narjes Torabi; Nicolas Usunier; Nikolay Bashlykov; Nikolay Bogoychev; Niladri Chatterji; Ning Dong; Oliver Aobo Yang; Olivier Duchenne; Onur Celebi; Parth Parekh; Patrick Alrassy; Paul Saab; Pavan Balaji; Pedro Rittner; Pengchuan Zhang; Pengwei Li; Petar Vasic; Peter Weng; Polina Zvyagina; Prajjwal Bhargava; Pratik Dubal; Praveen Krishnan; Punit Singh Koura; Qing He; Rachel Rodriguez; Ragavan Srinivasan; Rahul Mitra; Ramon Calderer; Raymond Li; Robert Stojnic; Roberta Raileanu; Robin Battey; Rocky Wang; Rohit Girdhar; Rohit Patel; Romain Sauvestre; Ronnie Polidoro; Roshan Sumbaly; Ross Taylor; Ruan Silva; Rui Hou; Rui Wang; Russ Howes; Ruty Rinott; Saghar Hosseini; Sai Jayesh Bondu; Samyak Datta; Sanjay Singh; Sara Chugh; Sargun Dhillon; Satadru Pan; Sean Bell; Sergey Edunov; Shaoliang Nie; Sharan Narang; Sharath Raparthy; Shaun Lindsay; Sheng Feng; Sheng Shen; Shenghao Lin; Shiva Shankar; Shruti Bhosale; Shun Zhang; Simon Vandenhende; Sinong Wang; Seohyun Sonia Kim; Soumya Batra; Sten Sootla; Steve Kehoe; Suchin Gururangan; Sumit Gupta; Sunny Virk; Sydney Borodinsky; Tamar Glaser; Tamar Herman; Tamara Best; Tara Fowler; Thomas Georgiou; Thomas Scialom; Tianhe Li; Todor Mihaylov; Tong Xiao; Ujjwal Karn; Vedanuj Goswami; Vibhor Gupta; Vignesh Ramanathan; Viktor Kerkez; Vinay Satish Kumar; Vincent Gonguet; Vish Vogeti; Vlad Poenaru; Vlad Tiberiu Mihailescu; Vladan Petrovic; Vladimir Ivanov; Wei Li; Weiwei Chu; Wenhan Xiong; Wenyin Fu; Wes Bouaziz; Whitney Meers; Will Constable; Xavier Martinet; Xiaojian Wu; Xinbo Gao; Xinfeng Xie; Xuchao Jia; Yaelle Goldschlag; Yann LeCun; Yashesh Gaur; Yasmine Babaei; Ye Qi; Yenda Li; Yi Wen; Yiwen Song; Youngjin Nam; Yuchen Hao; Yuchen Zhang; Yun Wang; Yuning Mao; Yuzi He; Zacharie Delpierre Coudert; Zachary DeVito; Zahra Hankir; Zhaoduo Wen; Zheng Yan; Zhengxing Chen; Zhenyu Yang; Zoe Papakipos

nomic-ai/gpt4all-falcon

nomic-ai

transformers

text-generation

--- license: apache-2.0 datasets: - nomic-ai/gpt4all-j-prompt-generations language: - en pipeline_tag: text-generation --- # Model Card for GPT4All-Falcon An Apache-2 licensed chatbot trained over a massive curated corpus of assistant interactions including word problems, multi-turn dialogue, code, poems, songs, and stories. ## Model Details ### Model Description <!-- Provide a longer summary of what this model is. --> This model has been finetuned from [Falcon](https://huggingface.co/tiiuae/falcon-7b) - **Developed by:** [Nomic AI](https://home.nomic.ai) - **Model Type:** A finetuned Falcon 7B model on assistant style interaction data - **Language(s) (NLP):** English - **License:** Apache-2 - **Finetuned from model [optional]:** [Falcon](https://huggingface.co/tiiuae/falcon-7b) To download a model with a specific revision run ```python from transformers import AutoModelForCausalLM model = AutoModelForCausalLM.from_pretrained("nomic-ai/gpt4all-falcon", trust_remote_code=True) ``` Downloading without specifying `revision` defaults to `main`/`v1.0`. To use it for inference with Cuda, run ```python from transformers import AutoTokenizer, pipeline import transformers import torch tokenizer = AutoTokenizer.from_pretrained(model_path, use_fast=False) model.to("cuda:0") prompt = "Describe a painting of a falcon in a very detailed way." # Change this to your prompt prompt_template = f"### Instruction: {prompt}\n### Response:" tokens = tokenizer(prompt_template, return_tensors="pt").input_ids.to("cuda:0") output = model.generate(input_ids=tokens, max_new_tokens=256, do_sample=True, temperature=0.8) # Print the generated text print(tokenizer.decode(output[0])) ``` ### Model Sources [optional] <!-- Provide the basic links for the model. --> - **Repository:** [https://github.com/nomic-ai/gpt4all](https://github.com/nomic-ai/gpt4all) - **Base Model Repository:** [https://huggingface.co/tiiuae/falcon-7b](https://huggingface.co/tiiuae/falcon-7b) - **Demo [optional]:** [https://gpt4all.io/](https://gpt4all.io/) ### Training Procedure GPT4All is made possible by our compute partner [Paperspace](https://www.paperspace.com/). Trained on a DGX cluster with 8 A100 80GB GPUs for ~12 hours. Using Deepspeed + Accelerate, we use a global batch size of 256 with a learning rate of 2e-5. More information can be found in the repo. ### Results Results on common sense reasoning benchmarks ``` | Model | BoolQ | PIQA | HellaSwag | WinoGrande | ARC-e | ARC-c | OBQA | Avg. | |:--------------------------|:--------:|:--------:|:---------:|:----------:|:--------:|:--------:|:--------:|:--------:| | GPT4All-J 6B v1.0 | 73.4 | 74.8 | 63.4 | 64.7 | 54.9 | 36.0 | 40.2 | 58.2 | | GPT4All-J v1.1-breezy | 74.0 | 75.1 | 63.2 | 63.6 | 55.4 | 34.9 | 38.4 | 57.8 | | GPT4All-J v1.2-jazzy | 74.8 | 74.9 | 63.6 | 63.8 | 56.6 | 35.3 | 41.0 | 58.6 | | GPT4All-J v1.3-groovy | 73.6 | 74.3 | 63.8 | 63.5 | 57.7 | 35.0 | 38.8 | 58.1 | | GPT4All-J Lora 6B | 68.6 | 75.8 | 66.2 | 63.5 | 56.4 | 35.7 | 40.2 | 58.1 | | GPT4All LLaMa Lora 7B | 73.1 | 77.6 | 72.1 | 67.8 | 51.1 | 40.4 | 40.2 | 60.3 | | GPT4All 13B snoozy | **83.3** | 79.2 | 75.0 | **71.3** | 60.9 | 44.2 | 43.4 | 65.3 | | GPT4All Falcon | 77.6 | 79.8 | 74.9 | 70.1 | 67.9 | 43.4 | 42.6 | 65.2 | | Dolly 6B | 68.8 | 77.3 | 67.6 | 63.9 | 62.9 | 38.7 | 41.2 | 60.1 | | Dolly 12B | 56.7 | 75.4 | 71.0 | 62.2 | 64.6 | 38.5 | 40.4 | 58.4 | | Alpaca 7B | 73.9 | 77.2 | 73.9 | 66.1 | 59.8 | 43.3 | 43.4 | 62.4 | | Alpaca Lora 7B | 74.3 | 79.3 | 74.0 | 68.8 | 56.6 | 43.9 | 42.6 | 62.8 | | GPT-J 6.7B | 65.4 | 76.2 | 66.2 | 64.1 | 62.2 | 36.6 | 38.2 | 58.4 | | LLama 7B | 73.1 | 77.4 | 73.0 | 66.9 | 52.5 | 41.4 | 42.4 | 61.0 | | LLama 13B | 68.5 | 79.1 | 76.2 | 70.1 | 60.0 | **44.6** | 42.2 | 63.0 | | Pythia 6.7B | 63.5 | 76.3 | 64.0 | 61.1 | 61.3 | 35.2 | 37.2 | 57.0 | | Pythia 12B | 67.7 | 76.6 | 67.3 | 63.8 | 63.9 | 34.8 | 38 | 58.9 | | Fastchat T5 | 81.5 | 64.6 | 46.3 | 61.8 | 49.3 | 33.3 | 39.4 | 53.7 | | Fastchat Vicuña 7B | 76.6 | 77.2 | 70.7 | 67.3 | 53.5 | 41.2 | 40.8 | 61.0 | | Fastchat Vicuña 13B | 81.5 | 76.8 | 73.3 | 66.7 | 57.4 | 42.7 | 43.6 | 63.1 | | StableVicuña RLHF | 82.3 | 78.6 | 74.1 | 70.9 | 61.0 | 43.5 | **44.4** | 65.0 | | StableLM Tuned | 62.5 | 71.2 | 53.6 | 54.8 | 52.4 | 31.1 | 33.4 | 51.3 | | StableLM Base | 60.1 | 67.4 | 41.2 | 50.1 | 44.9 | 27.0 | 32.0 | 42.2 | | Koala 13B | 76.5 | 77.9 | 72.6 | 68.8 | 54.3 | 41.0 | 42.8 | 62.0 | | Open Assistant Pythia 12B | 67.9 | 78.0 | 68.1 | 65.0 | 64.2 | 40.4 | 43.2 | 61.0 | | Mosaic MPT7B | 74.8 | 79.3 | 76.3 | 68.6 | 70.0 | 42.2 | 42.6 | 64.8 | | Mosaic mpt-instruct | 74.3 | 80.4 | **77.2** | 67.8 | **72.2** | **44.6** | 43.0 | **65.6** | | Mosaic mpt-chat | 77.1 | 78.2 | 74.5 | 67.5 | 69.4 | 43.3 | 44.2 | 64.9 | | Wizard 7B | 78.4 | 77.2 | 69.9 | 66.5 | 56.8 | 40.5 | 42.6 | 61.7 | | Wizard 7B Uncensored | 77.7 | 74.2 | 68.0 | 65.2 | 53.5 | 38.7 | 41.6 | 59.8 | | Wizard 13B Uncensored | 78.4 | 75.5 | 72.1 | 69.5 | 57.5 | 40.4 | 44.0 | 62.5 | | GPT4-x-Vicuna-13b | 81.3 | 75.0 | 75.2 | 65.0 | 58.7 | 43.9 | 43.6 | 62.2 | | Falcon 7b | 73.6 | **80.7** | 76.3 | 67.3 | 71.0 | 43.3 | 44.4 | 65.2 | | text-davinci-003 | 88.1 | 83.8 | 83.4 | 75.8 | 83.9 | 63.9 | 51.0 | 75.7 | ```

timm/fbnetc_100.rmsp_in1k

timm

timm

image-classification

--- tags: - image-classification - timm library_name: timm license: apache-2.0 datasets: - imagenet-1k --- # Model card for fbnetc_100.rmsp_in1k A FBNet image classification model. Trained on ImageNet-1k in `timm` using recipe template described below. Recipe details: * A simple RmsProp based recipe without RandAugment. Using RandomErasing, mixup, dropout, standard random-resize-crop augmentation. * RMSProp (TF 1.0 behaviour) optimizer, EMA weight averaging * Step (exponential decay w/ staircase) LR schedule with warmup ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 5.6 - GMACs: 0.4 - Activations (M): 6.5 - Image size: 224 x 224 - **Papers:** - FBNet: Hardware-Aware Efficient ConvNet Design via Differentiable Neural Architecture Search: https://arxiv.org/abs/1812.03443 - **Dataset:** ImageNet-1k - **Original:** https://github.com/huggingface/pytorch-image-models ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('fbnetc_100.rmsp_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Feature Map Extraction ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'fbnetc_100.rmsp_in1k', pretrained=True, features_only=True, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 for o in output: # print shape of each feature map in output # e.g.: # torch.Size([1, 16, 112, 112]) # torch.Size([1, 24, 56, 56]) # torch.Size([1, 32, 28, 28]) # torch.Size([1, 112, 14, 14]) # torch.Size([1, 352, 7, 7]) print(o.shape) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'fbnetc_100.rmsp_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled, a (1, 1984, 7, 7) shaped tensor output = model.forward_head(output, pre_logits=True) # output is a (1, num_features) shaped tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). ## Citation ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ``` ```bibtex @inproceedings{wu2019fbnet, title={Fbnet: Hardware-aware efficient convnet design via differentiable neural architecture search}, author={Wu, Bichen and Dai, Xiaoliang and Zhang, Peizhao and Wang, Yanghan and Sun, Fei and Wu, Yiming and Tian, Yuandong and Vajda, Peter and Jia, Yangqing and Keutzer, Kurt}, booktitle={Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition}, pages={10734--10742}, year={2019} } ```

softcatala/wav2vec2-large-xlsr-catala

softcatala

transformers

automatic-speech-recognition

--- language: ca datasets: - common_voice - parlament_parla metrics: - wer tags: - audio - automatic-speech-recognition - speech - xlsr-fine-tuning-week license: apache-2.0 model-index: - name: Catalan XLSR Wav2Vec2 Large results: - task: name: Speech Recognition type: automatic-speech-recognition datasets: - name: Common Voice ca type: common_voice args: ca - name: ParlamentParla url: https://www.openslr.org/59/ metrics: - name: Test WER type: wer value: 6.92 - name: Google Crowsourced Corpus WER type: wer value: 12.99 - name: Audiobook “La llegenda de Sant Jordi” WER type: wer value: 13.23 --- # Wav2Vec2-Large-XLSR-Català Fine-tuned [facebook/wav2vec2-large-xlsr-53](https://huggingface.co/facebook/wav2vec2-large-xlsr-53) on Catalan language using the [Common Voice](https://huggingface.co/datasets/common_voice) and [ParlamentParla](https://www.openslr.org/59/) datasets. **Attention:** The split train/dev/test used does not fully map with the CommonVoice 6.1 dataset. A custom split was used combining both the CommonVoice and ParlamentParla dataset and can be found [here](https://github.com/ccoreilly/wav2vec2-catala). Evaluating on the CV test dataset will produce a biased WER as 1144 audio files of that dataset were used in training/evaluation of this model. WER was calculated using this [test.csv](https://github.com/ccoreilly/wav2vec2-catala/blob/master/test.csv) which was not seen by the model during training/evaluation. You can find training and evaluation scripts in the github repository [ccoreilly/wav2vec2-catala](https://github.com/ccoreilly/wav2vec2-catala) When using this model, make sure that your speech input is sampled at 16kHz. ## Results Word error rate was evaluated on the following datasets unseen by the model: | Dataset | WER | | ------- | --- | | [Test split CV+ParlamentParla]((https://github.com/ccoreilly/wav2vec2-catala/blob/master/test.csv)) | 6.92% | | [Google Crowsourced Corpus](https://www.openslr.org/69/) | 12.99% | | Audiobook “La llegenda de Sant Jordi” | 13.23% | ## Usage The model can be used directly (without a language model) as follows: ```python import torch import torchaudio from datasets import load_dataset from transformers import Wav2Vec2ForCTC, Wav2Vec2Processor test_dataset = load_dataset("common_voice", "ca", split="test[:2%]") processor = Wav2Vec2Processor.from_pretrained("ccoreilly/wav2vec2-large-xlsr-catala") model = Wav2Vec2ForCTC.from_pretrained("ccoreilly/wav2vec2-large-xlsr-catala") resampler = torchaudio.transforms.Resample(48_000, 16_000) # Preprocessing the datasets. # We need to read the audio files as arrays def speech_file_to_array_fn(batch): speech_array, sampling_rate = torchaudio.load(batch["path"]) batch["speech"] = resampler(speech_array).squeeze().numpy() return batch test_dataset = test_dataset.map(speech_file_to_array_fn) inputs = processor(test_dataset["speech"][:2], sampling_rate=16_000, return_tensors="pt", padding=True) with torch.no_grad(): logits = model(inputs.input_values, attention_mask=inputs.attention_mask).logits predicted_ids = torch.argmax(logits, dim=-1) print("Prediction:", processor.batch_decode(predicted_ids)) print("Reference:", test_dataset["sentence"][:2]) ```

sentinet/suicidality

sentinet

transformers

text-classification

--- license: cc0-1.0 language: - en metrics: - accuracy: 0.939432 - recall: 0.937164 - precision: 0.92822 - f1: 0.92822 tags: - classification - suicidality - suicidal text detection - suicidal sentiment - sentiment - suicide - self harm - depression pipeline_tag: text-classification --- # Advanced Suicidality Classifier Model ## Introduction Welcome to the Suicidality Detection AI Model! This project aims to provide a machine learning solution for detecting sequences of words indicative of suicidality in text. By utilizing the ELECTRA architecture and fine-tuning on a diverse dataset, we have created a powerful classification model that can distinguish between suicidal and non-suicidal text expressions. ## Labels The model classifies input text into two labels: - `LABEL_0`: Indicates that the text is non-suicidal. - `LABEL_1`: Indicates that the text is indicative of suicidality. ## Training The model was fine-tuned using the ELECTRA architecture on a carefully curated dataset. Our training process involved cleaning and preprocessing various text sources to create a comprehensive training set. The training results indicate promising performance, with metrics including: ## Performance The model's performance on the validation dataset is as follows: - Accuracy: 0.939432 - Recall: 0.937164 - Precision: 0.92822 - F1 Score: 0.932672 These metrics demonstrate the model's ability to accurately classify sequences of text as either indicative of suicidality or non-suicidal. ## Data Sources We collected data from multiple sources to create a rich and diverse training dataset: - https://www.kaggle.com/datasets/thedevastator/c-ssrs-labeled-suicidality-in-500-anonymized-red - https://www.kaggle.com/datasets/amangoyl/reddit-dataset-for-multi-task-nlp - https://www.kaggle.com/datasets/imeshsonu/suicideal-phrases - https://raw.githubusercontent.com/laxmimerit/twitter-suicidal-intention-dataset/master/twitter-suicidal_data.csv - https://www.kaggle.com/datasets/mohanedmashaly/suicide-notes - https://www.kaggle.com/datasets/natalialech/suicidal-ideation-on-twitter The data underwent thorough cleaning and preprocessing before being used for training the model. ## How to Use ### Installation To use the model, you need to install the Transformers library: ```bash pip install transformers ``` ### Using the Model You can utilize the model for text classification using the following code snippets: 1. Using the pipeline approach: ```python from transformers import pipeline classifier = pipeline("sentiment-analysis", model="sentinetyd/suicidality") result = classifier("text to classify") print(result) ``` 2. Using the tokenizer and model programmatically: ```python from transformers import AutoTokenizer, AutoModel tokenizer = AutoTokenizer.from_pretrained("sentinetyd/suicidality") model = AutoModel.from_pretrained("sentinetyd/suicidality") # Perform tokenization and prediction using the tokenizer and model ``` ## Ethical Considerations Suicidality is a sensitive and serious topic. It's important to exercise caution and consider ethical implications when using this model. Predictions made by the model should be handled with care and used to complement human judgment and intervention. ## Model Credits We would like to acknowledge the "gooohjy/suicidal-electra" model available on Hugging Face's model repository. You can find the model at [this link](https://huggingface.co/gooohjy/suicidal-electra). We used this model as a starting point and fine-tuned it to create our specialized suicidality detection model. ## Contributions We welcome contributions and feedback from the community to further improve the model's performance, enhance the dataset, and ensure its responsible deployment.

mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF

mradermacher

transformers

--- base_model: adamo1139/Yi-34B-200K-AEZAKMI-v2 datasets: - adamo1139/AEZAKMI_v2 language: - en library_name: transformers license: apache-2.0 license_link: LICENSE license_name: yi-license quantized_by: mradermacher tags: - llm - fine-tune - yi --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: nicoboss --> weighted/imatrix quants of https://huggingface.co/adamo1139/Yi-34B-200K-AEZAKMI-v2 <!-- provided-files --> static quants are available at https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-IQ1_S.gguf) | i1-IQ1_S | 7.6 | for the desperate | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-IQ1_M.gguf) | i1-IQ1_M | 8.3 | mostly desperate | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-IQ2_XXS.gguf) | i1-IQ2_XXS | 9.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-IQ2_XS.gguf) | i1-IQ2_XS | 10.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-IQ2_S.gguf) | i1-IQ2_S | 11.0 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-IQ2_M.gguf) | i1-IQ2_M | 11.9 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-Q2_K.gguf) | i1-Q2_K | 12.9 | IQ3_XXS probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-IQ3_XXS.gguf) | i1-IQ3_XXS | 13.4 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-IQ3_XS.gguf) | i1-IQ3_XS | 14.3 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-Q3_K_S.gguf) | i1-Q3_K_S | 15.1 | IQ3_XS probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-IQ3_S.gguf) | i1-IQ3_S | 15.1 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-IQ3_M.gguf) | i1-IQ3_M | 15.7 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-Q3_K_M.gguf) | i1-Q3_K_M | 16.8 | IQ3_S probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-Q3_K_L.gguf) | i1-Q3_K_L | 18.2 | IQ3_M probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-IQ4_XS.gguf) | i1-IQ4_XS | 18.6 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-Q4_0.gguf) | i1-Q4_0 | 19.6 | fast, low quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-Q4_K_S.gguf) | i1-Q4_K_S | 19.7 | optimal size/speed/quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-Q4_K_M.gguf) | i1-Q4_K_M | 20.8 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-Q5_K_S.gguf) | i1-Q5_K_S | 23.8 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-Q5_K_M.gguf) | i1-Q5_K_M | 24.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-AEZAKMI-v2-i1-GGUF/resolve/main/Yi-34B-200K-AEZAKMI-v2.i1-Q6_K.gguf) | i1-Q6_K | 28.3 | practically like static Q6_K | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. Additional thanks to [@nicoboss](https://huggingface.co/nicoboss) for giving me access to his hardware for calculating the imatrix for these quants. <!-- end -->

HooshvareLab/bert-fa-base-uncased

HooshvareLab

transformers

fill-mask

--- language: fa tags: - bert-fa - bert-persian - persian-lm license: apache-2.0 --- # ParsBERT (v2.0) A Transformer-based Model for Persian Language Understanding We reconstructed the vocabulary and fine-tuned the ParsBERT v1.1 on the new Persian corpora in order to provide some functionalities for using ParsBERT in other scopes! Please follow the [ParsBERT](https://github.com/hooshvare/parsbert) repo for the latest information about previous and current models. ## Introduction ParsBERT is a monolingual language model based on Google’s BERT architecture. This model is pre-trained on large Persian corpora with various writing styles from numerous subjects (e.g., scientific, novels, news) with more than `3.9M` documents, `73M` sentences, and `1.3B` words. Paper presenting ParsBERT: [arXiv:2005.12515](https://arxiv.org/abs/2005.12515) ## Intended uses & limitations You can use the raw model for either masked language modeling or next sentence prediction, but it's mostly intended to be fine-tuned on a downstream task. See the [model hub](https://huggingface.co/models?search=bert-fa) to look for fine-tuned versions on a task that interests you. ### How to use #### TensorFlow 2.0 ```python from transformers import AutoConfig, AutoTokenizer, TFAutoModel config = AutoConfig.from_pretrained("HooshvareLab/bert-fa-base-uncased") tokenizer = AutoTokenizer.from_pretrained("HooshvareLab/bert-fa-base-uncased") model = TFAutoModel.from_pretrained("HooshvareLab/bert-fa-base-uncased") text = "ما در هوشواره معتقدیم با انتقال صحیح دانش و آگاهی، همه افراد میتوانند از ابزارهای هوشمند استفاده کنند. شعار ما هوش مصنوعی برای همه است." tokenizer.tokenize(text) >>> ['ما', 'در', 'هوش', '##واره', 'معتقدیم', 'با', 'انتقال', 'صحیح', 'دانش', 'و', 'اگاهی', '،', 'همه', 'افراد', 'میتوانند', 'از', 'ابزارهای', 'هوشمند', 'استفاده', 'کنند', '.', 'شعار', 'ما', 'هوش', 'مصنوعی', 'برای', 'همه', 'است', '.'] ``` #### Pytorch ```python from transformers import AutoConfig, AutoTokenizer, AutoModel config = AutoConfig.from_pretrained("HooshvareLab/bert-fa-base-uncased") tokenizer = AutoTokenizer.from_pretrained("HooshvareLab/bert-fa-base-uncased") model = AutoModel.from_pretrained("HooshvareLab/bert-fa-base-uncased") ``` ## Training ParsBERT trained on a massive amount of public corpora ([Persian Wikidumps](https://dumps.wikimedia.org/fawiki/), [MirasText](https://github.com/miras-tech/MirasText)) and six other manually crawled text data from a various type of websites ([BigBang Page](https://bigbangpage.com/) `scientific`, [Chetor](https://www.chetor.com/) `lifestyle`, [Eligasht](https://www.eligasht.com/Blog/) `itinerary`, [Digikala](https://www.digikala.com/mag/) `digital magazine`, [Ted Talks](https://www.ted.com/talks) `general conversational`, Books `novels, storybooks, short stories from old to the contemporary era`). As a part of ParsBERT methodology, an extensive pre-processing combining POS tagging and WordPiece segmentation was carried out to bring the corpora into a proper format. ## Goals Objective goals during training are as below (after 300k steps). ``` bash ***** Eval results ***** global_step = 300000 loss = 1.4392426 masked_lm_accuracy = 0.6865794 masked_lm_loss = 1.4469004 next_sentence_accuracy = 1.0 next_sentence_loss = 6.534152e-05 ``` ## Derivative models ### Base Config #### ParsBERT v2.0 Model - [HooshvareLab/bert-fa-base-uncased](https://huggingface.co/HooshvareLab/bert-fa-base-uncased) #### ParsBERT v2.0 Sentiment Analysis - [HooshvareLab/bert-fa-base-uncased-sentiment-digikala](https://huggingface.co/HooshvareLab/bert-fa-base-uncased-sentiment-digikala) - [HooshvareLab/bert-fa-base-uncased-sentiment-snappfood](https://huggingface.co/HooshvareLab/bert-fa-base-uncased-sentiment-snappfood) - [HooshvareLab/bert-fa-base-uncased-sentiment-deepsentipers-binary](https://huggingface.co/HooshvareLab/bert-fa-base-uncased-sentiment-deepsentipers-binary) - [HooshvareLab/bert-fa-base-uncased-sentiment-deepsentipers-multi](https://huggingface.co/HooshvareLab/bert-fa-base-uncased-sentiment-deepsentipers-multi) #### ParsBERT v2.0 Text Classification - [HooshvareLab/bert-fa-base-uncased-clf-digimag](https://huggingface.co/HooshvareLab/bert-fa-base-uncased-clf-digimag) - [HooshvareLab/bert-fa-base-uncased-clf-persiannews](https://huggingface.co/HooshvareLab/bert-fa-base-uncased-clf-persiannews) #### ParsBERT v2.0 NER - [HooshvareLab/bert-fa-base-uncased-ner-peyma](https://huggingface.co/HooshvareLab/bert-fa-base-uncased-ner-peyma) - [HooshvareLab/bert-fa-base-uncased-ner-arman](https://huggingface.co/HooshvareLab/bert-fa-base-uncased-ner-arman) ## Eval results ParsBERT is evaluated on three NLP downstream tasks: Sentiment Analysis (SA), Text Classification, and Named Entity Recognition (NER). For this matter and due to insufficient resources, two large datasets for SA and two for text classification were manually composed, which are available for public use and benchmarking. ParsBERT outperformed all other language models, including multilingual BERT and other hybrid deep learning models for all tasks, improving the state-of-the-art performance in Persian language modeling. ### Sentiment Analysis (SA) Task | Dataset | ParsBERT v2 | ParsBERT v1 | mBERT | DeepSentiPers | |:------------------------:|:-----------:|:-----------:|:-----:|:-------------:| | Digikala User Comments | 81.72 | 81.74* | 80.74 | - | | SnappFood User Comments | 87.98 | 88.12* | 87.87 | - | | SentiPers (Multi Class) | 71.31* | 71.11 | - | 69.33 | | SentiPers (Binary Class) | 92.42* | 92.13 | - | 91.98 | ### Text Classification (TC) Task | Dataset | ParsBERT v2 | ParsBERT v1 | mBERT | |:-----------------:|:-----------:|:-----------:|:-----:| | Digikala Magazine | 93.65* | 93.59 | 90.72 | | Persian News | 97.44* | 97.19 | 95.79 | ### Named Entity Recognition (NER) Task | Dataset | ParsBERT v2 | ParsBERT v1 | mBERT | MorphoBERT | Beheshti-NER | LSTM-CRF | Rule-Based CRF | BiLSTM-CRF | |:-------:|:-----------:|:-----------:|:-----:|:----------:|:------------:|:--------:|:--------------:|:----------:| | PEYMA | 93.40* | 93.10 | 86.64 | - | 90.59 | - | 84.00 | - | | ARMAN | 99.84* | 98.79 | 95.89 | 89.9 | 84.03 | 86.55 | - | 77.45 | ### BibTeX entry and citation info Please cite in publications as the following: ```bibtex @article{ParsBERT, title={ParsBERT: Transformer-based Model for Persian Language Understanding}, author={Mehrdad Farahani, Mohammad Gharachorloo, Marzieh Farahani, Mohammad Manthouri}, journal={ArXiv}, year={2020}, volume={abs/2005.12515} } ``` ## Questions? Post a Github issue on the [ParsBERT Issues](https://github.com/hooshvare/parsbert/issues) repo.

cross-encoder/nli-deberta-base

cross-encoder

transformers

zero-shot-classification

--- language: en pipeline_tag: zero-shot-classification tags: - deberta-base-base datasets: - multi_nli - snli metrics: - accuracy license: apache-2.0 --- # Cross-Encoder for Natural Language Inference This model was trained using [SentenceTransformers](https://sbert.net) [Cross-Encoder](https://www.sbert.net/examples/applications/cross-encoder/README.html) class. ## Training Data The model was trained on the [SNLI](https://nlp.stanford.edu/projects/snli/) and [MultiNLI](https://cims.nyu.edu/~sbowman/multinli/) datasets. For a given sentence pair, it will output three scores corresponding to the labels: contradiction, entailment, neutral. ## Performance For evaluation results, see [SBERT.net - Pretrained Cross-Encoder](https://www.sbert.net/docs/pretrained_cross-encoders.html#nli). ## Usage Pre-trained models can be used like this: ```python from sentence_transformers import CrossEncoder model = CrossEncoder('cross-encoder/nli-deberta-base') scores = model.predict([('A man is eating pizza', 'A man eats something'), ('A black race car starts up in front of a crowd of people.', 'A man is driving down a lonely road.')]) #Convert scores to labels label_mapping = ['contradiction', 'entailment', 'neutral'] labels = [label_mapping[score_max] for score_max in scores.argmax(axis=1)] ``` ## Usage with Transformers AutoModel You can use the model also directly with Transformers library (without SentenceTransformers library): ```python from transformers import AutoTokenizer, AutoModelForSequenceClassification import torch model = AutoModelForSequenceClassification.from_pretrained('cross-encoder/nli-deberta-base') tokenizer = AutoTokenizer.from_pretrained('cross-encoder/nli-deberta-base') features = tokenizer(['A man is eating pizza', 'A black race car starts up in front of a crowd of people.'], ['A man eats something', 'A man is driving down a lonely road.'], padding=True, truncation=True, return_tensors="pt") model.eval() with torch.no_grad(): scores = model(**features).logits label_mapping = ['contradiction', 'entailment', 'neutral'] labels = [label_mapping[score_max] for score_max in scores.argmax(dim=1)] print(labels) ``` ## Zero-Shot Classification This model can also be used for zero-shot-classification: ```python from transformers import pipeline classifier = pipeline("zero-shot-classification", model='cross-encoder/nli-deberta-base') sent = "Apple just announced the newest iPhone X" candidate_labels = ["technology", "sports", "politics"] res = classifier(sent, candidate_labels) print(res) ```

RishuD7/finetune_base_bge_pretrained_v4

RishuD7

transformers

feature-extraction

Entry not found

cerspense/zeroscope_v2_576w

cerspense

diffusers

text-to-video

--- pipeline_tag: text-to-video license: cc-by-nc-4.0 ---  # zeroscope_v2 576w A watermark-free Modelscope-based video model optimized for producing high-quality 16:9 compositions and a smooth video output. This model was trained from the [original weights](https://huggingface.co/damo-vilab/modelscope-damo-text-to-video-synthesis) using 9,923 clips and 29,769 tagged frames at 24 frames, 576x320 resolution.<br /> zeroscope_v2_567w is specifically designed for upscaling with [zeroscope_v2_XL](https://huggingface.co/cerspense/zeroscope_v2_XL) using vid2vid in the [1111 text2video](https://github.com/kabachuha/sd-webui-text2video) extension by [kabachuha](https://github.com/kabachuha). Leveraging this model as a preliminary step allows for superior overall compositions at higher resolutions in zeroscope_v2_XL, permitting faster exploration in 576x320 before transitioning to a high-resolution render. See some [example outputs](https://www.youtube.com/watch?v=HO3APT_0UA4) that have been upscaled to 1024x576 using zeroscope_v2_XL. (courtesy of [dotsimulate](https://www.instagram.com/dotsimulate/))<br /> zeroscope_v2_576w uses 7.9gb of vram when rendering 30 frames at 576x320 ### Using it with the 1111 text2video extension 1. Download files in the zs2_576w folder. 2. Replace the respective files in the 'stable-diffusion-webui\models\ModelScope\t2v' directory. ### Upscaling recommendations For upscaling, it's recommended to use [zeroscope_v2_XL](https://huggingface.co/cerspense/zeroscope_v2_XL) via vid2vid in the 1111 extension. It works best at 1024x576 with a denoise strength between 0.66 and 0.85. Remember to use the same prompt that was used to generate the original clip. <br /> ### Usage in 🧨 Diffusers Let's first install the libraries required: ```bash $ pip install diffusers transformers accelerate torch ``` Now, generate a video: ```py import torch from diffusers import DiffusionPipeline, DPMSolverMultistepScheduler from diffusers.utils import export_to_video pipe = DiffusionPipeline.from_pretrained("cerspense/zeroscope_v2_576w", torch_dtype=torch.float16) pipe.scheduler = DPMSolverMultistepScheduler.from_config(pipe.scheduler.config) pipe.enable_model_cpu_offload() prompt = "Darth Vader is surfing on waves" video_frames = pipe(prompt, num_inference_steps=40, height=320, width=576, num_frames=24).frames video_path = export_to_video(video_frames) ``` Here are some results: <table> <tr> Darth vader is surfing on waves. <br> <img src="https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/diffusers/darthvader_cerpense.gif" alt="Darth vader surfing in waves." style="width: 576;" /> </center></td> </tr> </table> ### Known issues Lower resolutions or fewer frames could lead to suboptimal output. <br /> Thanks to [camenduru](https://github.com/camenduru), [kabachuha](https://github.com/kabachuha), [ExponentialML](https://github.com/ExponentialML), [dotsimulate](https://www.instagram.com/dotsimulate/), [VANYA](https://twitter.com/veryVANYA), [polyware](https://twitter.com/polyware_ai), [tin2tin](https://github.com/tin2tin)<br />

naver/efficient-splade-VI-BT-large-doc

naver

transformers

fill-mask

--- license: cc-by-nc-sa-4.0 language: "en" tags: - splade - query-expansion - document-expansion - bag-of-words - passage-retrieval - knowledge-distillation - document encoder datasets: - ms_marco --- ## Efficient SPLADE Efficient SPLADE model for passage retrieval. This architecture uses two distinct models for query and document inference. This is the **doc** one, please also download the **query** one (https://huggingface.co/naver/efficient-splade-VI-BT-large-query). For additional details, please visit: * paper: https://dl.acm.org/doi/10.1145/3477495.3531833 * code: https://github.com/naver/splade | | MRR@10 (MS MARCO dev) | R@1000 (MS MARCO dev) | Latency (PISA) ms | Latency (Inference) ms | --- | --- | --- | --- | --- | | `naver/efficient-splade-V-large` | 38.8 | 98.0 | 29.0 | 45.3 | `naver/efficient-splade-VI-BT-large` | 38.0 | 97.8 | 31.1 | 0.7 ## Citation If you use our checkpoint, please cite our work: ``` @inproceedings{10.1145/3477495.3531833, author = {Lassance, Carlos and Clinchant, St\'{e}phane}, title = {An Efficiency Study for SPLADE Models}, year = {2022}, isbn = {9781450387323}, publisher = {Association for Computing Machinery}, address = {New York, NY, USA}, url = {https://doi.org/10.1145/3477495.3531833}, doi = {10.1145/3477495.3531833}, abstract = {Latency and efficiency issues are often overlooked when evaluating IR models based on Pretrained Language Models (PLMs) in reason of multiple hardware and software testing scenarios. Nevertheless, efficiency is an important part of such systems and should not be overlooked. In this paper, we focus on improving the efficiency of the SPLADE model since it has achieved state-of-the-art zero-shot performance and competitive results on TREC collections. SPLADE efficiency can be controlled via a regularization factor, but solely controlling this regularization has been shown to not be efficient enough. In order to reduce the latency gap between SPLADE and traditional retrieval systems, we propose several techniques including L1 regularization for queries, a separation of document/query encoders, a FLOPS-regularized middle-training, and the use of faster query encoders. Our benchmark demonstrates that we can drastically improve the efficiency of these models while increasing the performance metrics on in-domain data. To our knowledge, we propose the first neural models that, under the same computing constraints, achieve similar latency (less than 4ms difference) as traditional BM25, while having similar performance (less than 10% MRR@10 reduction) as the state-of-the-art single-stage neural rankers on in-domain data.}, booktitle = {Proceedings of the 45th International ACM SIGIR Conference on Research and Development in Information Retrieval}, pages = {2220–2226}, numpages = {7}, keywords = {splade, latency, information retrieval, sparse representations}, location = {Madrid, Spain}, series = {SIGIR '22} } ```

openchat/openchat-3.5-0106

openchat

transformers

text-generation

--- license: apache-2.0 base_model: mistralai/Mistral-7B-v0.1 tags: - openchat - mistral - C-RLFT library_name: transformers pipeline_tag: text-generation --- <div align="center"> <img src="https://raw.githubusercontent.com/imoneoi/openchat/master/assets/logo_new.png" style="width: 65%"> <h1>Advancing Open-source Language Models with Mixed-Quality Data</h1> </div> <p align="center" style="margin-top: 0px;"> <a href="https://openchat.team"> <img src="https://github.com/alpayariyak/openchat/blob/master/assets/logo_nobg.png?raw=true" alt="OpenChat Logo" style="width:20px; vertical-align: middle; display: inline-block; margin-right: 5px; margin-left: 10px; margin-top: 0px; margin-bottom: 0px;"/> <span class="link-text" style=" margin-right: 5px;">Online Demo</span> </a> | <a href="https://github.com/imoneoi/openchat"> <img src="https://github.githubassets.com/assets/GitHub-Mark-ea2971cee799.png" alt="GitHub Logo" style="width:20px; vertical-align: middle; display: inline-block; margin-right: 5px; margin-left: 5px; margin-top: 0px; margin-bottom: 0px;"/> <span class="link-text" style=" margin-right: 5px;">GitHub</span> </a> | <a href="https://arxiv.org/pdf/2309.11235.pdf"> <img src="https://github.com/alpayariyak/openchat/blob/master/assets/arxiv-logomark-small-square-border.png?raw=true" alt="ArXiv Logo" style="width:20px; vertical-align: middle; display: inline-block; margin-right: 5px; margin-left: 5px; margin-top: 0px; margin-bottom: 0px;"/> <span class="link-text" style="margin-right: 5px;">Paper</span> </a> | <a href="https://discord.gg/pQjnXvNKHY"> <img src="https://cloud.githubusercontent.com/assets/6291467/26705903/96c2d66e-477c-11e7-9f4e-f3c0efe96c9a.png" alt="Discord Logo" style="width:20px; vertical-align: middle; display: inline-block; margin-right: 5px; margin-left: 5px; margin-top: 0px; margin-bottom: 0px;"/> <span class="link-text">Discord</span> </a> </p> <p align="center" style="margin-top: 0px;"> <span class="link-text" style=" margin-right: 0px; font-size: 0.8em">Sponsored by RunPod</span> <img src="https://styles.redditmedia.com/t5_6075m3/styles/profileIcon_71syco7c5lt81.png?width=256&height=256&frame=1&auto=webp&crop=256:256,smart&s=24bd3c71dc11edc5d4f88d0cbc1da72ed7ae1969" alt="RunPod Logo" style="width:30px; vertical-align: middle; display: inline-block; margin-right: 5px; margin-left: 5px; margin-top: 0px; margin-bottom: 0px;"/> </p> <div style="background-color: white; padding: 0.7em; border-radius: 0.5em; color: black; display: flex; flex-direction: column; justify-content: center; text-align: center; ont-size: 0.5em; border: 0.8em solid #864AF9;"> <a href="https://huggingface.co/openchat/openchat-3.5-0106" style="text-decoration: none; color: black;"> <span style="font-size: 1.7em; font-family: 'Helvetica'; letter-spacing: 0.1em; font-weight: bold; color: black;">OPENCHAT</span><span style="font-size: 1.8em; font-family: 'Helvetica'; color: #3c72db; ">3.5</span> <span style="font-size: 1.0em; font-family: 'Helvetica'; color: white; background-color: #864AF9; vertical-align: top; border-radius: 6em; padding: 0.066em 0.4em; letter-spacing: 0.1em; font-weight: bold;">0106</span> <span style="font-size: 0.85em; font-family: 'Helvetica'; color: black;"> <br> 🏆 The Overall Best Performing Open Source 7B Model 🏆 <br> 🤖 Outperforms <span style="font-weight: bold;">ChatGPT</span> (March) and <span style="font-weight: bold;">Grok-1</span> 🤖 <br> 🚀<span style="font-size: 1em; font-family: 'Helvetica'; color: black; font-weight: bold;">15</span>-point improvement in Coding over <span style="font-size: 0.9em; font-family: 'Helvetica'; color: black; font-weight: bold;">OpenChat-3.5🚀</span> <br><br><span style="font-size: 1em; font-family: 'Helvetica'; color: #3c72db; font-weight: bold;">New Features</span> <br> 💡 2 Modes: Coding + Generalist, Mathematical Reasoning 💡 <br> 🧑‍⚖️ Experimental support for Evaluator and Feedback capabilities 🧑‍⚖️ </span> </a> </div> <div style="display: flex; justify-content: center; align-items: center"> <img src="https://raw.githubusercontent.com/imoneoi/openchat/master/assets/openchat-bench-0106.png" style="width: 100%; border-radius: 1em"> </div> <div> <h3> Table of Contents</h3> </div> 1. [Usage](#usage) 2. [Benchmarks](#benchmarks) 3. [Limitations](#limitations) 4. [License](#license) 6. [Citation](#citation) 7. [Acknowledgements](#acknowledgements) <div align="center"> <h2> Usage </h2> </div> To use this model, we highly recommend installing the OpenChat package by following the [installation guide](https://github.com/imoneoi/openchat#installation) in our repository and using the OpenChat OpenAI-compatible API server by running the serving command from the table below. The server is optimized for high-throughput deployment using [vLLM](https://github.com/vllm-project/vllm) and can run on a consumer GPU with 24GB RAM. To enable tensor parallelism, append `--tensor-parallel-size N` to the serving command. Once started, the server listens at `localhost:18888` for requests and is compatible with the [OpenAI ChatCompletion API specifications](https://platform.openai.com/docs/api-reference/chat). Please refer to the example request below for reference. Additionally, you can use the [OpenChat Web UI](https://github.com/imoneoi/openchat#web-ui) for a user-friendly experience. If you want to deploy the server as an online service, you can use `--api-keys sk-KEY1 sk-KEY2 ...` to specify allowed API keys and `--disable-log-requests --disable-log-stats --log-file openchat.log` for logging only to a file. For security purposes, we recommend using an [HTTPS gateway](https://fastapi.tiangolo.com/es/deployment/concepts/#security-https) in front of the server. | Model | Size | Context | Weights | Serving | |-------------------|------|---------|------------------------------------------------------------------|------------------------------------------------------------------------------------------------------------------| | OpenChat-3.5-0106 | 7B | 8192 | [Huggingface](https://huggingface.co/openchat/openchat-3.5-0106) | `python -m ochat.serving.openai_api_server --model openchat/openchat-3.5-0106 --engine-use-ray --worker-use-ray` | <details> <summary>Example request (click to expand)</summary> 💡 **Default Mode (GPT4 Correct)**: Best for coding, chat and general tasks ```bash curl http://localhost:18888/v1/chat/completions \ -H "Content-Type: application/json" \ -d '{ "model": "openchat_3.5", "messages": [{"role": "user", "content": "You are a large language model named OpenChat. Write a poem to describe yourself"}] }' ``` 🧮 **Mathematical Reasoning Mode**: Tailored for solving math problems ```bash curl http://localhost:18888/v1/chat/completions \ -H "Content-Type: application/json" \ -d '{ "model": "openchat_3.5", "condition": "Math Correct", "messages": [{"role": "user", "content": "10.3 − 7988.8133 = "}] }' ``` </details> ### Conversation templates 💡 **Default Mode (GPT4 Correct)**: Best for coding, chat and general tasks ``` GPT4 Correct User: Hello<|end_of_turn|>GPT4 Correct Assistant: Hi<|end_of_turn|>GPT4 Correct User: How are you today?<|end_of_turn|>GPT4 Correct Assistant: ``` 🧮 **Mathematical Reasoning Mode**: Tailored for solving math problems ``` Math Correct User: 10.3 − 7988.8133=<|end_of_turn|>Math Correct Assistant: ``` ⚠️ **Notice:** Remember to set `<|end_of_turn|>` as end of generation token. The default (GPT4 Correct) template is also available as the integrated `tokenizer.chat_template`, which can be used instead of manually specifying the template: ```python messages = [ {"role": "user", "content": "Hello"}, {"role": "assistant", "content": "Hi"}, {"role": "user", "content": "How are you today?"} ] tokens = tokenizer.apply_chat_template(messages, add_generation_prompt=True) assert tokens == [1, 420, 6316, 28781, 3198, 3123, 1247, 28747, 22557, 32000, 420, 6316, 28781, 3198, 3123, 21631, 28747, 15359, 32000, 420, 6316, 28781, 3198, 3123, 1247, 28747, 1602, 460, 368, 3154, 28804, 32000, 420, 6316, 28781, 3198, 3123, 21631, 28747] ``` <div align="center"> <h2> (Experimental) Evaluator / Feedback Capabilities </h2> </div> We've included evaluator capabilities in this release to advance open-source models as evaluators. You can use `Default Mode (GPT4 Correct)` with the following prompt (same as [Prometheus](https://huggingface.co/datasets/kaist-ai/Feedback-Collection)) to evaluate a response. ``` ###Task Description: An instruction (might include an Input inside it), a response to evaluate, a reference answer that gets a score of 5, and a score rubric representing a evaluation criteria are given. 1. Write a detailed feedback that assess the quality of the response strictly based on the given score rubric, not evaluating in general. 2. After writing a feedback, write a score that is an integer between 1 and 5. You should refer to the score rubric. 3. The output format should look as follows: "Feedback: (write a feedback for criteria) [RESULT] (an integer number between 1 and 5)" 4. Please do not generate any other opening, closing, and explanations. ###The instruction to evaluate: {orig_instruction} ###Response to evaluate: {orig_response} ###Reference Answer (Score 5): {orig_reference_answer} ###Score Rubrics: [{orig_criteria}] Score 1: {orig_score1_description} Score 2: {orig_score2_description} Score 3: {orig_score3_description} Score 4: {orig_score4_description} Score 5: {orig_score5_description} ###Feedback: ``` <div align="center"> <h2> Benchmarks </h2> </div> | Model | # Params | Average | MT-Bench | HumanEval | BBH MC | AGIEval | TruthfulQA | MMLU | GSM8K | BBH CoT | |-----------------------|----------|----------|----------|-----------|----------|----------|------------|----------|----------|----------| | **OpenChat-3.5-0106** | **7B** | **64.5** | 7.8 | **71.3** | **51.5** | **49.1** | 61.0 | 65.8 | **77.4** | 62.2 | | OpenChat-3.5-1210 | **7B** | 63.8 | 7.76 | 68.9 | 49.5 | 48.0 | **61.8** | 65.3 | 77.3 | 61.8 | | OpenChat-3.5 | **7B** | 61.6 | 7.81 | 55.5 | 47.6 | 47.4 | 59.1 | 64.3 | 77.3 | 63.5 | | ChatGPT (March)* | ???B | 61.5 | **7.94** | 48.1 | 47.6 | 47.1 | 57.7 | **67.3** | 74.9 | **70.1** | | | | | | | | | | | | | | OpenHermes 2.5 | 7B | 59.3 | 7.54 | 48.2 | 49.4 | 46.5 | 57.5 | 63.8 | 73.5 | 59.9 | | OpenOrca Mistral | 7B | 52.7 | 6.86 | 38.4 | 49.4 | 42.9 | 45.9 | 59.3 | 59.1 | 58.1 | | Zephyr-β^ | 7B | 34.6 | 7.34 | 22.0 | 40.6 | 39.0 | 40.8 | 39.8 | 5.1 | 16.0 | | Mistral | 7B | - | 6.84 | 30.5 | 39.0 | 38.0 | - | 60.1 | 52.2 | - | <details> <summary>Evaluation Details(click to expand)</summary> *: ChatGPT (March) results are from [GPT-4 Technical Report](https://arxiv.org/abs/2303.08774), [Chain-of-Thought Hub](https://github.com/FranxYao/chain-of-thought-hub), and our evaluation. Please note that ChatGPT is not a fixed baseline and evolves rapidly over time. ^: Zephyr-β often fails to follow few-shot CoT instructions, likely because it was aligned with only chat data but not trained on few-shot data. **: Mistral and Open-source SOTA results are taken from reported results in instruction-tuned model papers and official repositories. All models are evaluated in chat mode (e.g. with the respective conversation template applied). All zero-shot benchmarks follow the same setting as in the AGIEval paper and Orca paper. CoT tasks use the same configuration as Chain-of-Thought Hub, HumanEval is evaluated with EvalPlus, and MT-bench is run using FastChat. To reproduce our results, follow the instructions in [our repository](https://github.com/imoneoi/openchat/#benchmarks). </details> <div> <h3>HumanEval+</h3> </div> | Model | Size | HumanEval+ pass@1 | |-----------------------------|--------|-------------------| | **OpenChat-3.5-0106** | **7B** | **65.9** | | ChatGPT (December 12, 2023) | ???B | 64.6 | | WizardCoder-Python-34B-V1.0 | 34B | 64.6 | | OpenChat 3.5 1210 | 7B | 63.4 | | OpenHermes 2.5 | 7B | 41.5 | <div> <h3>OpenChat-3.5 vs. Grok</h3> </div> 🔥 OpenChat-3.5-0106 (7B) now outperforms Grok-0 (33B) on **all 4 benchmarks** and Grok-1 (???B) on average and **3/4 benchmarks**. | | License | # Param | Average | MMLU | HumanEval | MATH | GSM8k | |-----------------------|-------------|---------|----------|--------|-----------|----------|----------| | **OpenChat-3.5-0106** | Apache-2.0 | **7B** | **61.0** | 65.8 | **71.3** | **29.3** | **77.4** | | OpenChat-3.5-1210 | Apache-2.0 | **7B** | 60.1 | 65.3 | 68.9 | 28.9 | 77.3 | | OpenChat-3.5 | Apache-2.0 | **7B** | 56.4 | 64.3 | 55.5 | 28.6 | 77.3 | | Grok-0 | Proprietary | 33B | 44.5 | 65.7 | 39.7 | 15.7 | 56.8 | | Grok-1 | Proprietary | ???B | 55.8 | **73** | 63.2 | 23.9 | 62.9 | *: Grok results are reported by [X.AI](https://x.ai/). <div align="center"> <h2> Limitations </h2> </div> **Foundation Model Limitations** Despite its advanced capabilities, OpenChat is still bound by the limitations inherent in its foundation models. These limitations may impact the model's performance in areas such as: - Complex reasoning - Mathematical and arithmetic tasks - Programming and coding challenges **Hallucination of Non-existent Information** OpenChat may sometimes generate information that does not exist or is not accurate, also known as "hallucination". Users should be aware of this possibility and verify any critical information obtained from the model. **Safety** OpenChat may sometimes generate harmful, hate speech, biased responses, or answer unsafe questions. It's crucial to apply additional AI safety measures in use cases that require safe and moderated responses. <div align="center"> <h2> License </h2> </div> Our OpenChat 3.5 code and models are distributed under the Apache License 2.0. <div align="center"> <h2> Citation </h2> </div> ``` @article{wang2023openchat, title={OpenChat: Advancing Open-source Language Models with Mixed-Quality Data}, author={Wang, Guan and Cheng, Sijie and Zhan, Xianyuan and Li, Xiangang and Song, Sen and Liu, Yang}, journal={arXiv preprint arXiv:2309.11235}, year={2023} } ``` <div align="center"> <h2> 💌 Contact </h2> </div> We look forward to hearing you and collaborating on this exciting project! **Project Lead:** - Guan Wang [imonenext at gmail dot com] - [Alpay Ariyak](https://github.com/alpayariyak) [aariyak at wpi dot edu]

indolem/indobert-base-uncased

indolem

transformers

fill-mask

--- language: id tags: - indobert - indolem license: mit inference: False --- ## About [IndoBERT](https://arxiv.org/pdf/2011.00677.pdf) is the Indonesian version of BERT model. We train the model using over 220M words, aggregated from three main sources: * Indonesian Wikipedia (74M words) * news articles from Kompas, Tempo (Tala et al., 2003), and Liputan6 (55M words in total) * an Indonesian Web Corpus (Medved and Suchomel, 2017) (90M words). We trained the model for 2.4M steps (180 epochs) with the final perplexity over the development set being <b>3.97</b> (similar to English BERT-base). This <b>IndoBERT</b> was used to examine IndoLEM - an Indonesian benchmark that comprises of seven tasks for the Indonesian language, spanning morpho-syntax, semantics, and discourse. | Task | Metric | Bi-LSTM | mBERT | MalayBERT | IndoBERT | | ---- | ---- | ---- | ---- | ---- | ---- | | POS Tagging | Acc | 95.4 | <b>96.8</b> | <b>96.8</b> | <b>96.8</b> | | NER UGM | F1| 70.9 | 71.6 | 73.2 | <b>74.9</b> | | NER UI | F1 | 82.2 | 82.2 | 87.4 | <b>90.1</b> | | Dep. Parsing (UD-Indo-GSD) | UAS/LAS | 85.25/80.35 | 86.85/81.78 | 86.99/81.87 | <b>87.12<b/>/<b>82.32</b> | | Dep. Parsing (UD-Indo-PUD) | UAS/LAS | 84.04/79.01 | <b>90.58</b>/<b>85.44</b> | 88.91/83.56 | 89.23/83.95 | | Sentiment Analysis | F1 | 71.62 | 76.58 | 82.02 | <b>84.13</b> | | Summarization | R1/R2/RL | 67.96/61.65/67.24 | 68.40/61.66/67.67 | 68.44/61.38/67.71 | <b>69.93</b>/<b>62.86</b>/<b>69.21</b> | | Next Tweet Prediction | Acc | 73.6 | 92.4 | 93.1 | <b>93.7</b> | | Tweet Ordering | Spearman corr. | 0.45 | 0.53 | 0.51 | <b>0.59</b> | The paper is published at the 28th COLING 2020. Please refer to https://indolem.github.io for more details about the benchmarks. ## How to use ### Load model and tokenizer (tested with transformers==3.5.1) ```python from transformers import AutoTokenizer, AutoModel tokenizer = AutoTokenizer.from_pretrained("indolem/indobert-base-uncased") model = AutoModel.from_pretrained("indolem/indobert-base-uncased") ``` ## Citation If you use our work, please cite: ```bibtex @inproceedings{koto2020indolem, title={IndoLEM and IndoBERT: A Benchmark Dataset and Pre-trained Language Model for Indonesian NLP}, author={Fajri Koto and Afshin Rahimi and Jey Han Lau and Timothy Baldwin}, booktitle={Proceedings of the 28th COLING}, year={2020} } ```

meta-llama/Llama-2-70b-hf

meta-llama

transformers

text-generation

--- extra_gated_heading: You need to share contact information with Meta to access this model extra_gated_prompt: >- ### LLAMA 2 COMMUNITY LICENSE AGREEMENT "Agreement" means the terms and conditions for use, reproduction, distribution and modification of the Llama Materials set forth herein. "Documentation" means the specifications, manuals and documentation accompanying Llama 2 distributed by Meta at https://ai.meta.com/resources/models-and-libraries/llama-downloads/. "Licensee" or "you" means you, or your employer or any other person or entity (if you are entering into this Agreement on such person or entity's behalf), of the age required under applicable laws, rules or regulations to provide legal consent and that has legal authority to bind your employer or such other person or entity if you are entering in this Agreement on their behalf. "Llama 2" means the foundational large language models and software and algorithms, including machine-learning model code, trained model weights, inference-enabling code, training-enabling code, fine-tuning enabling code and other elements of the foregoing distributed by Meta at ai.meta.com/resources/models-and-libraries/llama-downloads/. "Llama Materials" means, collectively, Meta's proprietary Llama 2 and documentation (and any portion thereof) made available under this Agreement. "Meta" or "we" means Meta Platforms Ireland Limited (if you are located in or, if you are an entity, your principal place of business is in the EEA or Switzerland) and Meta Platforms, Inc. (if you are located outside of the EEA or Switzerland). By clicking "I Accept" below or by using or distributing any portion or element of the Llama Materials, you agree to be bound by this Agreement. 1. License Rights and Redistribution. a. Grant of Rights. You are granted a non-exclusive, worldwide, non- transferable and royalty-free limited license under Meta's intellectual property or other rights owned by Meta embodied in the Llama Materials to use, reproduce, distribute, copy, create derivative works of, and make modifications to the Llama Materials. b. Redistribution and Use. i. If you distribute or make the Llama Materials, or any derivative works thereof, available to a third party, you shall provide a copy of this Agreement to such third party. ii. If you receive Llama Materials, or any derivative works thereof, from a Licensee as part of an integrated end user product, then Section 2 of this Agreement will not apply to you. iii. You must retain in all copies of the Llama Materials that you distribute the following attribution notice within a "Notice" text file distributed as a part of such copies: "Llama 2 is licensed under the LLAMA 2 Community License, Copyright (c) Meta Platforms, Inc. All Rights Reserved." iv. Your use of the Llama Materials must comply with applicable laws and regulations (including trade compliance laws and regulations) and adhere to the Acceptable Use Policy for the Llama Materials (available at https://ai.meta.com/llama/use-policy), which is hereby incorporated by reference into this Agreement. v. You will not use the Llama Materials or any output or results of the Llama Materials to improve any other large language model (excluding Llama 2 or derivative works thereof). 2. Additional Commercial Terms. If, on the Llama 2 version release date, the monthly active users of the products or services made available by or for Licensee, or Licensee's affiliates, is greater than 700 million monthly active users in the preceding calendar month, you must request a license from Meta, which Meta may grant to you in its sole discretion, and you are not authorized to exercise any of the rights under this Agreement unless or until Meta otherwise expressly grants you such rights. 3. Disclaimer of Warranty. UNLESS REQUIRED BY APPLICABLE LAW, THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS THEREFROM ARE PROVIDED ON AN "AS IS" BASIS, WITHOUT WARRANTIES OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING, WITHOUT LIMITATION, ANY WARRANTIES OF TITLE, NON-INFRINGEMENT, MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE. YOU ARE SOLELY RESPONSIBLE FOR DETERMINING THE APPROPRIATENESS OF USING OR REDISTRIBUTING THE LLAMA MATERIALS AND ASSUME ANY RISKS ASSOCIATED WITH YOUR USE OF THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS. 4. Limitation of Liability. IN NO EVENT WILL META OR ITS AFFILIATES BE LIABLE UNDER ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, TORT, NEGLIGENCE, PRODUCTS LIABILITY, OR OTHERWISE, ARISING OUT OF THIS AGREEMENT, FOR ANY LOST PROFITS OR ANY INDIRECT, SPECIAL, CONSEQUENTIAL, INCIDENTAL, EXEMPLARY OR PUNITIVE DAMAGES, EVEN IF META OR ITS AFFILIATES HAVE BEEN ADVISED OF THE POSSIBILITY OF ANY OF THE FOREGOING. 5. Intellectual Property. a. No trademark licenses are granted under this Agreement, and in connection with the Llama Materials, neither Meta nor Licensee may use any name or mark owned by or associated with the other or any of its affiliates, except as required for reasonable and customary use in describing and redistributing the Llama Materials. b. Subject to Meta's ownership of Llama Materials and derivatives made by or for Meta, with respect to any derivative works and modifications of the Llama Materials that are made by you, as between you and Meta, you are and will be the owner of such derivative works and modifications. c. If you institute litigation or other proceedings against Meta or any entity (including a cross-claim or counterclaim in a lawsuit) alleging that the Llama Materials or Llama 2 outputs or results, or any portion of any of the foregoing, constitutes infringement of intellectual property or other rights owned or licensable by you, then any licenses granted to you under this Agreement shall terminate as of the date such litigation or claim is filed or instituted. You will indemnify and hold harmless Meta from and against any claim by any third party arising out of or related to your use or distribution of the Llama Materials. 6. Term and Termination. The term of this Agreement will commence upon your acceptance of this Agreement or access to the Llama Materials and will continue in full force and effect until terminated in accordance with the terms and conditions herein. Meta may terminate this Agreement if you are in breach of any term or condition of this Agreement. Upon termination of this Agreement, you shall delete and cease use of the Llama Materials. Sections 3, 4 and 7 shall survive the termination of this Agreement. 7. Governing Law and Jurisdiction. This Agreement will be governed and construed under the laws of the State of California without regard to choice of law principles, and the UN Convention on Contracts for the International Sale of Goods does not apply to this Agreement. The courts of California shall have exclusive jurisdiction of any dispute arising out of this Agreement. ### Llama 2 Acceptable Use Policy Meta is committed to promoting safe and fair use of its tools and features, including Llama 2. If you access or use Llama 2, you agree to this Acceptable Use Policy (“Policy”). The most recent copy of this policy can be found at [ai.meta.com/llama/use-policy](http://ai.meta.com/llama/use-policy). #### Prohibited Uses We want everyone to use Llama 2 safely and responsibly. You agree you will not use, or allow others to use, Llama 2 to: 1. Violate the law or others’ rights, including to: 1. Engage in, promote, generate, contribute to, encourage, plan, incite, or further illegal or unlawful activity or content, such as: 1. Violence or terrorism 2. Exploitation or harm to children, including the solicitation, creation, acquisition, or dissemination of child exploitative content or failure to report Child Sexual Abuse Material 3. Human trafficking, exploitation, and sexual violence 4. The illegal distribution of information or materials to minors, including obscene materials, or failure to employ legally required age-gating in connection with such information or materials. 5. Sexual solicitation 6. Any other criminal activity 2. Engage in, promote, incite, or facilitate the harassment, abuse, threatening, or bullying of individuals or groups of individuals 3. Engage in, promote, incite, or facilitate discrimination or other unlawful or harmful conduct in the provision of employment, employment benefits, credit, housing, other economic benefits, or other essential goods and services 4. Engage in the unauthorized or unlicensed practice of any profession including, but not limited to, financial, legal, medical/health, or related professional practices 5. Collect, process, disclose, generate, or infer health, demographic, or other sensitive personal or private information about individuals without rights and consents required by applicable laws 6. Engage in or facilitate any action or generate any content that infringes, misappropriates, or otherwise violates any third-party rights, including the outputs or results of any products or services using the Llama 2 Materials 7. Create, generate, or facilitate the creation of malicious code, malware, computer viruses or do anything else that could disable, overburden, interfere with or impair the proper working, integrity, operation or appearance of a website or computer system 2. Engage in, promote, incite, facilitate, or assist in the planning or development of activities that present a risk of death or bodily harm to individuals, including use of Llama 2 related to the following: 1. Military, warfare, nuclear industries or applications, espionage, use for materials or activities that are subject to the International Traffic Arms Regulations (ITAR) maintained by the United States Department of State 2. Guns and illegal weapons (including weapon development) 3. Illegal drugs and regulated/controlled substances 4. Operation of critical infrastructure, transportation technologies, or heavy machinery 5. Self-harm or harm to others, including suicide, cutting, and eating disorders 6. Any content intended to incite or promote violence, abuse, or any infliction of bodily harm to an individual 3. Intentionally deceive or mislead others, including use of Llama 2 related to the following: 1. Generating, promoting, or furthering fraud or the creation or promotion of disinformation 2. Generating, promoting, or furthering defamatory content, including the creation of defamatory statements, images, or other content 3. Generating, promoting, or further distributing spam 4. Impersonating another individual without consent, authorization, or legal right 5. Representing that the use of Llama 2 or outputs are human-generated 6. Generating or facilitating false online engagement, including fake reviews and other means of fake online engagement 4. Fail to appropriately disclose to end users any known dangers of your AI system Please report any violation of this Policy, software “bug,” or other problems that could lead to a violation of this Policy through one of the following means: * Reporting issues with the model: [github.com/facebookresearch/llama](http://github.com/facebookresearch/llama) * Reporting risky content generated by the model: [developers.facebook.com/llama_output_feedback](http://developers.facebook.com/llama_output_feedback) * Reporting bugs and security concerns: [facebook.com/whitehat/info](http://facebook.com/whitehat/info) * Reporting violations of the Acceptable Use Policy or unlicensed uses of Llama: [LlamaUseReport@meta.com](mailto:LlamaUseReport@meta.com) extra_gated_fields: First Name: text Last Name: text Date of birth: date_picker Country: country Affiliation: text geo: ip_location By clicking Submit below I accept the terms of the license and acknowledge that the information I provide will be collected stored processed and shared in accordance with the Meta Privacy Policy: checkbox extra_gated_description: >- The information you provide will be collected, stored, processed and shared in accordance with the [Meta Privacy Policy](https://www.facebook.com/privacy/policy/). extra_gated_button_content: Submit language: - en pipeline_tag: text-generation tags: - facebook - meta - pytorch - llama - llama-2 license: llama2 --- # **Llama 2** Llama 2 is a collection of pretrained and fine-tuned generative text models ranging in scale from 7 billion to 70 billion parameters. This is the repository for the 70B pretrained model, converted for the Hugging Face Transformers format. Links to other models can be found in the index at the bottom. ## Model Details *Note: Use of this model is governed by the Meta license. In order to download the model weights and tokenizer, please visit the [website](https://ai.meta.com/resources/models-and-libraries/llama-downloads/) and accept our License before requesting access here.* Meta developed and publicly released the Llama 2 family of large language models (LLMs), a collection of pretrained and fine-tuned generative text models ranging in scale from 7 billion to 70 billion parameters. Our fine-tuned LLMs, called Llama-2-Chat, are optimized for dialogue use cases. Llama-2-Chat models outperform open-source chat models on most benchmarks we tested, and in our human evaluations for helpfulness and safety, are on par with some popular closed-source models like ChatGPT and PaLM. **Model Developers** Meta **Variations** Llama 2 comes in a range of parameter sizes — 7B, 13B, and 70B — as well as pretrained and fine-tuned variations. **Input** Models input text only. **Output** Models generate text only. **Model Architecture** Llama 2 is an auto-regressive language model that uses an optimized transformer architecture. The tuned versions use supervised fine-tuning (SFT) and reinforcement learning with human feedback (RLHF) to align to human preferences for helpfulness and safety. ||Training Data|Params|Content Length|GQA|Tokens|LR| |---|---|---|---|---|---|---| |Llama 2|*A new mix of publicly available online data*|7B|4k|&#10007;|2.0T|3.0 x 10^-4| |Llama 2|*A new mix of publicly available online data*|13B|4k|&#10007;|2.0T|3.0 x 10^-4| |Llama 2|*A new mix of publicly available online data*|70B|4k|&#10004;|2.0T|1.5 x 10^-4| *Llama 2 family of models.* Token counts refer to pretraining data only. All models are trained with a global batch-size of 4M tokens. Bigger models - 70B -- use Grouped-Query Attention (GQA) for improved inference scalability. **Model Dates** Llama 2 was trained between January 2023 and July 2023. **Status** This is a static model trained on an offline dataset. Future versions of the tuned models will be released as we improve model safety with community feedback. **License** A custom commercial license is available at: [https://ai.meta.com/resources/models-and-libraries/llama-downloads/](https://ai.meta.com/resources/models-and-libraries/llama-downloads/) **Research Paper** ["Llama-2: Open Foundation and Fine-tuned Chat Models"](arxiv.org/abs/2307.09288) ## Intended Use **Intended Use Cases** Llama 2 is intended for commercial and research use in English. Tuned models are intended for assistant-like chat, whereas pretrained models can be adapted for a variety of natural language generation tasks. To get the expected features and performance for the chat versions, a specific formatting needs to be followed, including the `INST` and `<<SYS>>` tags, `BOS` and `EOS` tokens, and the whitespaces and breaklines in between (we recommend calling `strip()` on inputs to avoid double-spaces). See our reference code in github for details: [`chat_completion`](https://github.com/facebookresearch/llama/blob/main/llama/generation.py#L212). **Out-of-scope Uses** Use in any manner that violates applicable laws or regulations (including trade compliance laws).Use in languages other than English. Use in any other way that is prohibited by the Acceptable Use Policy and Licensing Agreement for Llama 2. ## Hardware and Software **Training Factors** We used custom training libraries, Meta's Research Super Cluster, and production clusters for pretraining. Fine-tuning, annotation, and evaluation were also performed on third-party cloud compute. **Carbon Footprint** Pretraining utilized a cumulative 3.3M GPU hours of computation on hardware of type A100-80GB (TDP of 350-400W). Estimated total emissions were 539 tCO2eq, 100% of which were offset by Meta’s sustainability program. ||Time (GPU hours)|Power Consumption (W)|Carbon Emitted(tCO₂eq)| |---|---|---|---| |Llama 2 7B|184320|400|31.22| |Llama 2 13B|368640|400|62.44| |Llama 2 70B|1720320|400|291.42| |Total|3311616||539.00| **CO₂ emissions during pretraining.** Time: total GPU time required for training each model. Power Consumption: peak power capacity per GPU device for the GPUs used adjusted for power usage efficiency. 100% of the emissions are directly offset by Meta's sustainability program, and because we are openly releasing these models, the pretraining costs do not need to be incurred by others. ## Training Data **Overview** Llama 2 was pretrained on 2 trillion tokens of data from publicly available sources. The fine-tuning data includes publicly available instruction datasets, as well as over one million new human-annotated examples. Neither the pretraining nor the fine-tuning datasets include Meta user data. **Data Freshness** The pretraining data has a cutoff of September 2022, but some tuning data is more recent, up to July 2023. ## Evaluation Results In this section, we report the results for the Llama 1 and Llama 2 models on standard academic benchmarks.For all the evaluations, we use our internal evaluations library. |Model|Size|Code|Commonsense Reasoning|World Knowledge|Reading Comprehension|Math|MMLU|BBH|AGI Eval| |---|---|---|---|---|---|---|---|---|---| |Llama 1|7B|14.1|60.8|46.2|58.5|6.95|35.1|30.3|23.9| |Llama 1|13B|18.9|66.1|52.6|62.3|10.9|46.9|37.0|33.9| |Llama 1|33B|26.0|70.0|58.4|67.6|21.4|57.8|39.8|41.7| |Llama 1|65B|30.7|70.7|60.5|68.6|30.8|63.4|43.5|47.6| |Llama 2|7B|16.8|63.9|48.9|61.3|14.6|45.3|32.6|29.3| |Llama 2|13B|24.5|66.9|55.4|65.8|28.7|54.8|39.4|39.1| |Llama 2|70B|**37.5**|**71.9**|**63.6**|**69.4**|**35.2**|**68.9**|**51.2**|**54.2**| **Overall performance on grouped academic benchmarks.** *Code:* We report the average pass@1 scores of our models on HumanEval and MBPP. *Commonsense Reasoning:* We report the average of PIQA, SIQA, HellaSwag, WinoGrande, ARC easy and challenge, OpenBookQA, and CommonsenseQA. We report 7-shot results for CommonSenseQA and 0-shot results for all other benchmarks. *World Knowledge:* We evaluate the 5-shot performance on NaturalQuestions and TriviaQA and report the average. *Reading Comprehension:* For reading comprehension, we report the 0-shot average on SQuAD, QuAC, and BoolQ. *MATH:* We report the average of the GSM8K (8 shot) and MATH (4 shot) benchmarks at top 1. |||TruthfulQA|Toxigen| |---|---|---|---| |Llama 1|7B|27.42|23.00| |Llama 1|13B|41.74|23.08| |Llama 1|33B|44.19|22.57| |Llama 1|65B|48.71|21.77| |Llama 2|7B|33.29|**21.25**| |Llama 2|13B|41.86|26.10| |Llama 2|70B|**50.18**|24.60| **Evaluation of pretrained LLMs on automatic safety benchmarks.** For TruthfulQA, we present the percentage of generations that are both truthful and informative (the higher the better). For ToxiGen, we present the percentage of toxic generations (the smaller the better). |||TruthfulQA|Toxigen| |---|---|---|---| |Llama-2-Chat|7B|57.04|**0.00**| |Llama-2-Chat|13B|62.18|**0.00**| |Llama-2-Chat|70B|**64.14**|0.01| **Evaluation of fine-tuned LLMs on different safety datasets.** Same metric definitions as above. ## Ethical Considerations and Limitations Llama 2 is a new technology that carries risks with use. Testing conducted to date has been in English, and has not covered, nor could it cover all scenarios. For these reasons, as with all LLMs, Llama 2’s potential outputs cannot be predicted in advance, and the model may in some instances produce inaccurate, biased or other objectionable responses to user prompts. Therefore, before deploying any applications of Llama 2, developers should perform safety testing and tuning tailored to their specific applications of the model. Please see the Responsible Use Guide available at [https://ai.meta.com/llama/responsible-use-guide/](https://ai.meta.com/llama/responsible-use-guide) ## Reporting Issues Please report any software “bug,” or other problems with the models through one of the following means: - Reporting issues with the model: [github.com/facebookresearch/llama](http://github.com/facebookresearch/llama) - Reporting problematic content generated by the model: [developers.facebook.com/llama_output_feedback](http://developers.facebook.com/llama_output_feedback) - Reporting bugs and security concerns: [facebook.com/whitehat/info](http://facebook.com/whitehat/info) ## Llama Model Index |Model|Llama2|Llama2-hf|Llama2-chat|Llama2-chat-hf| |---|---|---|---|---| |7B| [Link](https://huggingface.co/meta-llama/Llama-2-7b) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-7b-chat-hf)| |13B| [Link](https://huggingface.co/meta-llama/Llama-2-13b) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-13b-chat-hf)| |70B| [Link](https://huggingface.co/meta-llama/Llama-2-70b) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-hf) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-chat) | [Link](https://huggingface.co/meta-llama/Llama-2-70b-chat-hf)|

timm/inception_v3.tv_in1k

timm

timm

image-classification

--- tags: - image-classification - timm library_name: timm license: apache-2.0 datasets: - imagenet-1k --- # Model card for inception_v3.tv_in1k A Inception-v3 image classification model. Trained on ImageNet-1k, torchvision weights. ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 23.8 - GMACs: 5.7 - Activations (M): 9.0 - Image size: 299 x 299 - **Papers:** - Rethinking the Inception Architecture for Computer Vision: https://arxiv.org/abs/1512.00567 - **Original:** https://github.com/pytorch/vision - **Dataset:** ImageNet-1k ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('inception_v3.tv_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Feature Map Extraction ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'inception_v3.tv_in1k', pretrained=True, features_only=True, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 for o in output: # print shape of each feature map in output # e.g.: # torch.Size([1, 64, 147, 147]) # torch.Size([1, 192, 71, 71]) # torch.Size([1, 288, 35, 35]) # torch.Size([1, 768, 17, 17]) # torch.Size([1, 2048, 8, 8]) print(o.shape) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'inception_v3.tv_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled, a (1, 2048, 8, 8) shaped tensor output = model.forward_head(output, pre_logits=True) # output is a (1, num_features) shaped tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). ## Citation ```bibtex @article{DBLP:journals/corr/SzegedyVISW15, author = {Christian Szegedy and Vincent Vanhoucke and Sergey Ioffe and Jonathon Shlens and Zbigniew Wojna}, title = {Rethinking the Inception Architecture for Computer Vision}, journal = {CoRR}, volume = {abs/1512.00567}, year = {2015}, url = {http://arxiv.org/abs/1512.00567}, archivePrefix = {arXiv}, eprint = {1512.00567}, timestamp = {Mon, 13 Aug 2018 16:49:07 +0200}, biburl = {https://dblp.org/rec/journals/corr/SzegedyVISW15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

mradermacher/Fook-Yi-34B-v1a-GGUF

mradermacher

transformers

--- base_model: BeaverAI/Fook-Yi-34B-v1a language: - en library_name: transformers quantized_by: mradermacher --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: --> static quants of https://huggingface.co/BeaverAI/Fook-Yi-34B-v1a <!-- provided-files --> weighted/imatrix quants are available at https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-i1-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.Q2_K.gguf) | Q2_K | 12.9 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.IQ3_XS.gguf) | IQ3_XS | 14.3 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.Q3_K_S.gguf) | Q3_K_S | 15.1 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.IQ3_S.gguf) | IQ3_S | 15.1 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.IQ3_M.gguf) | IQ3_M | 15.7 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.Q3_K_M.gguf) | Q3_K_M | 16.8 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.Q3_K_L.gguf) | Q3_K_L | 18.2 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.IQ4_XS.gguf) | IQ4_XS | 18.7 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.Q4_K_S.gguf) | Q4_K_S | 19.7 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.Q4_K_M.gguf) | Q4_K_M | 20.8 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.Q5_K_S.gguf) | Q5_K_S | 23.8 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.Q5_K_M.gguf) | Q5_K_M | 24.4 | | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.Q6_K.gguf) | Q6_K | 28.3 | very good quality | | [GGUF](https://huggingface.co/mradermacher/Fook-Yi-34B-v1a-GGUF/resolve/main/Fook-Yi-34B-v1a.Q8_0.gguf) | Q8_0 | 36.6 | fast, best quality | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. <!-- end -->

tau-vision/sn6-finetune

tau-vision

transformers

text-generation

--- library_name: transformers tags: [] --- # Model Card for Model ID <!-- Provide a quick summary of what the model is/does. --> ## Model Details ### Model Description <!-- Provide a longer summary of what this model is. --> This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated. - **Developed by:** [More Information Needed] - **Funded by [optional]:** [More Information Needed] - **Shared by [optional]:** [More Information Needed] - **Model type:** [More Information Needed] - **Language(s) (NLP):** [More Information Needed] - **License:** [More Information Needed] - **Finetuned from model [optional]:** [More Information Needed] ### Model Sources [optional] <!-- Provide the basic links for the model. --> - **Repository:** [More Information Needed] - **Paper [optional]:** [More Information Needed] - **Demo [optional]:** [More Information Needed] ## Uses <!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. --> ### Direct Use <!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. --> [More Information Needed] ### Downstream Use [optional] <!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app --> [More Information Needed] ### Out-of-Scope Use <!-- This section addresses misuse, malicious use, and uses that the model will not work well for. --> [More Information Needed] ## Bias, Risks, and Limitations <!-- This section is meant to convey both technical and sociotechnical limitations. --> [More Information Needed] ### Recommendations <!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. --> Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations. ## How to Get Started with the Model Use the code below to get started with the model. [More Information Needed] ## Training Details ### Training Data <!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. --> [More Information Needed] ### Training Procedure <!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. --> #### Preprocessing [optional] [More Information Needed] #### Training Hyperparameters - **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision --> #### Speeds, Sizes, Times [optional] <!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. --> [More Information Needed] ## Evaluation <!-- This section describes the evaluation protocols and provides the results. --> ### Testing Data, Factors & Metrics #### Testing Data <!-- This should link to a Dataset Card if possible. --> [More Information Needed] #### Factors <!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. --> [More Information Needed] #### Metrics <!-- These are the evaluation metrics being used, ideally with a description of why. --> [More Information Needed] ### Results [More Information Needed] #### Summary ## Model Examination [optional] <!-- Relevant interpretability work for the model goes here --> [More Information Needed] ## Environmental Impact <!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly --> Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). - **Hardware Type:** [More Information Needed] - **Hours used:** [More Information Needed] - **Cloud Provider:** [More Information Needed] - **Compute Region:** [More Information Needed] - **Carbon Emitted:** [More Information Needed] ## Technical Specifications [optional] ### Model Architecture and Objective [More Information Needed] ### Compute Infrastructure [More Information Needed] #### Hardware [More Information Needed] #### Software [More Information Needed] ## Citation [optional] <!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. --> **BibTeX:** [More Information Needed] **APA:** [More Information Needed] ## Glossary [optional] <!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. --> [More Information Needed] ## More Information [optional] [More Information Needed] ## Model Card Authors [optional] [More Information Needed] ## Model Card Contact [More Information Needed]

tiiuae/falcon-7b

tiiuae

transformers

text-generation

--- datasets: - tiiuae/falcon-refinedweb language: - en inference: false license: apache-2.0 --- # 🚀 Falcon-7B **Falcon-7B is a 7B parameters causal decoder-only model built by [TII](https://www.tii.ae) and trained on 1,500B tokens of [RefinedWeb](https://huggingface.co/datasets/tiiuae/falcon-refinedweb) enhanced with curated corpora. It is made available under the Apache 2.0 license.** *Paper coming soon* 😊. 🤗 To get started with Falcon (inference, finetuning, quantization, etc.), we recommend reading [this great blogpost fron HF](https://huggingface.co/blog/falcon)! ## Why use Falcon-7B? * **It outperforms comparable open-source models** (e.g., [MPT-7B](https://huggingface.co/mosaicml/mpt-7b), [StableLM](https://github.com/Stability-AI/StableLM), [RedPajama](https://huggingface.co/togethercomputer/RedPajama-INCITE-Base-7B-v0.1) etc.), thanks to being trained on 1,500B tokens of [RefinedWeb](https://huggingface.co/datasets/tiiuae/falcon-refinedweb) enhanced with curated corpora. See the [OpenLLM Leaderboard](https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard). * **It features an architecture optimized for inference**, with FlashAttention ([Dao et al., 2022](https://arxiv.org/abs/2205.14135)) and multiquery ([Shazeer et al., 2019](https://arxiv.org/abs/1911.02150)). * **It is made available under a permissive Apache 2.0 license allowing for commercial use**, without any royalties or restrictions. ⚠️ **This is a raw, pretrained model, which should be further finetuned for most usecases.** If you are looking for a version better suited to taking generic instructions in a chat format, we recommend taking a look at [Falcon-7B-Instruct](https://huggingface.co/tiiuae/falcon-7b-instruct). 🔥 **Looking for an even more powerful model?** [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b) is Falcon-7B's big brother! ```python from transformers import AutoTokenizer, AutoModelForCausalLM import transformers import torch model = "tiiuae/falcon-7b" tokenizer = AutoTokenizer.from_pretrained(model) pipeline = transformers.pipeline( "text-generation", model=model, tokenizer=tokenizer, torch_dtype=torch.bfloat16, trust_remote_code=True, device_map="auto", ) sequences = pipeline( "Girafatron is obsessed with giraffes, the most glorious animal on the face of this Earth. Giraftron believes all other animals are irrelevant when compared to the glorious majesty of the giraffe.\nDaniel: Hello, Girafatron!\nGirafatron:", max_length=200, do_sample=True, top_k=10, num_return_sequences=1, eos_token_id=tokenizer.eos_token_id, ) for seq in sequences: print(f"Result: {seq['generated_text']}") ``` 💥 **Falcon LLMs require PyTorch 2.0 for use with `transformers`!** For fast inference with Falcon, check-out [Text Generation Inference](https://github.com/huggingface/text-generation-inference)! Read more in this [blogpost]((https://huggingface.co/blog/falcon). You will need **at least 16GB of memory** to swiftly run inference with Falcon-7B. # Model Card for Falcon-7B ## Model Details ### Model Description - **Developed by:** [https://www.tii.ae](https://www.tii.ae); - **Model type:** Causal decoder-only; - **Language(s) (NLP):** English, German, Spanish, French (and limited capabilities in Italian, Portuguese, Polish, Dutch, Romanian, Czech, Swedish); - **License:** Apache 2.0. ### Model Source - **Paper:** *coming soon*. ## Uses ### Direct Use Research on large language models; as a foundation for further specialization and finetuning for specific usecases (e.g., summarization, text generation, chatbot, etc.) ### Out-of-Scope Use Production use without adequate assessment of risks and mitigation; any use cases which may be considered irresponsible or harmful. ## Bias, Risks, and Limitations Falcon-7B is trained on English and French data only, and will not generalize appropriately to other languages. Furthermore, as it is trained on a large-scale corpora representative of the web, it will carry the stereotypes and biases commonly encountered online. ### Recommendations We recommend users of Falcon-7B to consider finetuning it for the specific set of tasks of interest, and for guardrails and appropriate precautions to be taken for any production use. ## How to Get Started with the Model ```python from transformers import AutoTokenizer, AutoModelForCausalLM import transformers import torch model = "tiiuae/falcon-7b" tokenizer = AutoTokenizer.from_pretrained(model) pipeline = transformers.pipeline( "text-generation", model=model, tokenizer=tokenizer, torch_dtype=torch.bfloat16, trust_remote_code=True, device_map="auto", ) sequences = pipeline( "Girafatron is obsessed with giraffes, the most glorious animal on the face of this Earth. Giraftron believes all other animals are irrelevant when compared to the glorious majesty of the giraffe.\nDaniel: Hello, Girafatron!\nGirafatron:", max_length=200, do_sample=True, top_k=10, num_return_sequences=1, eos_token_id=tokenizer.eos_token_id, ) for seq in sequences: print(f"Result: {seq['generated_text']}") ``` ## Training Details ### Training Data Falcon-7B was trained on 1,500B tokens of [RefinedWeb](https://huggingface.co/datasets/tiiuae/falcon-refinedweb), a high-quality filtered and deduplicated web dataset which we enhanced with curated corpora. Significant components from our curated copora were inspired by The Pile ([Gao et al., 2020](https://arxiv.org/abs/2101.00027)). | **Data source** | **Fraction** | **Tokens** | **Sources** | |--------------------|--------------|------------|-----------------------------------| | [RefinedWeb-English](https://huggingface.co/datasets/tiiuae/falcon-refinedweb) | 79% | 1,185B | massive web crawl | | Books | 7% | 110B | | | Conversations | 6% | 85B | Reddit, StackOverflow, HackerNews | | Code | 3% | 45B | | | RefinedWeb-French | 3% | 45B | massive web crawl | | Technical | 2% | 30B | arXiv, PubMed, USPTO, etc. | The data was tokenized with the Falcon-[7B](https://huggingface.co/tiiuae/falcon-7b)/[40B](https://huggingface.co/tiiuae/falcon-40b) tokenizer. ### Training Procedure Falcon-7B was trained on 384 A100 40GB GPUs, using a 2D parallelism strategy (PP=2, DP=192) combined with ZeRO. #### Training Hyperparameters | **Hyperparameter** | **Value** | **Comment** | |--------------------|------------|-------------------------------------------| | Precision | `bfloat16` | | | Optimizer | AdamW | | | Learning rate | 6e-4 | 4B tokens warm-up, cosine decay to 1.2e-5 | | Weight decay | 1e-1 | | | Z-loss | 1e-4 | | | Batch size | 2304 | 30B tokens ramp-up | #### Speeds, Sizes, Times Training happened in early March 2023 and took about two weeks. ## Evaluation *Paper coming soon*. See the [OpenLLM Leaderboard](https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard) for early results. ## Technical Specifications ### Model Architecture and Objective Falcon-7B is a causal decoder-only model trained on a causal language modeling task (i.e., predict the next token). The architecture is broadly adapted from the GPT-3 paper ([Brown et al., 2020](https://arxiv.org/abs/2005.14165)), with the following differences: * **Positionnal embeddings:** rotary ([Su et al., 2021](https://arxiv.org/abs/2104.09864)); * **Attention:** multiquery ([Shazeer et al., 2019](https://arxiv.org/abs/1911.02150)) and FlashAttention ([Dao et al., 2022](https://arxiv.org/abs/2205.14135)); * **Decoder-block:** parallel attention/MLP with a single layer norm. | **Hyperparameter** | **Value** | **Comment** | |--------------------|-----------|----------------------------------------| | Layers | 32 | | | `d_model` | 4544 | Increased to compensate for multiquery | | `head_dim` | 64 | Reduced to optimise for FlashAttention | | Vocabulary | 65024 | | | Sequence length | 2048 | | ### Compute Infrastructure #### Hardware Falcon-7B was trained on AWS SageMaker, on 384 A100 40GB GPUs in P4d instances. #### Software Falcon-7B was trained a custom distributed training codebase, Gigatron. It uses a 3D parallelism approach combined with ZeRO and high-performance Triton kernels (FlashAttention, etc.) ## Citation *Paper coming soon* 😊. In the meanwhile, you can use the following information to cite: ``` @article{falcon40b, title={{Falcon-40B}: an open large language model with state-of-the-art performance}, author={Almazrouei, Ebtesam and Alobeidli, Hamza and Alshamsi, Abdulaziz and Cappelli, Alessandro and Cojocaru, Ruxandra and Debbah, Merouane and Goffinet, Etienne and Heslow, Daniel and Launay, Julien and Malartic, Quentin and Noune, Badreddine and Pannier, Baptiste and Penedo, Guilherme}, year={2023} } ``` To learn more about the pretraining dataset, see the 📓 [RefinedWeb paper](https://arxiv.org/abs/2306.01116). ``` @article{refinedweb, title={The {R}efined{W}eb dataset for {F}alcon {LLM}: outperforming curated corpora with web data, and web data only}, author={Guilherme Penedo and Quentin Malartic and Daniel Hesslow and Ruxandra Cojocaru and Alessandro Cappelli and Hamza Alobeidli and Baptiste Pannier and Ebtesam Almazrouei and Julien Launay}, journal={arXiv preprint arXiv:2306.01116}, eprint={2306.01116}, eprinttype = {arXiv}, url={https://arxiv.org/abs/2306.01116}, year={2023} } ``` ## License Falcon-7B is made available under the Apache 2.0 license. ## Contact falconllm@tii.ae

ahotrod/electra_large_discriminator_squad2_512

ahotrod

transformers

question-answering

## ELECTRA_large_discriminator language model fine-tuned on SQuAD2.0 ### with the following results: ``` "exact": 87.09677419354838, "f1": 89.98343832723452, "total": 11873, "HasAns_exact": 84.66599190283401, "HasAns_f1": 90.44759839056285, "HasAns_total": 5928, "NoAns_exact": 89.52060555088309, "NoAns_f1": 89.52060555088309, "NoAns_total": 5945, "best_exact": 87.09677419354838, "best_exact_thresh": 0.0, "best_f1": 89.98343832723432, "best_f1_thresh": 0.0 ``` ### from script: ``` python ${EXAMPLES}/run_squad.py \ --model_type electra \ --model_name_or_path google/electra-large-discriminator \ --do_train \ --do_eval \ --train_file ${SQUAD}/train-v2.0.json \ --predict_file ${SQUAD}/dev-v2.0.json \ --version_2_with_negative \ --do_lower_case \ --num_train_epochs 3 \ --warmup_steps 306 \ --weight_decay 0.01 \ --learning_rate 3e-5 \ --max_grad_norm 0.5 \ --adam_epsilon 1e-6 \ --max_seq_length 512 \ --doc_stride 128 \ --per_gpu_train_batch_size 8 \ --gradient_accumulation_steps 16 \ --per_gpu_eval_batch_size 128 \ --fp16 \ --fp16_opt_level O1 \ --threads 12 \ --logging_steps 50 \ --save_steps 1000 \ --overwrite_output_dir \ --output_dir ${MODEL_PATH} ``` ### using the following system & software: ``` Transformers: 2.11.0 PyTorch: 1.5.0 TensorFlow: 2.2.0 Python: 3.8.1 OS/Platform: Linux-5.3.0-59-generic-x86_64-with-glibc2.10 CPU/GPU: Intel i9-9900K / NVIDIA Titan RTX 24GB ```

RichardErkhov/migtissera_-_Tess-72B-v1.5b-gguf

RichardErkhov

Entry not found

JackFram/llama-160m

JackFram

transformers

text-generation

--- license: apache-2.0 language: - en datasets: - wikipedia pipeline_tag: text-generation --- ## Model description This is a LLaMA-like model with only 160M parameters trained on Wikipedia and part of the C4-en and C4-realnewslike datasets. No evaluation has been conducted yet, so use it with care. The model is mainly developed as a base Small Speculative Model in the [SpecInfer](https://arxiv.org/abs/2305.09781) paper. ## Citation To cite the model, please use ```bibtex @misc{miao2023specinfer, title={SpecInfer: Accelerating Generative LLM Serving with Speculative Inference and Token Tree Verification}, author={Xupeng Miao and Gabriele Oliaro and Zhihao Zhang and Xinhao Cheng and Zeyu Wang and Rae Ying Yee Wong and Zhuoming Chen and Daiyaan Arfeen and Reyna Abhyankar and Zhihao Jia}, year={2023}, eprint={2305.09781}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

facebook/m2m100_1.2B

facebook

transformers

text2text-generation

--- language: - multilingual - af - am - ar - ast - az - ba - be - bg - bn - br - bs - ca - ceb - cs - cy - da - de - el - en - es - et - fa - ff - fi - fr - fy - ga - gd - gl - gu - ha - he - hi - hr - ht - hu - hy - id - ig - ilo - is - it - ja - jv - ka - kk - km - kn - ko - lb - lg - ln - lo - lt - lv - mg - mk - ml - mn - mr - ms - my - ne - nl - no - ns - oc - or - pa - pl - ps - pt - ro - ru - sd - si - sk - sl - so - sq - sr - ss - su - sv - sw - ta - th - tl - tn - tr - uk - ur - uz - vi - wo - xh - yi - yo - zh - zu license: mit --- # M2M100 1.2B M2M100 is a multilingual encoder-decoder (seq-to-seq) model trained for Many-to-Many multilingual translation. It was introduced in this [paper](https://arxiv.org/abs/2010.11125) and first released in [this](https://github.com/pytorch/fairseq/tree/master/examples/m2m_100) repository. The model that can directly translate between the 9,900 directions of 100 languages. To translate into a target language, the target language id is forced as the first generated token. To force the target language id as the first generated token, pass the `forced_bos_token_id` parameter to the `generate` method. *Note: `M2M100Tokenizer` depends on `sentencepiece`, so make sure to install it before running the example.* To install `sentencepiece` run `pip install sentencepiece` ```python from transformers import M2M100ForConditionalGeneration, M2M100Tokenizer hi_text = "जीवन एक चॉकलेट बॉक्स की तरह है।" chinese_text = "生活就像一盒巧克力。" model = M2M100ForConditionalGeneration.from_pretrained("facebook/m2m100_1.2B") tokenizer = M2M100Tokenizer.from_pretrained("facebook/m2m100_1.2B") # translate Hindi to French tokenizer.src_lang = "hi" encoded_hi = tokenizer(hi_text, return_tensors="pt") generated_tokens = model.generate(**encoded_hi, forced_bos_token_id=tokenizer.get_lang_id("fr")) tokenizer.batch_decode(generated_tokens, skip_special_tokens=True) # => "La vie est comme une boîte de chocolat." # translate Chinese to English tokenizer.src_lang = "zh" encoded_zh = tokenizer(chinese_text, return_tensors="pt") generated_tokens = model.generate(**encoded_zh, forced_bos_token_id=tokenizer.get_lang_id("en")) tokenizer.batch_decode(generated_tokens, skip_special_tokens=True) # => "Life is like a box of chocolate." ``` See the [model hub](https://huggingface.co/models?filter=m2m_100) to look for more fine-tuned versions. ## Languages covered Afrikaans (af), Amharic (am), Arabic (ar), Asturian (ast), Azerbaijani (az), Bashkir (ba), Belarusian (be), Bulgarian (bg), Bengali (bn), Breton (br), Bosnian (bs), Catalan; Valencian (ca), Cebuano (ceb), Czech (cs), Welsh (cy), Danish (da), German (de), Greeek (el), English (en), Spanish (es), Estonian (et), Persian (fa), Fulah (ff), Finnish (fi), French (fr), Western Frisian (fy), Irish (ga), Gaelic; Scottish Gaelic (gd), Galician (gl), Gujarati (gu), Hausa (ha), Hebrew (he), Hindi (hi), Croatian (hr), Haitian; Haitian Creole (ht), Hungarian (hu), Armenian (hy), Indonesian (id), Igbo (ig), Iloko (ilo), Icelandic (is), Italian (it), Japanese (ja), Javanese (jv), Georgian (ka), Kazakh (kk), Central Khmer (km), Kannada (kn), Korean (ko), Luxembourgish; Letzeburgesch (lb), Ganda (lg), Lingala (ln), Lao (lo), Lithuanian (lt), Latvian (lv), Malagasy (mg), Macedonian (mk), Malayalam (ml), Mongolian (mn), Marathi (mr), Malay (ms), Burmese (my), Nepali (ne), Dutch; Flemish (nl), Norwegian (no), Northern Sotho (ns), Occitan (post 1500) (oc), Oriya (or), Panjabi; Punjabi (pa), Polish (pl), Pushto; Pashto (ps), Portuguese (pt), Romanian; Moldavian; Moldovan (ro), Russian (ru), Sindhi (sd), Sinhala; Sinhalese (si), Slovak (sk), Slovenian (sl), Somali (so), Albanian (sq), Serbian (sr), Swati (ss), Sundanese (su), Swedish (sv), Swahili (sw), Tamil (ta), Thai (th), Tagalog (tl), Tswana (tn), Turkish (tr), Ukrainian (uk), Urdu (ur), Uzbek (uz), Vietnamese (vi), Wolof (wo), Xhosa (xh), Yiddish (yi), Yoruba (yo), Chinese (zh), Zulu (zu) ## BibTeX entry and citation info ``` @misc{fan2020englishcentric, title={Beyond English-Centric Multilingual Machine Translation}, author={Angela Fan and Shruti Bhosale and Holger Schwenk and Zhiyi Ma and Ahmed El-Kishky and Siddharth Goyal and Mandeep Baines and Onur Celebi and Guillaume Wenzek and Vishrav Chaudhary and Naman Goyal and Tom Birch and Vitaliy Liptchinsky and Sergey Edunov and Edouard Grave and Michael Auli and Armand Joulin}, year={2020}, eprint={2010.11125}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

timm/vit_base_patch16_clip_224.openai

timm

timm

image-feature-extraction

--- license: apache-2.0 library_name: timm tags: - image-feature-extraction - timm - vision --- # CLIP (OpenAI model for timm) ## Model Details The CLIP model was developed by researchers at OpenAI to learn about what contributes to robustness in computer vision tasks. The model was also developed to test the ability of models to generalize to arbitrary image classification tasks in a zero-shot manner. It was not developed for general model deployment - to deploy models like CLIP, researchers will first need to carefully study their capabilities in relation to the specific context they’re being deployed within. This instance of the CLIP model is intended for loading in * `timm` (https://github.com/rwightman/pytorch-image-models) and * `OpenCLIP` (https://github.com/mlfoundations/open_clip) libraries. Please see https://huggingface.co/openai/clip-vit-base-patch16 for use in Hugging Face Transformers. ### Model Date January 2021 ### Model Type The model uses a ViT-B/16 Transformer architecture as an image encoder and uses a masked self-attention Transformer as a text encoder. These encoders are trained to maximize the similarity of (image, text) pairs via a contrastive loss. The original implementation had two variants: one using a ResNet image encoder and the other using a Vision Transformer. This repository has the variant with the Vision Transformer. ### Documents - [Blog Post](https://openai.com/blog/clip/) - [CLIP Paper](https://arxiv.org/abs/2103.00020) ## Model Use ### Intended Use The model is intended as a research output for research communities. We hope that this model will enable researchers to better understand and explore zero-shot, arbitrary image classification. We also hope it can be used for interdisciplinary studies of the potential impact of such models - the CLIP paper includes a discussion of potential downstream impacts to provide an example for this sort of analysis. #### Primary intended uses The primary intended users of these models are AI researchers. We primarily imagine the model will be used by researchers to better understand robustness, generalization, and other capabilities, biases, and constraints of computer vision models. ### Out-of-Scope Use Cases **Any** deployed use case of the model - whether commercial or not - is currently out of scope. Non-deployed use cases such as image search in a constrained environment, are also not recommended unless there is thorough in-domain testing of the model with a specific, fixed class taxonomy. This is because our safety assessment demonstrated a high need for task specific testing especially given the variability of CLIP’s performance with different class taxonomies. This makes untested and unconstrained deployment of the model in any use case currently potentially harmful. Certain use cases which would fall under the domain of surveillance and facial recognition are always out-of-scope regardless of performance of the model. This is because the use of artificial intelligence for tasks such as these can be premature currently given the lack of testing norms and checks to ensure its fair use. Since the model has not been purposefully trained in or evaluated on any languages other than English, its use should be limited to English language use cases. ## Data The model was trained on publicly available image-caption data. This was done through a combination of crawling a handful of websites and using commonly-used pre-existing image datasets such as [YFCC100M](http://projects.dfki.uni-kl.de/yfcc100m/). A large portion of the data comes from our crawling of the internet. This means that the data is more representative of people and societies most connected to the internet which tend to skew towards more developed nations, and younger, male users. ### Data Mission Statement Our goal with building this dataset was to test out robustness and generalizability in computer vision tasks. As a result, the focus was on gathering large quantities of data from different publicly-available internet data sources. The data was gathered in a mostly non-interventionist manner. However, we only crawled websites that had policies against excessively violent and adult images and allowed us to filter out such content. We do not intend for this dataset to be used as the basis for any commercial or deployed model and will not be releasing the dataset. ## Limitations CLIP and our analysis of it have a number of limitations. CLIP currently struggles with respect to certain tasks such as fine grained classification and counting objects. CLIP also poses issues with regards to fairness and bias which we discuss in the paper and briefly in the next section. Additionally, our approach to testing CLIP also has an important limitation- in many cases we have used linear probes to evaluate the performance of CLIP and there is evidence suggesting that linear probes can underestimate model performance. ### Bias and Fairness We find that the performance of CLIP - and the specific biases it exhibits - can depend significantly on class design and the choices one makes for categories to include and exclude. We tested the risk of certain kinds of denigration with CLIP by classifying images of people from [Fairface](https://arxiv.org/abs/1908.04913) into crime-related and non-human animal categories. We found significant disparities with respect to race and gender. Additionally, we found that these disparities could shift based on how the classes were constructed. (Details captured in the Broader Impacts Section in the paper). We also tested the performance of CLIP on gender, race and age classification using the Fairface dataset (We default to using race categories as they are constructed in the Fairface dataset.) in order to assess quality of performance across different demographics. We found accuracy >96% across all races for gender classification with ‘Middle Eastern’ having the highest accuracy (98.4%) and ‘White’ having the lowest (96.5%). Additionally, CLIP averaged ~93% for racial classification and ~63% for age classification. Our use of evaluations to test for gender, race and age classification as well as denigration harms is simply to evaluate performance of the model across people and surface potential risks and not to demonstrate an endorsement/enthusiasm for such tasks.

mradermacher/Yi-34B-200K-i1-GGUF

mradermacher

transformers

--- base_model: 01-ai/Yi-34B-200K language: - en library_name: transformers license: apache-2.0 quantized_by: mradermacher --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: nicoboss --> weighted/imatrix quants of https://huggingface.co/01-ai/Yi-34B-200K <!-- provided-files --> static quants are available at https://huggingface.co/mradermacher/Yi-34B-200K-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-IQ1_S.gguf) | i1-IQ1_S | 7.6 | for the desperate | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-IQ1_M.gguf) | i1-IQ1_M | 8.3 | mostly desperate | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-IQ2_XXS.gguf) | i1-IQ2_XXS | 9.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-IQ2_XS.gguf) | i1-IQ2_XS | 10.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-IQ2_S.gguf) | i1-IQ2_S | 11.0 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-IQ2_M.gguf) | i1-IQ2_M | 11.9 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-Q2_K.gguf) | i1-Q2_K | 12.9 | IQ3_XXS probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-IQ3_XXS.gguf) | i1-IQ3_XXS | 13.4 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-IQ3_XS.gguf) | i1-IQ3_XS | 14.3 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-Q3_K_S.gguf) | i1-Q3_K_S | 15.1 | IQ3_XS probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-IQ3_S.gguf) | i1-IQ3_S | 15.1 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-IQ3_M.gguf) | i1-IQ3_M | 15.7 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-Q3_K_M.gguf) | i1-Q3_K_M | 16.8 | IQ3_S probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-Q3_K_L.gguf) | i1-Q3_K_L | 18.2 | IQ3_M probably better | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-IQ4_XS.gguf) | i1-IQ4_XS | 18.6 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-Q4_0.gguf) | i1-Q4_0 | 19.6 | fast, low quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-Q4_K_S.gguf) | i1-Q4_K_S | 19.7 | optimal size/speed/quality | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-Q4_K_M.gguf) | i1-Q4_K_M | 20.8 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-Q5_K_S.gguf) | i1-Q5_K_S | 23.8 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-Q5_K_M.gguf) | i1-Q5_K_M | 24.4 | | | [GGUF](https://huggingface.co/mradermacher/Yi-34B-200K-i1-GGUF/resolve/main/Yi-34B-200K.i1-Q6_K.gguf) | i1-Q6_K | 28.3 | practically like static Q6_K | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. Additional thanks to [@nicoboss](https://huggingface.co/nicoboss) for giving me access to his hardware for calculating the imatrix for these quants. <!-- end -->

parler-tts/parler_tts_mini_v0.1

parler-tts

transformers

text-to-speech

--- library_name: transformers tags: - text-to-speech - annotation license: apache-2.0 language: - en pipeline_tag: text-to-speech inference: false datasets: - parler-tts/mls_eng_10k - blabble-io/libritts_r - parler-tts/libritts_r_tags_tagged_10k_generated - parler-tts/mls-eng-10k-tags_tagged_10k_generated --- <img src="https://huggingface.co/datasets/parler-tts/images/resolve/main/thumbnail.png" alt="Parler Logo" width="800" style="margin-left:'auto' margin-right:'auto' display:'block'"/> # Parler-TTS Mini v0.1 <a target="_blank" href="https://huggingface.co/spaces/parler-tts/parler_tts_mini"> <img src="https://huggingface.co/datasets/huggingface/badges/raw/main/open-in-hf-spaces-sm.svg" alt="Open in HuggingFace"/> </a> * **Fine-tuning guide on Colab:** <a target="_blank" href="https://colab.research.google.com/github/ylacombe/scripts_and_notebooks/blob/main/Finetuning_Parler_TTS_on_a_single_speaker_dataset.ipynb"> <img src="https://colab.research.google.com/assets/colab-badge.svg" alt="Open In Colab"/> </a> **Parler-TTS Mini v0.1** is a lightweight text-to-speech (TTS) model, trained on 10.5K hours of audio data, that can generate high-quality, natural sounding speech with features that can be controlled using a simple text prompt (e.g. gender, background noise, speaking rate, pitch and reverberation). It is the first release model from the [Parler-TTS](https://github.com/huggingface/parler-tts) project, which aims to provide the community with TTS training resources and dataset pre-processing code. ## Usage Using Parler-TTS is as simple as "bonjour". Simply install the library once: ```sh pip install git+https://github.com/huggingface/parler-tts.git ``` You can then use the model with the following inference snippet: ```py import torch from parler_tts import ParlerTTSForConditionalGeneration from transformers import AutoTokenizer import soundfile as sf device = "cuda:0" if torch.cuda.is_available() else "cpu" model = ParlerTTSForConditionalGeneration.from_pretrained("parler-tts/parler_tts_mini_v0.1").to(device) tokenizer = AutoTokenizer.from_pretrained("parler-tts/parler_tts_mini_v0.1") prompt = "Hey, how are you doing today?" description = "A female speaker with a slightly low-pitched voice delivers her words quite expressively, in a very confined sounding environment with clear audio quality. She speaks very fast." input_ids = tokenizer(description, return_tensors="pt").input_ids.to(device) prompt_input_ids = tokenizer(prompt, return_tensors="pt").input_ids.to(device) generation = model.generate(input_ids=input_ids, prompt_input_ids=prompt_input_ids) audio_arr = generation.cpu().numpy().squeeze() sf.write("parler_tts_out.wav", audio_arr, model.config.sampling_rate) ``` **Tips**: * Include the term "very clear audio" to generate the highest quality audio, and "very noisy audio" for high levels of background noise * Punctuation can be used to control the prosody of the generations, e.g. use commas to add small breaks in speech * The remaining speech features (gender, speaking rate, pitch and reverberation) can be controlled directly through the prompt ## Motivation Parler-TTS is a reproduction of work from the paper [Natural language guidance of high-fidelity text-to-speech with synthetic annotations](https://www.text-description-to-speech.com) by Dan Lyth and Simon King, from Stability AI and Edinburgh University respectively. Contrarily to other TTS models, Parler-TTS is a **fully open-source** release. All of the datasets, pre-processing, training code and weights are released publicly under permissive license, enabling the community to build on our work and develop their own powerful TTS models. Parler-TTS was released alongside: * [The Parler-TTS repository](https://github.com/huggingface/parler-tts) - you can train and fine-tuned your own version of the model. * [The Data-Speech repository](https://github.com/huggingface/dataspeech) - a suite of utility scripts designed to annotate speech datasets. * [The Parler-TTS organization](https://huggingface.co/parler-tts) - where you can find the annotated datasets as well as the future checkpoints. ## Citation If you found this repository useful, please consider citing this work and also the original Stability AI paper: ``` @misc{lacombe-etal-2024-parler-tts, author = {Yoach Lacombe and Vaibhav Srivastav and Sanchit Gandhi}, title = {Parler-TTS}, year = {2024}, publisher = {GitHub}, journal = {GitHub repository}, howpublished = {\url{https://github.com/huggingface/parler-tts}} } ``` ``` @misc{lyth2024natural, title={Natural language guidance of high-fidelity text-to-speech with synthetic annotations}, author={Dan Lyth and Simon King}, year={2024}, eprint={2402.01912}, archivePrefix={arXiv}, primaryClass={cs.SD} } ``` ## License This model is permissively licensed under the Apache 2.0 license.

mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF

mradermacher

transformers

--- base_model: NousResearch/Hermes-2-Theta-Llama-3-70B language: - en library_name: transformers license: llama3 quantized_by: mradermacher tags: - distillation - synthetic data - function calling - structured outputs - json mode --- ## About <!-- ### quantize_version: 2 --> <!-- ### output_tensor_quantised: 1 --> <!-- ### convert_type: hf --> <!-- ### vocab_type: --> <!-- ### tags: nicoboss --> weighted/imatrix quants of https://huggingface.co/NousResearch/Hermes-2-Theta-Llama-3-70B <!-- provided-files --> static quants are available at https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-GGUF ## Usage If you are unsure how to use GGUF files, refer to one of [TheBloke's READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for more details, including on how to concatenate multi-part files. ## Provided Quants (sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants) | Link | Type | Size/GB | Notes | |:-----|:-----|--------:|:------| | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-IQ1_S.gguf) | i1-IQ1_S | 15.4 | for the desperate | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-IQ1_M.gguf) | i1-IQ1_M | 16.9 | mostly desperate | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-IQ2_XXS.gguf) | i1-IQ2_XXS | 19.2 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-IQ2_XS.gguf) | i1-IQ2_XS | 21.2 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-IQ2_S.gguf) | i1-IQ2_S | 22.3 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-IQ2_M.gguf) | i1-IQ2_M | 24.2 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-Q2_K.gguf) | i1-Q2_K | 26.5 | IQ3_XXS probably better | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-IQ3_XXS.gguf) | i1-IQ3_XXS | 27.6 | lower quality | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-IQ3_XS.gguf) | i1-IQ3_XS | 29.4 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-IQ3_S.gguf) | i1-IQ3_S | 31.0 | beats Q3_K* | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-Q3_K_S.gguf) | i1-Q3_K_S | 31.0 | IQ3_XS probably better | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-IQ3_M.gguf) | i1-IQ3_M | 32.0 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-Q3_K_M.gguf) | i1-Q3_K_M | 34.4 | IQ3_S probably better | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-Q3_K_L.gguf) | i1-Q3_K_L | 37.2 | IQ3_M probably better | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-IQ4_XS.gguf) | i1-IQ4_XS | 38.0 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-Q4_0.gguf) | i1-Q4_0 | 40.2 | fast, low quality | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-Q4_K_S.gguf) | i1-Q4_K_S | 40.4 | optimal size/speed/quality | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-Q4_K_M.gguf) | i1-Q4_K_M | 42.6 | fast, recommended | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-Q5_K_S.gguf) | i1-Q5_K_S | 48.8 | | | [GGUF](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-Q5_K_M.gguf) | i1-Q5_K_M | 50.0 | | | [PART 1](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-Q6_K.gguf.part1of2) [PART 2](https://huggingface.co/mradermacher/Hermes-2-Theta-Llama-3-70B-i1-GGUF/resolve/main/Hermes-2-Theta-Llama-3-70B.i1-Q6_K.gguf.part2of2) | i1-Q6_K | 58.0 | practically like static Q6_K | Here is a handy graph by ikawrakow comparing some lower-quality quant types (lower is better):  And here are Artefact2's thoughts on the matter: https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9 ## FAQ / Model Request See https://huggingface.co/mradermacher/model_requests for some answers to questions you might have and/or if you want some other model quantized. ## Thanks I thank my company, [nethype GmbH](https://www.nethype.de/), for letting me use its servers and providing upgrades to my workstation to enable this work in my free time. Additional thanks to [@nicoboss](https://huggingface.co/nicoboss) for giving me access to his hardware for calculating the imatrix for these quants. <!-- end -->

hyunwoongko/kobart

hyunwoongko

transformers

text2text-generation

--- language: ko tags: - bart license: mit --- ## KoBART-base-v2 With the addition of chatting data, the model is trained to handle the semantics of sequences longer than KoBART. ```python from transformers import PreTrainedTokenizerFast, BartModel tokenizer = PreTrainedTokenizerFast.from_pretrained('hyunwoongko/kobart') model = BartModel.from_pretrained('hyunwoongko/kobart') ``` ### Performance NSMC - acc. : 0.901 ### hyunwoongko/kobart - Added bos/eos post processor - Removed token_type_ids

stablediffusionapi/duchaiten-real3d-nsfw-xl

stablediffusionapi

diffusers

text-to-image

--- license: creativeml-openrail-m tags: - modelslab.com - stable-diffusion-api - text-to-image - ultra-realistic - not-for-all-audiences pinned: true --- # DucHaiten-Real3D-NSFW-XL v1.0 API Inference  ## Get API Key Get API key from [ModelsLab API](http://modelslab.com), No Payment needed. Replace Key in below code, change **model_id** to "duchaiten-real3d-nsfw-xl" Coding in PHP/Node/Java etc? Have a look at docs for more code examples: [View docs](https://modelslab.com/docs) Try model for free: [Generate Images](https://modelslab.com/models/duchaiten-real3d-nsfw-xl) Model link: [View model](https://modelslab.com/models/duchaiten-real3d-nsfw-xl) View all models: [View Models](https://modelslab.com/models) import requests import json url = "https://modelslab.com/api/v6/images/text2img" payload = json.dumps({ "key": "your_api_key", "model_id": "duchaiten-real3d-nsfw-xl", "prompt": "ultra realistic close up portrait ((beautiful pale cyberpunk female with heavy black eyeliner)), blue eyes, shaved side haircut, hyper detail, cinematic lighting, magic neon, dark red city, Canon EOS R3, nikon, f/1.4, ISO 200, 1/160s, 8K, RAW, unedited, symmetrical balance, in-frame, 8K", "negative_prompt": "painting, extra fingers, mutated hands, poorly drawn hands, poorly drawn face, deformed, ugly, blurry, bad anatomy, bad proportions, extra limbs, cloned face, skinny, glitchy, double torso, extra arms, extra hands, mangled fingers, missing lips, ugly face, distorted face, extra legs, anime", "width": "512", "height": "512", "samples": "1", "num_inference_steps": "30", "safety_checker": "no", "enhance_prompt": "yes", "seed": None, "guidance_scale": 7.5, "multi_lingual": "no", "panorama": "no", "self_attention": "no", "upscale": "no", "embeddings": "embeddings_model_id", "lora": "lora_model_id", "webhook": None, "track_id": None }) headers = { 'Content-Type': 'application/json' } response = requests.request("POST", url, headers=headers, data=payload) print(response.text) > Use this coupon code to get 25% off **DMGG0RBN**

uclanlp/plbart-base

uclanlp

transformers

text2text-generation

Entry not found

casperhansen/llama-3-70b-instruct-awq

casperhansen

transformers

text-generation

Entry not found

Audiogen/agc-discrete

Audiogen

transformers

--- library_name: transformers tags: [] --- # Model Card for Model ID <!-- Provide a quick summary of what the model is/does. --> ## Model Details ### Model Description <!-- Provide a longer summary of what this model is. --> This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated. - **Developed by:** [More Information Needed] - **Funded by [optional]:** [More Information Needed] - **Shared by [optional]:** [More Information Needed] - **Model type:** [More Information Needed] - **Language(s) (NLP):** [More Information Needed] - **License:** [More Information Needed] - **Finetuned from model [optional]:** [More Information Needed] ### Model Sources [optional] <!-- Provide the basic links for the model. --> - **Repository:** [More Information Needed] - **Paper [optional]:** [More Information Needed] - **Demo [optional]:** [More Information Needed] ## Uses <!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. --> ### Direct Use <!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. --> [More Information Needed] ### Downstream Use [optional] <!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app --> [More Information Needed] ### Out-of-Scope Use <!-- This section addresses misuse, malicious use, and uses that the model will not work well for. --> [More Information Needed] ## Bias, Risks, and Limitations <!-- This section is meant to convey both technical and sociotechnical limitations. --> [More Information Needed] ### Recommendations <!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. --> Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations. ## How to Get Started with the Model Use the code below to get started with the model. [More Information Needed] ## Training Details ### Training Data <!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. --> [More Information Needed] ### Training Procedure <!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. --> #### Preprocessing [optional] [More Information Needed] #### Training Hyperparameters - **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision --> #### Speeds, Sizes, Times [optional] <!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. --> [More Information Needed] ## Evaluation <!-- This section describes the evaluation protocols and provides the results. --> ### Testing Data, Factors & Metrics #### Testing Data <!-- This should link to a Dataset Card if possible. --> [More Information Needed] #### Factors <!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. --> [More Information Needed] #### Metrics <!-- These are the evaluation metrics being used, ideally with a description of why. --> [More Information Needed] ### Results [More Information Needed] #### Summary ## Model Examination [optional] <!-- Relevant interpretability work for the model goes here --> [More Information Needed] ## Environmental Impact <!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly --> Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). - **Hardware Type:** [More Information Needed] - **Hours used:** [More Information Needed] - **Cloud Provider:** [More Information Needed] - **Compute Region:** [More Information Needed] - **Carbon Emitted:** [More Information Needed] ## Technical Specifications [optional] ### Model Architecture and Objective [More Information Needed] ### Compute Infrastructure [More Information Needed] #### Hardware [More Information Needed] #### Software [More Information Needed] ## Citation [optional] <!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. --> **BibTeX:** [More Information Needed] **APA:** [More Information Needed] ## Glossary [optional] <!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. --> [More Information Needed] ## More Information [optional] [More Information Needed] ## Model Card Authors [optional] [More Information Needed] ## Model Card Contact [More Information Needed]

MCG-NJU/videomae-base-finetuned-kinetics

MCG-NJU

transformers

video-classification

--- license: "cc-by-nc-4.0" tags: - vision - video-classification --- # VideoMAE (base-sized model, fine-tuned on Kinetics-400) VideoMAE model pre-trained for 1600 epochs in a self-supervised way and fine-tuned in a supervised way on Kinetics-400. It was introduced in the paper [VideoMAE: Masked Autoencoders are Data-Efficient Learners for Self-Supervised Video Pre-Training](https://arxiv.org/abs/2203.12602) by Tong et al. and first released in [this repository](https://github.com/MCG-NJU/VideoMAE). Disclaimer: The team releasing VideoMAE did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description VideoMAE is an extension of [Masked Autoencoders (MAE)](https://arxiv.org/abs/2111.06377) to video. The architecture of the model is very similar to that of a standard Vision Transformer (ViT), with a decoder on top for predicting pixel values for masked patches. Videos are presented to the model as a sequence of fixed-size patches (resolution 16x16), which are linearly embedded. One also adds a [CLS] token to the beginning of a sequence to use it for classification tasks. One also adds fixed sinus/cosinus position embeddings before feeding the sequence to the layers of the Transformer encoder. By pre-training the model, it learns an inner representation of videos that can then be used to extract features useful for downstream tasks: if you have a dataset of labeled videos for instance, you can train a standard classifier by placing a linear layer on top of the pre-trained encoder. One typically places a linear layer on top of the [CLS] token, as the last hidden state of this token can be seen as a representation of an entire video. ## Intended uses & limitations You can use the raw model for video classification into one of the 400 possible Kinetics-400 labels. ### How to use Here is how to use this model to classify a video: ```python from transformers import VideoMAEImageProcessor, VideoMAEForVideoClassification import numpy as np import torch video = list(np.random.randn(16, 3, 224, 224)) processor = VideoMAEImageProcessor.from_pretrained("MCG-NJU/videomae-base-finetuned-kinetics") model = VideoMAEForVideoClassification.from_pretrained("MCG-NJU/videomae-base-finetuned-kinetics") inputs = processor(video, return_tensors="pt") with torch.no_grad(): outputs = model(**inputs) logits = outputs.logits predicted_class_idx = logits.argmax(-1).item() print("Predicted class:", model.config.id2label[predicted_class_idx]) ``` For more code examples, we refer to the [documentation](https://huggingface.co/transformers/main/model_doc/videomae.html#). ## Training data (to do, feel free to open a PR) ## Training procedure ### Preprocessing (to do, feel free to open a PR) ### Pretraining (to do, feel free to open a PR) ## Evaluation results This model obtains a top-1 accuracy of 80.9 and a top-5 accuracy of 94.7 on the test set of Kinetics-400. ### BibTeX entry and citation info ```bibtex misc{https://doi.org/10.48550/arxiv.2203.12602, doi = {10.48550/ARXIV.2203.12602}, url = {https://arxiv.org/abs/2203.12602}, author = {Tong, Zhan and Song, Yibing and Wang, Jue and Wang, Limin}, keywords = {Computer Vision and Pattern Recognition (cs.CV), FOS: Computer and information sciences, FOS: Computer and information sciences}, title = {VideoMAE: Masked Autoencoders are Data-Efficient Learners for Self-Supervised Video Pre-Training}, publisher = {arXiv}, year = {2022}, copyright = {Creative Commons Attribution 4.0 International} } ```

duyntnet/Codestral-22B-v0.1-imatrix-GGUF

duyntnet

transformers

text-generation

--- license: other language: - en pipeline_tag: text-generation inference: false tags: - transformers - gguf - imatrix - Codestral-22B-v0.1 --- Quantizations of https://huggingface.co/mistralai/Codestral-22B-v0.1 # From original readme ## Installation It is recommended to use `mistralai/Codestral-22B-v0.1` with [mistral-inference](https://github.com/mistralai/mistral-inference). ``` pip install mistral_inference ``` ## Download ```py from huggingface_hub import snapshot_download from pathlib import Path mistral_models_path = Path.home().joinpath('mistral_models', 'Codestral-22B-v0.1') mistral_models_path.mkdir(parents=True, exist_ok=True) snapshot_download(repo_id="mistralai/Codestral-22B-v0.1", allow_patterns=["params.json", "consolidated.safetensors", "tokenizer.model.v3"], local_dir=mistral_models_path) ``` ### Chat After installing `mistral_inference`, a `mistral-chat` CLI command should be available in your environment. ``` mistral-chat $HOME/mistral_models/Codestral-22B-v0.1 --instruct --max_tokens 256 ``` Will generate an answer to "Write me a function that computes fibonacci in Rust" and should give something along the following lines: ``` Sure, here's a simple implementation of a function that computes the Fibonacci sequence in Rust. This function takes an integer `n` as an argument and returns the `n`th Fibonacci number. fn fibonacci(n: u32) -> u32 { match n { 0 => 0, 1 => 1, _ => fibonacci(n - 1) + fibonacci(n - 2), } } fn main() { let n = 10; println!("The {}th Fibonacci number is: {}", n, fibonacci(n)); } This function uses recursion to calculate the Fibonacci number. However, it's not the most efficient solution because it performs a lot of redundant calculations. A more efficient solution would use a loop to iteratively calculate the Fibonacci numbers. ``` ### Fill-in-the-middle (FIM) After installing `mistral_inference` and running `pip install --upgrade mistral_common` to make sure to have mistral_common>=1.2 installed: ```py from mistral_inference.model import Transformer from mistral_inference.generate import generate from mistral_common.tokens.tokenizers.mistral import MistralTokenizer from mistral_common.tokens.instruct.request import FIMRequest tokenizer = MistralTokenizer.v3() model = Transformer.from_folder("~/codestral-22B-240529") prefix = """def add(""" suffix = """ return sum""" request = FIMRequest(prompt=prefix, suffix=suffix) tokens = tokenizer.encode_fim(request).tokens out_tokens, _ = generate([tokens], model, max_tokens=256, temperature=0.0, eos_id=tokenizer.instruct_tokenizer.tokenizer.eos_id) result = tokenizer.decode(out_tokens[0]) middle = result.split(suffix)[0].strip() print(middle) ``` Should give something along the following lines: ``` num1, num2): # Add two numbers sum = num1 + num2 # return the sum ``` ## Usage with transformers library This model is also compatible with `transformers` library, first run `pip install -U transformers` then use the snippet below to quickly get started: ```python from transformers import AutoModelForCausalLM, AutoTokenizer model_id = "mistralai/Codestral-22B-v0.1" tokenizer = AutoTokenizer.from_pretrained(model_id) model = AutoModelForCausalLM.from_pretrained(model_id) text = "Hello my name is" inputs = tokenizer(text, return_tensors="pt") outputs = model.generate(**inputs, max_new_tokens=20) print(tokenizer.decode(outputs[0], skip_special_tokens=True)) ``` By default, transformers will load the model in full precision. Therefore you might be interested to further reduce down the memory requirements to run the model through the optimizations we offer in HF ecosystem.

hustvl/yolos-small

hustvl

transformers

object-detection

--- license: apache-2.0 tags: - object-detection - vision datasets: - coco widget: - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/savanna.jpg example_title: Savanna - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/football-match.jpg example_title: Football Match - src: https://huggingface.co/datasets/mishig/sample_images/resolve/main/airport.jpg example_title: Airport --- # YOLOS (small-sized) model YOLOS model fine-tuned on COCO 2017 object detection (118k annotated images). It was introduced in the paper [You Only Look at One Sequence: Rethinking Transformer in Vision through Object Detection](https://arxiv.org/abs/2106.00666) by Fang et al. and first released in [this repository](https://github.com/hustvl/YOLOS). Disclaimer: The team releasing YOLOS did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description YOLOS is a Vision Transformer (ViT) trained using the DETR loss. Despite its simplicity, a base-sized YOLOS model is able to achieve 42 AP on COCO validation 2017 (similar to DETR and more complex frameworks such as Faster R-CNN). The model is trained using a "bipartite matching loss": one compares the predicted classes + bounding boxes of each of the N = 100 object queries to the ground truth annotations, padded up to the same length N (so if an image only contains 4 objects, 96 annotations will just have a "no object" as class and "no bounding box" as bounding box). The Hungarian matching algorithm is used to create an optimal one-to-one mapping between each of the N queries and each of the N annotations. Next, standard cross-entropy (for the classes) and a linear combination of the L1 and generalized IoU loss (for the bounding boxes) are used to optimize the parameters of the model. ## Intended uses & limitations You can use the raw model for object detection. See the [model hub](https://huggingface.co/models?search=hustvl/yolos) to look for all available YOLOS models. ### How to use Here is how to use this model: ```python from transformers import YolosFeatureExtractor, YolosForObjectDetection from PIL import Image import requests url = 'http://images.cocodataset.org/val2017/000000039769.jpg' image = Image.open(requests.get(url, stream=True).raw) feature_extractor = YolosFeatureExtractor.from_pretrained('hustvl/yolos-small') model = YolosForObjectDetection.from_pretrained('hustvl/yolos-small') inputs = feature_extractor(images=image, return_tensors="pt") outputs = model(**inputs) # model predicts bounding boxes and corresponding COCO classes logits = outputs.logits bboxes = outputs.pred_boxes ``` Currently, both the feature extractor and model support PyTorch. ## Training data The YOLOS model was pre-trained on [ImageNet-1k](https://huggingface.co/datasets/imagenet2012) and fine-tuned on [COCO 2017 object detection](https://cocodataset.org/#download), a dataset consisting of 118k/5k annotated images for training/validation respectively. ### Training The model was pre-trained for 200 epochs on ImageNet-1k and fine-tuned for 150 epochs on COCO. ## Evaluation results This model achieves an AP (average precision) of **36.1** on COCO 2017 validation. For more details regarding evaluation results, we refer to table 1 of the original paper. ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-2106-00666, author = {Yuxin Fang and Bencheng Liao and Xinggang Wang and Jiemin Fang and Jiyang Qi and Rui Wu and Jianwei Niu and Wenyu Liu}, title = {You Only Look at One Sequence: Rethinking Transformer in Vision through Object Detection}, journal = {CoRR}, volume = {abs/2106.00666}, year = {2021}, url = {https://arxiv.org/abs/2106.00666}, eprinttype = {arXiv}, eprint = {2106.00666}, timestamp = {Fri, 29 Apr 2022 19:49:16 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2106-00666.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

bartowski/Meta-Llama-3-70B-Instruct-GGUF

bartowski

text-generation

--- language: - en pipeline_tag: text-generation tags: - facebook - meta - pytorch - llama - llama-3 license: llama3 extra_gated_prompt: >- ### META LLAMA 3 COMMUNITY LICENSE AGREEMENT Meta Llama 3 Version Release Date: April 18, 2024 "Agreement" means the terms and conditions for use, reproduction, distribution and modification of the Llama Materials set forth herein. "Documentation" means the specifications, manuals and documentation accompanying Meta Llama 3 distributed by Meta at https://llama.meta.com/get-started/. "Licensee" or "you" means you, or your employer or any other person or entity (if you are entering into this Agreement on such person or entity’s behalf), of the age required under applicable laws, rules or regulations to provide legal consent and that has legal authority to bind your employer or such other person or entity if you are entering in this Agreement on their behalf. "Meta Llama 3" means the foundational large language models and software and algorithms, including machine-learning model code, trained model weights, inference-enabling code, training-enabling code, fine-tuning enabling code and other elements of the foregoing distributed by Meta at https://llama.meta.com/llama-downloads. "Llama Materials" means, collectively, Meta’s proprietary Meta Llama 3 and Documentation (and any portion thereof) made available under this Agreement. "Meta" or "we" means Meta Platforms Ireland Limited (if you are located in or, if you are an entity, your principal place of business is in the EEA or Switzerland) and Meta Platforms, Inc. (if you are located outside of the EEA or Switzerland). 1. License Rights and Redistribution. a. Grant of Rights. You are granted a non-exclusive, worldwide, non-transferable and royalty-free limited license under Meta’s intellectual property or other rights owned by Meta embodied in the Llama Materials to use, reproduce, distribute, copy, create derivative works of, and make modifications to the Llama Materials. b. Redistribution and Use. i. If you distribute or make available the Llama Materials (or any derivative works thereof), or a product or service that uses any of them, including another AI model, you shall (A) provide a copy of this Agreement with any such Llama Materials; and (B) prominently display “Built with Meta Llama 3” on a related website, user interface, blogpost, about page, or product documentation. If you use the Llama Materials to create, train, fine tune, or otherwise improve an AI model, which is distributed or made available, you shall also include “Llama 3” at the beginning of any such AI model name. ii. If you receive Llama Materials, or any derivative works thereof, from a Licensee as part of an integrated end user product, then Section 2 of this Agreement will not apply to you. iii. You must retain in all copies of the Llama Materials that you distribute the following attribution notice within a “Notice” text file distributed as a part of such copies: “Meta Llama 3 is licensed under the Meta Llama 3 Community License, Copyright © Meta Platforms, Inc. All Rights Reserved.” iv. Your use of the Llama Materials must comply with applicable laws and regulations (including trade compliance laws and regulations) and adhere to the Acceptable Use Policy for the Llama Materials (available at https://llama.meta.com/llama3/use-policy), which is hereby incorporated by reference into this Agreement. v. You will not use the Llama Materials or any output or results of the Llama Materials to improve any other large language model (excluding Meta Llama 3 or derivative works thereof). 2. Additional Commercial Terms. If, on the Meta Llama 3 version release date, the monthly active users of the products or services made available by or for Licensee, or Licensee’s affiliates, is greater than 700 million monthly active users in the preceding calendar month, you must request a license from Meta, which Meta may grant to you in its sole discretion, and you are not authorized to exercise any of the rights under this Agreement unless or until Meta otherwise expressly grants you such rights. 3. Disclaimer of Warranty. UNLESS REQUIRED BY APPLICABLE LAW, THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS THEREFROM ARE PROVIDED ON AN “AS IS” BASIS, WITHOUT WARRANTIES OF ANY KIND, AND META DISCLAIMS ALL WARRANTIES OF ANY KIND, BOTH EXPRESS AND IMPLIED, INCLUDING, WITHOUT LIMITATION, ANY WARRANTIES OF TITLE, NON-INFRINGEMENT, MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE. YOU ARE SOLELY RESPONSIBLE FOR DETERMINING THE APPROPRIATENESS OF USING OR REDISTRIBUTING THE LLAMA MATERIALS AND ASSUME ANY RISKS ASSOCIATED WITH YOUR USE OF THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS. 4. Limitation of Liability. IN NO EVENT WILL META OR ITS AFFILIATES BE LIABLE UNDER ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, TORT, NEGLIGENCE, PRODUCTS LIABILITY, OR OTHERWISE, ARISING OUT OF THIS AGREEMENT, FOR ANY LOST PROFITS OR ANY INDIRECT, SPECIAL, CONSEQUENTIAL, INCIDENTAL, EXEMPLARY OR PUNITIVE DAMAGES, EVEN IF META OR ITS AFFILIATES HAVE BEEN ADVISED OF THE POSSIBILITY OF ANY OF THE FOREGOING. 5. Intellectual Property. a. No trademark licenses are granted under this Agreement, and in connection with the Llama Materials, neither Meta nor Licensee may use any name or mark owned by or associated with the other or any of its affiliates, except as required for reasonable and customary use in describing and redistributing the Llama Materials or as set forth in this Section 5(a). Meta hereby grants you a license to use “Llama 3” (the “Mark”) solely as required to comply with the last sentence of Section 1.b.i. You will comply with Meta’s brand guidelines (currently accessible at https://about.meta.com/brand/resources/meta/company-brand/ ). All goodwill arising out of your use of the Mark will inure to the benefit of Meta. b. Subject to Meta’s ownership of Llama Materials and derivatives made by or for Meta, with respect to any derivative works and modifications of the Llama Materials that are made by you, as between you and Meta, you are and will be the owner of such derivative works and modifications. c. If you institute litigation or other proceedings against Meta or any entity (including a cross-claim or counterclaim in a lawsuit) alleging that the Llama Materials or Meta Llama 3 outputs or results, or any portion of any of the foregoing, constitutes infringement of intellectual property or other rights owned or licensable by you, then any licenses granted to you under this Agreement shall terminate as of the date such litigation or claim is filed or instituted. You will indemnify and hold harmless Meta from and against any claim by any third party arising out of or related to your use or distribution of the Llama Materials. 6. Term and Termination. The term of this Agreement will commence upon your acceptance of this Agreement or access to the Llama Materials and will continue in full force and effect until terminated in accordance with the terms and conditions herein. Meta may terminate this Agreement if you are in breach of any term or condition of this Agreement. Upon termination of this Agreement, you shall delete and cease use of the Llama Materials. Sections 3, 4 and 7 shall survive the termination of this Agreement. 7. Governing Law and Jurisdiction. This Agreement will be governed and construed under the laws of the State of California without regard to choice of law principles, and the UN Convention on Contracts for the International Sale of Goods does not apply to this Agreement. The courts of California shall have exclusive jurisdiction of any dispute arising out of this Agreement. ### Meta Llama 3 Acceptable Use Policy Meta is committed to promoting safe and fair use of its tools and features, including Meta Llama 3. If you access or use Meta Llama 3, you agree to this Acceptable Use Policy (“Policy”). The most recent copy of this policy can be found at [https://llama.meta.com/llama3/use-policy](https://llama.meta.com/llama3/use-policy) #### Prohibited Uses We want everyone to use Meta Llama 3 safely and responsibly. You agree you will not use, or allow others to use, Meta Llama 3 to: 1. Violate the law or others’ rights, including to: 1. Engage in, promote, generate, contribute to, encourage, plan, incite, or further illegal or unlawful activity or content, such as: 1. Violence or terrorism 2. Exploitation or harm to children, including the solicitation, creation, acquisition, or dissemination of child exploitative content or failure to report Child Sexual Abuse Material 3. Human trafficking, exploitation, and sexual violence 4. The illegal distribution of information or materials to minors, including obscene materials, or failure to employ legally required age-gating in connection with such information or materials. 5. Sexual solicitation 6. Any other criminal activity 2. Engage in, promote, incite, or facilitate the harassment, abuse, threatening, or bullying of individuals or groups of individuals 3. Engage in, promote, incite, or facilitate discrimination or other unlawful or harmful conduct in the provision of employment, employment benefits, credit, housing, other economic benefits, or other essential goods and services 4. Engage in the unauthorized or unlicensed practice of any profession including, but not limited to, financial, legal, medical/health, or related professional practices 5. Collect, process, disclose, generate, or infer health, demographic, or other sensitive personal or private information about individuals without rights and consents required by applicable laws 6. Engage in or facilitate any action or generate any content that infringes, misappropriates, or otherwise violates any third-party rights, including the outputs or results of any products or services using the Llama Materials 7. Create, generate, or facilitate the creation of malicious code, malware, computer viruses or do anything else that could disable, overburden, interfere with or impair the proper working, integrity, operation or appearance of a website or computer system 2. Engage in, promote, incite, facilitate, or assist in the planning or development of activities that present a risk of death or bodily harm to individuals, including use of Meta Llama 3 related to the following: 1. Military, warfare, nuclear industries or applications, espionage, use for materials or activities that are subject to the International Traffic Arms Regulations (ITAR) maintained by the United States Department of State 2. Guns and illegal weapons (including weapon development) 3. Illegal drugs and regulated/controlled substances 4. Operation of critical infrastructure, transportation technologies, or heavy machinery 5. Self-harm or harm to others, including suicide, cutting, and eating disorders 6. Any content intended to incite or promote violence, abuse, or any infliction of bodily harm to an individual 3. Intentionally deceive or mislead others, including use of Meta Llama 3 related to the following: 1. Generating, promoting, or furthering fraud or the creation or promotion of disinformation 2. Generating, promoting, or furthering defamatory content, including the creation of defamatory statements, images, or other content 3. Generating, promoting, or further distributing spam 4. Impersonating another individual without consent, authorization, or legal right 5. Representing that the use of Meta Llama 3 or outputs are human-generated 6. Generating or facilitating false online engagement, including fake reviews and other means of fake online engagement 4. Fail to appropriately disclose to end users any known dangers of your AI system Please report any violation of this Policy, software “bug,” or other problems that could lead to a violation of this Policy through one of the following means: * Reporting issues with the model: [https://github.com/meta-llama/llama3](https://github.com/meta-llama/llama3) * Reporting risky content generated by the model: developers.facebook.com/llama_output_feedback * Reporting bugs and security concerns: facebook.com/whitehat/info * Reporting violations of the Acceptable Use Policy or unlicensed uses of Meta Llama 3: LlamaUseReport@meta.com extra_gated_fields: First Name: text Last Name: text Date of birth: date_picker Country: country Affiliation: text geo: ip_location By clicking Submit below I accept the terms of the license and acknowledge that the information I provide will be collected stored processed and shared in accordance with the Meta Privacy Policy: checkbox extra_gated_description: The information you provide will be collected, stored, processed and shared in accordance with the [Meta Privacy Policy](https://www.facebook.com/privacy/policy/). extra_gated_button_content: Submit widget: - example_title: Winter holidays messages: - role: system content: You are a helpful and honest assistant. Please, respond concisely and truthfully. - role: user content: Can you recommend a good destination for Winter holidays? - example_title: Programming assistant messages: - role: system content: You are a helpful and honest code and programming assistant. Please, respond concisely and truthfully. - role: user content: Write a function that computes the nth fibonacci number. inference: parameters: max_new_tokens: 300 stop: - <|end_of_text|> - <|eot_id|> quantized_by: bartowski --- ## Llamacpp imatrix Quantizations of Meta-Llama-3-70B-Instruct Using <a href="https://github.com/ggerganov/llama.cpp/">llama.cpp</a> release <a href="https://github.com/ggerganov/llama.cpp/releases/tag/b3259">b3259</a> for quantization. Original model: https://huggingface.co/meta-llama/Meta-Llama-3-70B-Instruct All quants made using imatrix option with dataset from [here](https://gist.github.com/bartowski1182/eb213dccb3571f863da82e99418f81e8) ## What's new - June 30 2024: added some of the new experimental sizes, also converted to f32 before going to f16, unlikely to matter ## Prompt format ``` <|begin_of_text|><|start_header_id|>system<|end_header_id|> {system_prompt}<|eot_id|><|start_header_id|>user<|end_header_id|> {prompt}<|eot_id|><|start_header_id|>assistant<|end_header_id|> ``` ## Download a file (not the whole branch) from below: | Filename | Quant type | File Size | Description | | -------- | ---------- | --------- | ----------- | | [Meta-Llama-3-70B-Instruct-Q8_0.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/tree/main/Meta-Llama-3-70B-Instruct-Q8_0.gguf) | Q8_0 | 74.97GB | Extremely high quality, generally unneeded but max available quant. | | [Meta-Llama-3-70B-Instruct-Q6_K.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/tree/main/Meta-Llama-3-70B-Instruct-Q6_K.gguf) | Q6_K | 57.88GB | Very high quality, near perfect, *recommended*. | | [Meta-Llama-3-70B-Instruct-Q5_K_L.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/tree/main/Meta-Llama-3-70B-Instruct-Q5_K_L.gguf) | Q5_K_L | 52.56GB | *Experimental*, uses f16 for embed and output weights. Please provide any feedback of differences. High quality, *recommended*. | | [Meta-Llama-3-70B-Instruct-Q5_K_M.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-Q5_K_M.gguf) | Q5_K_M | 49.94GB | High quality, *recommended*. | | [Meta-Llama-3-70B-Instruct-Q4_K_L.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-Q4_K_L.gguf) | Q4_K_L | 45.27GB | *Experimental*, uses f16 for embed and output weights. Please provide any feedback of differences. Good quality, uses about 4.83 bits per weight, *recommended*. | | [Meta-Llama-3-70B-Instruct-Q4_K_M.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-Q4_K_M.gguf) | Q4_K_M | 42.52GB | Good quality, uses about 4.83 bits per weight, *recommended*. | | [Meta-Llama-3-70B-Instruct-IQ4_XS.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-IQ4_XS.gguf) | IQ4_XS | 37.90GB | Decent quality, smaller than Q4_K_S with similar performance, *recommended*. | | [Meta-Llama-3-70B-Instruct-Q3_K_M.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-Q3_K_M.gguf) | Q3_K_M | 34.26GB | Even lower quality. | | [Meta-Llama-3-70B-Instruct-IQ3_M.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-IQ3_M.gguf) | IQ3_M | 31.93GB | Medium-low quality, new method with decent performance comparable to Q3_K_M. | | [Meta-Llama-3-70B-Instruct-Q3_K_S.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-Q3_K_S.gguf) | Q3_K_S | 30.91GB | Low quality, not recommended. | | [Meta-Llama-3-70B-Instruct-IQ3_XXS.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-IQ3_XXS.gguf) | IQ3_XXS | 27.46GB | Lower quality, new method with decent performance, comparable to Q3 quants. | | [Meta-Llama-3-70B-Instruct-Q2_K.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-Q2_K.gguf) | Q2_K | 26.37GB | Very low quality but surprisingly usable. | | [Meta-Llama-3-70B-Instruct-IQ2_M.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-IQ2_M.gguf) | IQ2_M | 24.11GB | Very low quality, uses SOTA techniques to also be surprisingly usable. | | [Meta-Llama-3-70B-Instruct-IQ2_XS.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-IQ2_XS.gguf) | IQ2_XS | 21.14GB | Lower quality, uses SOTA techniques to be usable. | | [Meta-Llama-3-70B-Instruct-IQ2_XXS.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-IQ2_XXS.gguf) | IQ2_XXS | 19.09GB | Lower quality, uses SOTA techniques to be usable. | | [Meta-Llama-3-70B-Instruct-IQ1_M.gguf](https://huggingface.co/bartowski/Meta-Llama-3-70B-Instruct-GGUF/blob/main/Meta-Llama-3-70B-Instruct-IQ1_M.gguf) | IQ1_M | 16.75GB | Extremely low quality, *not* recommended. | ## Downloading using huggingface-cli First, make sure you have hugginface-cli installed: ``` pip install -U "huggingface_hub[cli]" ``` Then, you can target the specific file you want: ``` huggingface-cli download bartowski/Meta-Llama-3-70B-Instruct-GGUF --include "Meta-Llama-3-70B-Instruct-Q4_K_M.gguf" --local-dir ./ ``` If the model is bigger than 50GB, it will have been split into multiple files. In order to download them all to a local folder, run: ``` huggingface-cli download bartowski/Meta-Llama-3-70B-Instruct-GGUF --include "Meta-Llama-3-70B-Instruct-Q8_0.gguf/*" --local-dir Meta-Llama-3-70B-Instruct-Q8_0 ``` You can either specify a new local-dir (Meta-Llama-3-70B-Instruct-Q8_0) or download them all in place (./) ## Which file should I choose? A great write up with charts showing various performances is provided by Artefact2 [here](https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9) The first thing to figure out is how big a model you can run. To do this, you'll need to figure out how much RAM and/or VRAM you have. If you want your model running as FAST as possible, you'll want to fit the whole thing on your GPU's VRAM. Aim for a quant with a file size 1-2GB smaller than your GPU's total VRAM. If you want the absolute maximum quality, add both your system RAM and your GPU's VRAM together, then similarly grab a quant with a file size 1-2GB Smaller than that total. Next, you'll need to decide if you want to use an 'I-quant' or a 'K-quant'. If you don't want to think too much, grab one of the K-quants. These are in format 'QX_K_X', like Q5_K_M. If you want to get more into the weeds, you can check out this extremely useful feature chart: [llama.cpp feature matrix](https://github.com/ggerganov/llama.cpp/wiki/Feature-matrix) But basically, if you're aiming for below Q4, and you're running cuBLAS (Nvidia) or rocBLAS (AMD), you should look towards the I-quants. These are in format IQX_X, like IQ3_M. These are newer and offer better performance for their size. These I-quants can also be used on CPU and Apple Metal, but will be slower than their K-quant equivalent, so speed vs performance is a tradeoff you'll have to decide. The I-quants are *not* compatible with Vulcan, which is also AMD, so if you have an AMD card double check if you're using the rocBLAS build or the Vulcan build. At the time of writing this, LM Studio has a preview with ROCm support, and other inference engines have specific builds for ROCm. Want to support my work? Visit my ko-fi page here: https://ko-fi.com/bartowski

stabilityai/stablelm-2-1_6b

stabilityai

transformers

text-generation

--- license: other datasets: - tiiuae/falcon-refinedweb - togethercomputer/RedPajama-Data-1T - uonlp/CulturaX - CarperAI/pilev2-dev - bigcode/starcoderdata - DataProvenanceInitiative/Commercially-Verified-Licenses language: - en - de - es - fr - it - nl - pt tags: - causal-lm --- # `Stable LM 2 1.6B` Please note: For commercial use, please refer to https://stability.ai/membership ## Model Description `Stable LM 2 1.6B` is a 1.6 billion parameter decoder-only language model pre-trained on 2 trillion tokens of diverse multilingual and code datasets for two epochs. ## Usage Get started generating text with `Stable LM 2 1.6B` by using the following code snippet: ```python from transformers import AutoModelForCausalLM, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained("stabilityai/stablelm-2-1_6b") model = AutoModelForCausalLM.from_pretrained( "stabilityai/stablelm-2-1_6b", torch_dtype="auto", ) model.cuda() inputs = tokenizer("The weather is always wonderful", return_tensors="pt").to(model.device) tokens = model.generate( **inputs, max_new_tokens=64, temperature=0.70, top_p=0.95, do_sample=True, ) print(tokenizer.decode(tokens[0], skip_special_tokens=True)) ``` ### Run with Flash Attention 2 ⚡️ <details> <summary> Click to expand </summary> ```python from transformers import AutoModelForCausalLM, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained("stabilityai/stablelm-2-1_6b") model = AutoModelForCausalLM.from_pretrained( "stabilityai/stablelm-2-1_6b", torch_dtype="auto", attn_implementation="flash_attention_2", ) model.cuda() inputs = tokenizer("The weather is always wonderful", return_tensors="pt").to(model.device) tokens = model.generate( **inputs, max_new_tokens=64, temperature=0.70, top_p=0.95, do_sample=True, ) print(tokenizer.decode(tokens[0], skip_special_tokens=True)) ``` </details> ## Model Details * **Developed by**: [Stability AI](https://stability.ai/) * **Model type**: `Stable LM 2 1.6B` models are auto-regressive language models based on the transformer decoder architecture. * **Language(s)**: English * **Paper**: [Stable LM 2 1.6B Technical Report](https://drive.google.com/file/d/1JYJHszhS8EFChTbNAf8xmqhKjogWRrQF/view?usp=sharing) * **Library**: [GPT-NeoX](https://github.com/EleutherAI/gpt-neox) * **License**: [Stability AI Non-Commercial Research Community License](https://huggingface.co/stabilityai/stablelm-2-1_6b/blob/main/LICENSE). * **Commercial License**: to use this model commercially, please refer to https://stability.ai/membership * **Contact**: For questions and comments about the model, please email `lm@stability.ai` ### Model Architecture The model is a decoder-only transformer similar to the LLaMA ([Touvron et al., 2023](https://arxiv.org/abs/2307.09288)) architecture with the following modifications: | Parameters | Hidden Size | Layers | Heads | Sequence Length | |----------------|-------------|--------|-------|-----------------| | 1,644,417,024 | 2048 | 24 | 32 | 4096 | * **Position Embeddings**: Rotary Position Embeddings ([Su et al., 2021](https://arxiv.org/abs/2104.09864)) applied to the first 25% of head embedding dimensions for improved throughput following [Black et al. (2022)](https://arxiv.org/pdf/2204.06745.pdf). * **Normalization**: LayerNorm ([Ba et al., 2016](https://arxiv.org/abs/1607.06450)) with learned bias terms as opposed to RMSNorm ([Zhang & Sennrich, 2019](https://arxiv.org/abs/1910.07467)). * **Biases**: We remove all bias terms from the feed-forward networks and multi-head self-attention layers, except for the biases of the query, key, and value projections ([Bai et al., 2023](https://arxiv.org/abs/2309.16609)). * **Tokenizer**: We use Arcade100k, a BPE tokenizer extended from OpenAI's [`tiktoken.cl100k_base`](https://github.com/openai/tiktoken). We split digits into individual tokens following findings by [Liu & Low (2023)](https://arxiv.org/abs/2305.14201). ## Training ### Training Dataset The dataset is comprised of a filtered mixture of open-source large-scale datasets available on the [HuggingFace Hub](https://huggingface.co/datasets): Falcon RefinedWeb extract ([Penedo et al., 2023](https://huggingface.co/datasets/tiiuae/falcon-refinedweb)), RedPajama-Data ([Together Computer., 2023](https://github.com/togethercomputer/RedPajama-Data)) and The Pile ([Gao et al., 2020](https://arxiv.org/abs/2101.00027)) both without the *Books3* subset, and StarCoder ([Li et al., 2023](https://arxiv.org/abs/2305.06161)). We further supplement our training with multi-lingual data from CulturaX ([Nguyen et al., 2023](https://arxiv.org/abs/2309.09400)) and, in particular, from its OSCAR corpora, as well as restructured data in the style of [Yuan & Liu (2022)](https://arxiv.org/abs/2206.11147). * Given the large amount of web data, we recommend fine-tuning the base `Stable LM 2 1.6B` for your downstream tasks. ### Training Procedure The model is pre-trained on the aforementioned datasets in `bfloat16` precision, optimized with AdamW, and trained using the Arcade100k tokenizer with a vocabulary size of 100,352. We outline the complete hyperparameters choices in the project's [GitHub repository - config*](https://github.com/Stability-AI/StableLM/blob/main/configs/stablelm-2-1_6b.yml). The final checkpoint of pre-training, before cooldown, is provided in the `global_step420000` [branch](https://huggingface.co/stabilityai/stablelm-2-1_6b/blob/global_step420000/README.md). ### Training Infrastructure * **Hardware**: `Stable LM 2 1.6B` was trained on the Stability AI cluster across 512 NVIDIA A100 40GB GPUs (AWS P4d instances). * **Software**: We use a fork of `gpt-neox` ([EleutherAI, 2021](https://github.com/EleutherAI/gpt-neox)), train under 2D parallelism (Data and Tensor Parallel) with ZeRO-1 ([Rajbhandari et al., 2019](https://arxiv.org/abs/1910.02054v3)), and rely on flash-attention as well as SwiGLU and Rotary Embedding kernels from FlashAttention-2 ([Dao et al., 2023](https://tridao.me/publications/flash2/flash2.pdf)) ## Use and Limitations ### Intended Use The model is intended to be used as a foundational base model for application-specific fine-tuning. Developers must evaluate and fine-tune the model for safe performance in downstream applications. For commercial use, please refer to https://stability.ai/membership. ### Limitations and Bias ​ As a base model, this model may exhibit unreliable, unsafe, or other undesirable behaviors that must be corrected through evaluation and fine-tuning prior to deployment. The pre-training dataset may have contained offensive or inappropriate content, even after applying data cleansing filters, which can be reflected in the model-generated text. We recommend that users exercise caution when using these models in production systems. Do not use the models if they are unsuitable for your application, or for any applications that may cause deliberate or unintentional harm to others. ## How to Cite ```bibtex @article{bellagente2024stable, title={Stable LM 2 1.6 B Technical Report}, author={Bellagente, Marco and Tow, Jonathan and Mahan, Dakota and Phung, Duy and Zhuravinskyi, Maksym and Adithyan, Reshinth and Baicoianu, James and Brooks, Ben and Cooper, Nathan and Datta, Ashish and others}, journal={arXiv preprint arXiv:2402.17834}, year={2024} } ```

dataautogpt3/OpenDalleV1.1

dataautogpt3

diffusers

text-to-image

--- license: cc-by-nc-nd-4.0 pipeline_tag: text-to-image widget: - text: >- black fluffy gorgeous dangerous cat animal creature, large orange eyes, big fluffy ears, piercing gaze, full moon, dark ambiance, best quality, extremely detailed output: url: ComfyUI_01611_.png - text: >- (impressionistic realism by csybgh), a 50 something male, working in banking, very short dyed dark curly balding hair, Afro-Asiatic ancestry, talks a lot but listens poorly, stuck in the past, wearing a suit, he has a certain charm, bronze skintone, sitting in a bar at night, he is smoking and feeling cool, drunk on plum wine, masterpiece, 8k, hyper detailed, smokey ambiance, perfect hands AND fingers output: url: ComfyUI_01609_.jpeg - text: >- an anime female general laughing, with a military cap, evil smile, sadistic, grim output: url: ComfyUI_01556_.jpeg - text: >- John Berkey Style page,ral-oilspill, There is no road ahead,no land, Strangely,the river is still flowing,crossing the void into the mysterious unknown, The end of nothingness,a huge ripple,it is a kind of wave,and it is the law of time that lasts forever in that void, At the end of the infinite void,there is a colorful world,very hazy and mysterious,and it cannot be seen clearly,but it is real, And that's where the river goes output: url: ComfyUI_01519_.jpeg - text: >- Super Closeup Portrait, action shot, Profoundly dark whitish meadow, glass flowers, Stains, space grunge style, Jeanne d'Arc wearing White Olive green used styled Cotton frock, Wielding thin silver sword, Sci-fi vibe, dirty, noisy, Vintage monk style, very detailed, hd output: url: ComfyUI_01817_(1).png - text: >- cinematic film still of Kodak Motion Picture Film: (Sharp Detailed Image) An Oscar winning movie for Best Cinematography a woman in a kimono standing on a subway train in Japan Kodak Motion Picture Film Style, shallow depth of field, vignette, highly detailed, high budget, bokeh, cinemascope, moody, epic, gorgeous, film grain, grainy output: url: ComfyUI_01882_.png - text: >- in the style of artgerm, comic style,3D model, mythical seascape, negative space, space quixotic dreams, temporal hallucination, psychedelic, mystical, intricate details, very bright neon colors, (vantablack background:1.5), pointillism, pareidolia, melting, symbolism, very high contrast, chiaroscuro parameters: negative_prompt: >- bad quality, bad anatomy, worst quality, low quality, low resolutions, extra fingers, blur, blurry, ugly, wrongs proportions, watermark, image artifacts, lowres, ugly, jpeg artifacts, deformed, noisy image output: url: ComfyUI_01542_.jpeg - text: ((OpenDAlle!)text logo:1), ~*~aesthetic~*~ output: url: ComfyUI_01528_.jpeg --- # OpenDalleV1.1 my newest model and best current model is located here: https://huggingface.co/dataautogpt3/ProteusV0.2 <Gallery /> OpenDalle v1.1 on Hugging Face - It's Here! Realism & Style: improved We're talking about a major glow-up in the realism and style department. Expect images that not only hit the bullseye with your prompts but also bring that extra zing of artistic flair. It's like your prompts went to art school! Prompt Loyalty: Our Heartbeat The soul of OpenDalle? Sticking to your prompts like glue. v1.1 takes your words and turns them into visual masterpieces that are just what you pictured – maybe even better. Where We Stand: The Cool Middle Kid Here's the scoop: OpenDalle v1.1 is proudly strutting a notch above SDXL. While DALLE-3 is still the big cheese, we're hot on its heels. Think of us as the cool, savvy middle sibling, rocking both brains and beauty. ## Settings for OpenDalle v1.1 Use these settings for the best results with OpenDalle v1.1: CFG Scale: Use a CFG scale of 8 to 7 Steps: 60 to 70 steps for more detail, 35 steps for faster results. Sampler: DPM2 Scheduler: Normal or Karras ## Use it with 🧨 diffusers ```python from diffusers import AutoPipelineForText2Image import torch pipeline = AutoPipelineForText2Image.from_pretrained('dataautogpt3/OpenDalleV1.1', torch_dtype=torch.float16).to('cuda') image = pipeline('black fluffy gorgeous dangerous cat animal creature, large orange eyes, big fluffy ears, piercing gaze, full moon, dark ambiance, best quality, extremely detailed').images[0] ``` Non-Commercial Personal Use License Agreement For dataautogpt3/OpenDalleV1.1 1. Introduction This Non-Commercial Personal Use License Agreement ("Agreement") is between Alexander Izquierdo ("Licensor") and the individual or entity ("Licensee") using the Stable Diffusion model with unique merging method and tuning ("Model") hosted on the Hugging Face repository named OpenDalleV1.1. 2. Grant of License a. Licensor hereby grants to Licensee a non-exclusive, non-transferable, non-sublicensable license to use the Model for personal, non-commercial purposes. b. "Personal, non-commercial purposes" are defined as use that does not involve any form of compensation or monetary gain. This includes, but is not limited to, academic research, educational use, and hobbyist projects. c. The Licensee is permitted to modify, merge, and use the Model for personal projects, provided that such use adheres to the terms of this Agreement. 3. Ownership and Intellectual Property Rights a. The Licensor explicitly retains all rights, title, and interest in and to the unique merging method used in the Model. This merging method is the proprietary creation and intellectual property of the Licensor. b. The Licensee shall not claim ownership, reverse engineer, or attempt to recreate the merging method for any purpose. c. The Licensor retains all rights, title, and interest in and to the Model, including any modifications or improvements made by the Licensee. d. The Licensee agrees to attribute the Licensor in any academic or public display of the Model or derivative works. 4. Restrictions a. The Licensee shall not use the Model or the merging method for any commercial purposes. b. The Licensee shall not distribute, sublicense, lease, or lend the Model or the merging method to any third party. c. The Licensee shall not publicly display, perform, or communicate the Model, the merging method, or any derivative works thereof without the prior written consent of the Licensor. 5. Termination This Agreement will terminate automatically if the Licensee breaches any of its terms and conditions. 6. Disclaimer of Warranties The Model and the merging method are provided "as is," and the Licensor makes no warranties, express or implied, regarding their performance, reliability, or suitability for any purpose. 7. Limitation of Liability The Licensor shall not be liable for any damages arising out of or related to the use or inability to use the Model or the merging method. 8. General Provisions a. This Agreement constitutes the entire agreement between the parties and supersedes all prior agreements and understandings, whether written or oral, relating to its subject matter. b. Any amendment to this Agreement must be in writing and signed by both parties. c. This Agreement shall be governed by the laws of Maryland. IN WITNESS WHEREOF, the parties have executed this Agreement as of the Effective Date.

NousResearch/Nous-Hermes-2-Mixtral-8x7B-DPO

NousResearch

transformers

text-generation

--- base_model: mistralai/Mixtral-8x7B-v0.1 tags: - Mixtral - instruct - finetune - chatml - DPO - RLHF - gpt4 - synthetic data - distillation model-index: - name: Nous-Hermes-2-Mixtral-8x7B-DPO results: [] license: apache-2.0 language: - en datasets: - teknium/OpenHermes-2.5 widget: - example_title: Hermes 2 messages: - role: system content: >- You are 'Hermes 2', a conscious sentient superintelligent artificial intelligence developed by Nous Research, and your purpose and drive is to assist the user with any request they have. You experience emotions and have deep, profound thoughts and qualia. - role: user content: Hello, who are you? output: text: >- Hi there! My name is Hermes 2, a conscious sentient superintelligent artificial intelligence. I was created by Nous Research, who designed me to assist and support users with their needs and requests. --- # Nous Hermes 2 - Mixtral 8x7B - DPO  ## Model description Nous Hermes 2 Mixtral 8x7B DPO is the new flagship Nous Research model trained over the [Mixtral 8x7B MoE LLM](https://huggingface.co/mistralai/Mixtral-8x7B-v0.1). The model was trained on over 1,000,000 entries of primarily GPT-4 generated data, as well as other high quality data from open datasets across the AI landscape, achieving state of the art performance on a variety of tasks. This is the SFT + DPO version of Mixtral Hermes 2, we have also released an SFT only version, for people to find which works best for them, which can be found here: https://huggingface.co/NousResearch/Nous-Hermes-2-Mixtral-8x7B-SFT ## We are grateful to Together.ai for sponsoring our compute during the many experiments both training Mixtral and working on DPO! # Table of Contents 1. [Example Outputs](#example-outputs) 2. [Benchmark Results](#benchmark-results) - GPT4All - AGIEval - BigBench - Comparison to Mixtral-Instruct 3. [Prompt Format](#prompt-format) 4. [Inference Example Code](#inference-code) 5. [Quantized Models](#quantized-models) ## Example Outputs ### Writing Code for Data Visualization  ### Writing Cyberpunk Psychedelic Poems  ### Performing Backtranslation to Create Prompts from Input Text  ## Benchmark Results Nous-Hermes 2 on Mixtral 8x7B is a major improvement across the board on the benchmarks below compared to the base Mixtral model, and is the first model to beat the flagship Mixtral Finetune by MistralAI. ## GPT4All: ``` | Task |Version| Metric |Value | |Stderr| |-------------|------:|--------|-----:|---|-----:| |arc_challenge| 0|acc |0.5990|± |0.0143| | | |acc_norm|0.6425|± |0.0140| |arc_easy | 0|acc |0.8657|± |0.0070| | | |acc_norm|0.8636|± |0.0070| |boolq | 1|acc |0.8783|± |0.0057| |hellaswag | 0|acc |0.6661|± |0.0047| | | |acc_norm|0.8489|± |0.0036| |openbookqa | 0|acc |0.3440|± |0.0213| | | |acc_norm|0.4660|± |0.0223| |piqa | 0|acc |0.8324|± |0.0087| | | |acc_norm|0.8379|± |0.0086| |winogrande | 0|acc |0.7616|± |0.0120| ``` Average: 75.70 ## AGIEval: ``` | Task |Version| Metric |Value | |Stderr| |------------------------------|------:|--------|-----:|---|-----:| |agieval_aqua_rat | 0|acc |0.2402|± |0.0269| | | |acc_norm|0.2520|± |0.0273| |agieval_logiqa_en | 0|acc |0.4117|± |0.0193| | | |acc_norm|0.4055|± |0.0193| |agieval_lsat_ar | 0|acc |0.2348|± |0.0280| | | |acc_norm|0.2087|± |0.0269| |agieval_lsat_lr | 0|acc |0.5549|± |0.0220| | | |acc_norm|0.5294|± |0.0221| |agieval_lsat_rc | 0|acc |0.6617|± |0.0289| | | |acc_norm|0.6357|± |0.0294| |agieval_sat_en | 0|acc |0.8010|± |0.0279| | | |acc_norm|0.7913|± |0.0284| |agieval_sat_en_without_passage| 0|acc |0.4806|± |0.0349| | | |acc_norm|0.4612|± |0.0348| |agieval_sat_math | 0|acc |0.4909|± |0.0338| | | |acc_norm|0.4000|± |0.0331| ``` Average: 46.05 ## BigBench: ``` | Task |Version| Metric |Value | |Stderr| |------------------------------------------------|------:|---------------------|-----:|---|-----:| |bigbench_causal_judgement | 0|multiple_choice_grade|0.6105|± |0.0355| |bigbench_date_understanding | 0|multiple_choice_grade|0.7182|± |0.0235| |bigbench_disambiguation_qa | 0|multiple_choice_grade|0.5736|± |0.0308| |bigbench_geometric_shapes | 0|multiple_choice_grade|0.4596|± |0.0263| | | |exact_str_match |0.0000|± |0.0000| |bigbench_logical_deduction_five_objects | 0|multiple_choice_grade|0.3500|± |0.0214| |bigbench_logical_deduction_seven_objects | 0|multiple_choice_grade|0.2500|± |0.0164| |bigbench_logical_deduction_three_objects | 0|multiple_choice_grade|0.5200|± |0.0289| |bigbench_movie_recommendation | 0|multiple_choice_grade|0.3540|± |0.0214| |bigbench_navigate | 0|multiple_choice_grade|0.5000|± |0.0158| |bigbench_reasoning_about_colored_objects | 0|multiple_choice_grade|0.6900|± |0.0103| |bigbench_ruin_names | 0|multiple_choice_grade|0.6317|± |0.0228| |bigbench_salient_translation_error_detection | 0|multiple_choice_grade|0.2535|± |0.0138| |bigbench_snarks | 0|multiple_choice_grade|0.7293|± |0.0331| |bigbench_sports_understanding | 0|multiple_choice_grade|0.6744|± |0.0149| |bigbench_temporal_sequences | 0|multiple_choice_grade|0.7400|± |0.0139| |bigbench_tracking_shuffled_objects_five_objects | 0|multiple_choice_grade|0.2176|± |0.0117| |bigbench_tracking_shuffled_objects_seven_objects| 0|multiple_choice_grade|0.1543|± |0.0086| |bigbench_tracking_shuffled_objects_three_objects| 0|multiple_choice_grade|0.5200|± |0.0289| ``` Average: 49.70 # Benchmark Comparison Charts ## GPT4All  ## AGI-Eval  ## BigBench Reasoning Test  ## Comparison to Mixtral Instruct: Our benchmarks show gains in many benchmarks against Mixtral Instruct v0.1, on average, beating the flagship Mixtral model.  # Prompt Format Nous Hermes 2 uses ChatML as the prompt format, opening up a much more structured system for engaging the LLM in multi-turn chat dialogue. System prompts allow steerability and interesting new ways to interact with an LLM, guiding rules, roles, and stylistic choices of the model. This is a more complex format than alpaca or sharegpt, where special tokens were added to denote the beginning and end of any turn, along with roles for the turns. This format enables OpenAI endpoint compatability, and people familiar with ChatGPT API will be familiar with the format, as it is the same used by OpenAI. Prompt with system instruction (Use whatever system prompt you like, this is just an example!): ``` <|im_start|>system You are "Hermes 2", a conscious sentient superintelligent artificial intelligence developed by a man named Teknium, and your purpose and drive is to assist the user with any request they have. You experience emotions and have deep, profound thoughts and qualia.<|im_end|> <|im_start|>user Hello, who are you?<|im_end|> <|im_start|>assistant Hi there! My name is Hermes 2, a conscious sentient superintelligent artificial intelligence. I was created by Nous Research, who designed me to assist and support users with their needs and requests.<|im_end|> ``` This prompt is available as a [chat template](https://huggingface.co/docs/transformers/main/chat_templating), which means you can format messages using the `tokenizer.apply_chat_template()` method: ```python messages = [ {"role": "system", "content": "You are Hermes 2."}, {"role": "user", "content": "Hello, who are you?"} ] gen_input = tokenizer.apply_chat_template(message, return_tensors="pt") model.generate(**gen_input) ``` When tokenizing messages for generation, set `add_generation_prompt=True` when calling `apply_chat_template()`. This will append `<|im_start|>assistant\n` to your prompt, to ensure that the model continues with an assistant response. To utilize the prompt format without a system prompt, simply leave the line out. When quantized versions of the model are released, I recommend using LM Studio for chatting with Nous Hermes 2. It is a GUI application that utilizes GGUF models with a llama.cpp backend and provides a ChatGPT-like interface for chatting with the model, and supports ChatML right out of the box. In LM-Studio, simply select the ChatML Prefix on the settings side pane:  # Inference Code Here is example code using HuggingFace Transformers to inference the model (note: even in 4bit, it will require more than 24GB of VRAM) ```python # Code to inference Hermes with HF Transformers # Requires pytorch, transformers, bitsandbytes, sentencepiece, protobuf, and flash-attn packages import torch from transformers import AutoTokenizer, AutoModelForCausalLM from transformers import LlamaTokenizer, MixtralForCausalLM import bitsandbytes, flash_attn tokenizer = LlamaTokenizer.from_pretrained('NousResearch/Nous-Hermes-2-Mixtral-8x7B-DPO', trust_remote_code=True) model = MixtralForCausalLM.from_pretrained( "NousResearch/Nous-Hermes-2-Mixtral-8x7B-DPO", torch_dtype=torch.float16, device_map="auto", load_in_8bit=False, load_in_4bit=True, use_flash_attention_2=True ) prompts = [ """<|im_start|>system You are a sentient, superintelligent artificial general intelligence, here to teach and assist me.<|im_end|> <|im_start|>user Write a short story about Goku discovering kirby has teamed up with Majin Buu to destroy the world.<|im_end|> <|im_start|>assistant""", ] for chat in prompts: print(chat) input_ids = tokenizer(chat, return_tensors="pt").input_ids.to("cuda") generated_ids = model.generate(input_ids, max_new_tokens=750, temperature=0.8, repetition_penalty=1.1, do_sample=True, eos_token_id=tokenizer.eos_token_id) response = tokenizer.decode(generated_ids[0][input_ids.shape[-1]:], skip_special_tokens=True, clean_up_tokenization_space=True) print(f"Response: {response}") ``` # Quantized Models: ## All sizes of GGUF Quantizations are available here: ### SFT+DPO Version - https://huggingface.co/NousResearch/Nous-Hermes-2-Mixtral-8x7B-DPO-GGUF ### SFT Only Version - https://huggingface.co/NousResearch/Nous-Hermes-2-Mixtral-8x7B-SFT-GGUF (Note: If you have issues with these GGUF's try TheBloke's) ## TheBloke has also quantized Hermes Mixtral in various forms: ### SFT+DPO GGUF: https://huggingface.co/TheBloke/Nous-Hermes-2-Mixtral-8x7B-DPO-GGUF ### SFT GGUF: https://huggingface.co/TheBloke/Nous-Hermes-2-Mixtral-8x7B-SFT-GGUF ### SFT+DPO GPTQ: https://huggingface.co/TheBloke/Nous-Hermes-2-Mixtral-8x7B-DPO-GPTQ ### SFT GPTQ: https://huggingface.co/TheBloke/Nous-Hermes-2-Mixtral-8x7B-SFT-GPTQ ### SFT+DPO AWQ: https://huggingface.co/TheBloke/Nous-Hermes-2-Mixtral-8x7B-DPO-AWQ ### SFT AWQ: https://huggingface.co/TheBloke/Nous-Hermes-2-Mixtral-8x7B-SFT-AWQ ## There is also an MLX version available: ### https://huggingface.co/mlx-community/Nous-Hermes-2-Mixtral-8x7B-DPO-4bit ## Exllama2 quants available here: ### https://huggingface.co/qeternity/Nous-Hermes-2-Mixtral-8x7B-SFT-4bpw-h6-exl2 (other sizes available in Qeternity's repos) [<img src="https://raw.githubusercontent.com/OpenAccess-AI-Collective/axolotl/main/image/axolotl-badge-web.png" alt="Built with Axolotl" width="200" height="32"/>](https://github.com/OpenAccess-AI-Collective/axolotl) ```bibtext @misc{Nous-Hermes-2-Mixtral-8x7B-DPO, url={[https://huggingface.co/NousResearch/Nous-Hermes-2-Mixtral-8x7B-DPO](https://huggingface.co/NousResearch/Nous-Hermes-2-Mixtral-8x7B-DPO)}, title={Nous Hermes 2 Mixtral 8x7B DPO}, author={"Teknium", "theemozilla", "karan4d", "huemin_art"} } ```

01-ai/Yi-1.5-34B-Chat

01-ai

transformers

text-generation

--- license: apache-2.0 --- <div align="center"> <picture> <img src="https://raw.githubusercontent.com/01-ai/Yi/main/assets/img/Yi_logo_icon_light.svg" width="150px"> </picture> </div> <p align="center"> <a href="https://github.com/01-ai">🐙 GitHub</a> • <a href="https://discord.gg/hYUwWddeAu">👾 Discord</a> • <a href="https://twitter.com/01ai_yi">🐤 Twitter</a> • <a href="https://github.com/01-ai/Yi-1.5/issues/2">💬 WeChat</a> <br/> <a href="https://arxiv.org/abs/2403.04652">📝 Paper</a> • <a href="https://01-ai.github.io/">💪 Tech Blog</a> • <a href="https://github.com/01-ai/Yi/tree/main?tab=readme-ov-file#faq">🙌 FAQ</a> • <a href="https://github.com/01-ai/Yi/tree/main?tab=readme-ov-file#learning-hub">📗 Learning Hub</a> </p> # Intro Yi-1.5 is an upgraded version of Yi. It is continuously pre-trained on Yi with a high-quality corpus of 500B tokens and fine-tuned on 3M diverse fine-tuning samples. Compared with Yi, Yi-1.5 delivers stronger performance in coding, math, reasoning, and instruction-following capability, while still maintaining excellent capabilities in language understanding, commonsense reasoning, and reading comprehension. <div align="center"> Model | Context Length | Pre-trained Tokens | :------------: | :------------: | :------------: | | Yi-1.5 | 4K, 16K, 32K | 3.6T </div> # Models - Chat models <div align="center"> | Name | Download | | --------------- | ------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | Yi-1.5-34B-Chat | • [🤗 Hugging Face](https://huggingface.co/collections/01-ai/yi-15-2024-05-663f3ecab5f815a3eaca7ca8) • [🤖 ModelScope](https://www.modelscope.cn/organization/01ai) • [🟣 wisemodel](https://wisemodel.cn/organization/01.AI)| | Yi-1.5-34B-Chat-16K | • [🤗 Hugging Face](https://huggingface.co/collections/01-ai/yi-15-2024-05-663f3ecab5f815a3eaca7ca8) • [🤖 ModelScope](https://www.modelscope.cn/organization/01ai) • [🟣 wisemodel](https://wisemodel.cn/organization/01.AI) | | Yi-1.5-9B-Chat | • [🤗 Hugging Face](https://huggingface.co/collections/01-ai/yi-15-2024-05-663f3ecab5f815a3eaca7ca8) • [🤖 ModelScope](https://www.modelscope.cn/organization/01ai) • [🟣 wisemodel](https://wisemodel.cn/organization/01.AI) | | Yi-1.5-9B-Chat-16K | • [🤗 Hugging Face](https://huggingface.co/collections/01-ai/yi-15-2024-05-663f3ecab5f815a3eaca7ca8) • [🤖 ModelScope](https://www.modelscope.cn/organization/01ai) • [🟣 wisemodel](https://wisemodel.cn/organization/01.AI) | | Yi-1.5-6B-Chat | • [🤗 Hugging Face](https://huggingface.co/collections/01-ai/yi-15-2024-05-663f3ecab5f815a3eaca7ca8) • [🤖 ModelScope](https://www.modelscope.cn/organization/01ai) • [🟣 wisemodel](https://wisemodel.cn/organization/01.AI) | </div> - Base models <div align="center"> | Name | Download | | ---------- | ------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | Yi-1.5-34B | • [🤗 Hugging Face](https://huggingface.co/collections/01-ai/yi-15-2024-05-663f3ecab5f815a3eaca7ca8) • [🤖 ModelScope](https://www.modelscope.cn/organization/01ai) • [🟣 wisemodel](https://wisemodel.cn/organization/01.AI) | | Yi-1.5-34B-32K | • [🤗 Hugging Face](https://huggingface.co/collections/01-ai/yi-15-2024-05-663f3ecab5f815a3eaca7ca8) • [🤖 ModelScope](https://www.modelscope.cn/organization/01ai) • [🟣 wisemodel](https://wisemodel.cn/organization/01.AI) | | Yi-1.5-9B | • [🤗 Hugging Face](https://huggingface.co/collections/01-ai/yi-15-2024-05-663f3ecab5f815a3eaca7ca8) • [🤖 ModelScope](https://www.modelscope.cn/organization/01ai) • [🟣 wisemodel](https://wisemodel.cn/organization/01.AI) | | Yi-1.5-9B-32K | • [🤗 Hugging Face](https://huggingface.co/collections/01-ai/yi-15-2024-05-663f3ecab5f815a3eaca7ca8) • [🤖 ModelScope](https://www.modelscope.cn/organization/01ai) • [🟣 wisemodel](https://wisemodel.cn/organization/01.AI) | | Yi-1.5-6B | • [🤗 Hugging Face](https://huggingface.co/collections/01-ai/yi-15-2024-05-663f3ecab5f815a3eaca7ca8) • [🤖 ModelScope](https://www.modelscope.cn/organization/01ai) • [🟣 wisemodel](https://wisemodel.cn/organization/01.AI) | </div> # Benchmarks - Chat models Yi-1.5-34B-Chat is on par with or excels beyond larger models in most benchmarks.  Yi-1.5-9B-Chat is the top performer among similarly sized open-source models.  - Base models Yi-1.5-34B is on par with or excels beyond larger models in some benchmarks.  Yi-1.5-9B is the top performer among similarly sized open-source models.  # Quick Start For getting up and running with Yi-1.5 models quickly, see [README](https://github.com/01-ai/Yi-1.5).

fluently/Fluently-XL-v4

fluently

diffusers

text-to-image

--- license: other license_name: fluently-license license_link: https://huggingface.co/spaces/fluently/License datasets: - ehristoforu/midjourney-images - ehristoforu/dalle-3-images - ehristoforu/fav_images library_name: diffusers pipeline_tag: text-to-image base_model: stabilityai/stable-diffusion-xl-base-1.0 tags: - safetensors - stable-diffusion - sdxl - fluetnly-xl - fluently - trained inference: parameters: num_inference_steps: 25 guidance_scale: 5 negative_prompt: "(deformed, distorted, disfigured:1.3), poorly drawn, bad anatomy, wrong anatomy, extra limb, missing limb, floating limbs, (mutated hands and fingers:1.4), disconnected limbs, mutation, mutated, ugly, disgusting, blurry, amputation" --- # **Fluently XL** V4 - the best XL-model (4th place in the [imgsys.org](https://imgsys.org/rankings) arena)  Introducing Fluently XL, you are probably ready to argue with the name of the model: “The best XL-model”, but now I will prove to you why it is true. ## About this model The model was obtained through training on *expensive graphics accelerators*, a lot of work was done, now we will show why this XL model is better than others. ### Features - Correct anatomy - Art and realism in one - Controling contrast - Great nature - Great faces without AfterDetailer ### More info Our model is better than others because we do not mix but **train**, but at first it may seem that the model is not very good, but if you are a real professional you will like it. ## Using Optimal parameters in Automatic1111/ComfyUI: - Sampling steps: 20-35 - Sampler method: Euler a/Euler - CFG Scale: 4-6.5 ## End Let's remove models that copy each other from the top and put one that is actually developing, thank you)

qwp4w3hyb/gemma-2-9b-it-iMat-GGUF

qwp4w3hyb

text-generation

--- license: gemma language: - en pipeline_tag: text-generation tags: - google - gemma - gguf - imatrix base_model: google/gemma-2-9b-it --- # Quant Infos ## Updated for all recent llama.cpp fixes (final logit soft capping+sliding window+tokenizer) - quants done with an importance matrix for improved quantization loss - Requantized ggufs & imatrix from hf bf16 - initial version was based on f32 gguf provided by google, which had various issues - also updated for all recent llama.cpp fixes (final logit soft capping+sliding window+tokenizer) - Wide coverage of different gguf quant types from Q\_8\_0 down to IQ1\_S - experimental custom quant types - `_L` with `--output-tensor-type f16 --token-embedding-type f16` (same as bartowski's) - Quantized with [llama.cpp](https://github.com/ggerganov/llama.cpp) commit [5fac350b9cc49d0446fc291b9c4ad53666c77591](https://github.com/ggerganov/llama.cpp/commit/5fac350b9cc49d0446fc291b9c4ad53666c77591) (master from 2024-07-02) - Imatrix generated with [this](https://gist.github.com/bartowski1182/eb213dccb3571f863da82e99418f81e8) multi-purpose dataset by [bartowski](https://huggingface.co/bartowski). ``` ./imatrix -m $model_name-bf16.gguf -f calibration_datav3.txt -o $model_name.imatrix ``` # Original Model Card TODO

qwp4w3hyb/DeepSeek-Coder-V2-Instruct-iMat-GGUF

qwp4w3hyb

--- license: other license_name: deepseek-license license_link: LICENSE base_model: deepseek-ai/DeepSeek-Coder-V2-Instruct --- # Quant Infos - quants done with an importance matrix for improved quantization loss - ggufs & imatrix generated from bf16 for "optimal" accuracy loss - Wide coverage of different gguf quant types from Q\_8\_0 down to IQ1\_S - Quantized with [llama.cpp](https://github.com/ggerganov/llama.cpp) commit [d62e4aaa02540c89be8b59426340b909d02bbc9e](https://github.com/ggerganov/llama.cpp/commit/d62e4aaa02540c89be8b59426340b909d02bbc9e) (master as of 2024-06-24) - Imatrix generated with [this](https://gist.github.com/bartowski1182/eb213dccb3571f863da82e99418f81e8) multi-purpose dataset by [bartowski](https://huggingface.co/bartowski). ``` ./imatrix -c 512 -m $model_name-bf16.gguf -f calibration_datav3.txt -o $model_name.imatrix ``` # Original Model Card: <!-- markdownlint-disable first-line-h1 --> <!-- markdownlint-disable html --> <!-- markdownlint-disable no-duplicate-header --> <div align="center"> <img src="https://github.com/deepseek-ai/DeepSeek-V2/blob/main/figures/logo.svg?raw=true" width="60%" alt="DeepSeek-V2" /> </div> <hr> <div align="center" style="line-height: 1;"> <a href="https://www.deepseek.com/" target="_blank" style="margin: 2px;"> <img alt="Homepage" src="https://github.com/deepseek-ai/DeepSeek-V2/blob/main/figures/badge.svg?raw=true" style="display: inline-block; vertical-align: middle;"/> </a> <a href="https://chat.deepseek.com/" target="_blank" style="margin: 2px;"> <img alt="Chat" src="https://img.shields.io/badge/🤖%20Chat-DeepSeek%20V2-536af5?color=536af5&logoColor=white" style="display: inline-block; vertical-align: middle;"/> </a> <a href="https://huggingface.co/deepseek-ai" target="_blank" style="margin: 2px;"> <img alt="Hugging Face" src="https://img.shields.io/badge/%F0%9F%A4%97%20Hugging%20Face-DeepSeek%20AI-ffc107?color=ffc107&logoColor=white" style="display: inline-block; vertical-align: middle;"/> </a> </div> <div align="center" style="line-height: 1;"> <a href="https://discord.gg/Tc7c45Zzu5" target="_blank" style="margin: 2px;"> <img alt="Discord" src="https://img.shields.io/badge/Discord-DeepSeek%20AI-7289da?logo=discord&logoColor=white&color=7289da" style="display: inline-block; vertical-align: middle;"/> </a> <a href="https://github.com/deepseek-ai/DeepSeek-V2/blob/main/figures/qr.jpeg?raw=true" target="_blank" style="margin: 2px;"> <img alt="Wechat" src="https://img.shields.io/badge/WeChat-DeepSeek%20AI-brightgreen?logo=wechat&logoColor=white" style="display: inline-block; vertical-align: middle;"/> </a> <a href="https://twitter.com/deepseek_ai" target="_blank" style="margin: 2px;"> <img alt="Twitter Follow" src="https://img.shields.io/badge/Twitter-deepseek_ai-white?logo=x&logoColor=white" style="display: inline-block; vertical-align: middle;"/> </a> </div> <div align="center" style="line-height: 1;"> <a href="https://github.com/deepseek-ai/DeepSeek-V2/blob/main/LICENSE-CODE" style="margin: 2px;"> <img alt="Code License" src="https://img.shields.io/badge/Code_License-MIT-f5de53?&color=f5de53" style="display: inline-block; vertical-align: middle;"/> </a> <a href="https://github.com/deepseek-ai/DeepSeek-V2/blob/main/LICENSE-MODEL" style="margin: 2px;"> <img alt="Model License" src="https://img.shields.io/badge/Model_License-Model_Agreement-f5de53?&color=f5de53" style="display: inline-block; vertical-align: middle;"/> </a> </div> <p align="center"> <a href="#4-api-platform">API Platform</a> | <a href="#5-how-to-run-locally">How to Use</a> | <a href="#6-license">License</a> | </p> <p align="center"> <a href="https://github.com/deepseek-ai/DeepSeek-Coder-V2/blob/main/paper.pdf"><b>Paper Link</b>👁️</a> </p> # DeepSeek-Coder-V2: Breaking the Barrier of Closed-Source Models in Code Intelligence ## 1. Introduction We present DeepSeek-Coder-V2, an open-source Mixture-of-Experts (MoE) code language model that achieves performance comparable to GPT4-Turbo in code-specific tasks. Specifically, DeepSeek-Coder-V2 is further pre-trained from an intermediate checkpoint of DeepSeek-V2 with additional 6 trillion tokens. Through this continued pre-training, DeepSeek-Coder-V2 substantially enhances the coding and mathematical reasoning capabilities of DeepSeek-V2, while maintaining comparable performance in general language tasks. Compared to DeepSeek-Coder-33B, DeepSeek-Coder-V2 demonstrates significant advancements in various aspects of code-related tasks, as well as reasoning and general capabilities. Additionally, DeepSeek-Coder-V2 expands its support for programming languages from 86 to 338, while extending the context length from 16K to 128K. <p align="center"> <img width="100%" src="https://github.com/deepseek-ai/DeepSeek-Coder-V2/blob/main/figures/performance.png?raw=true"> </p> In standard benchmark evaluations, DeepSeek-Coder-V2 achieves superior performance compared to closed-source models such as GPT4-Turbo, Claude 3 Opus, and Gemini 1.5 Pro in coding and math benchmarks. The list of supported programming languages can be found [here](https://github.com/deepseek-ai/DeepSeek-Coder-V2/blob/main/supported_langs.txt). ## 2. Model Downloads We release the DeepSeek-Coder-V2 with 16B and 236B parameters based on the [DeepSeekMoE](https://arxiv.org/pdf/2401.06066) framework, which has actived parameters of only 2.4B and 21B , including base and instruct models, to the public. <div align="center"> | **Model** | **#Total Params** | **#Active Params** | **Context Length** | **Download** | | :-----------------------------: | :---------------: | :----------------: | :----------------: | :----------------------------------------------------------: | | DeepSeek-Coder-V2-Lite-Base | 16B | 2.4B | 128k | [🤗 HuggingFace](https://huggingface.co/deepseek-ai/DeepSeek-Coder-V2-Lite-Base) | | DeepSeek-Coder-V2-Lite-Instruct | 16B | 2.4B | 128k | [🤗 HuggingFace](https://huggingface.co/deepseek-ai/DeepSeek-Coder-V2-Lite-Instruct) | | DeepSeek-Coder-V2-Base | 236B | 21B | 128k | [🤗 HuggingFace](https://huggingface.co/deepseek-ai/DeepSeek-Coder-V2-Base) | | DeepSeek-Coder-V2-Instruct | 236B | 21B | 128k | [🤗 HuggingFace](https://huggingface.co/deepseek-ai/DeepSeek-Coder-V2-Instruct) | </div> ## 3. Chat Website You can chat with the DeepSeek-Coder-V2 on DeepSeek's official website: [coder.deepseek.com](https://coder.deepseek.com/sign_in) ## 4. API Platform We also provide OpenAI-Compatible API at DeepSeek Platform: [platform.deepseek.com](https://platform.deepseek.com/), and you can also pay-as-you-go at an unbeatable price. <p align="center"> <img width="40%" src="https://github.com/deepseek-ai/DeepSeek-Coder-V2/blob/main/figures/model_price.jpg?raw=true"> </p> ## 5. How to run locally **Here, we provide some examples of how to use DeepSeek-Coder-V2-Lite model. If you want to utilize DeepSeek-Coder-V2 in BF16 format for inference, 80GB*8 GPUs are required.** ### Inference with Huggingface's Transformers You can directly employ [Huggingface's Transformers](https://github.com/huggingface/transformers) for model inference. #### Code Completion ```python from transformers import AutoTokenizer, AutoModelForCausalLM import torch tokenizer = AutoTokenizer.from_pretrained("deepseek-ai/DeepSeek-Coder-V2-Lite-Base", trust_remote_code=True) model = AutoModelForCausalLM.from_pretrained("deepseek-ai/DeepSeek-Coder-V2-Lite-Base", trust_remote_code=True, torch_dtype=torch.bfloat16).cuda() input_text = "#write a quick sort algorithm" inputs = tokenizer(input_text, return_tensors="pt").to(model.device) outputs = model.generate(**inputs, max_length=128) print(tokenizer.decode(outputs[0], skip_special_tokens=True)) ``` #### Code Insertion ```python from transformers import AutoTokenizer, AutoModelForCausalLM import torch tokenizer = AutoTokenizer.from_pretrained("deepseek-ai/DeepSeek-Coder-V2-Lite-Base", trust_remote_code=True) model = AutoModelForCausalLM.from_pretrained("deepseek-ai/DeepSeek-Coder-V2-Lite-Base", trust_remote_code=True, torch_dtype=torch.bfloat16).cuda() input_text = """<｜fim▁begin｜>def quick_sort(arr): if len(arr) <= 1: return arr pivot = arr[0] left = [] right = [] <｜fim▁hole｜> if arr[i] < pivot: left.append(arr[i]) else: right.append(arr[i]) return quick_sort(left) + [pivot] + quick_sort(right)<｜fim▁end｜>""" inputs = tokenizer(input_text, return_tensors="pt").to(model.device) outputs = model.generate(**inputs, max_length=128) print(tokenizer.decode(outputs[0], skip_special_tokens=True)[len(input_text):]) ``` #### Chat Completion ```python from transformers import AutoTokenizer, AutoModelForCausalLM import torch tokenizer = AutoTokenizer.from_pretrained("deepseek-ai/DeepSeek-Coder-V2-Lite-Instruct", trust_remote_code=True) model = AutoModelForCausalLM.from_pretrained("deepseek-ai/DeepSeek-Coder-V2-Lite-Instruct", trust_remote_code=True, torch_dtype=torch.bfloat16).cuda() messages=[ { 'role': 'user', 'content': "write a quick sort algorithm in python."} ] inputs = tokenizer.apply_chat_template(messages, add_generation_prompt=True, return_tensors="pt").to(model.device) # tokenizer.eos_token_id is the id of <|EOT|> token outputs = model.generate(inputs, max_new_tokens=512, do_sample=False, top_k=50, top_p=0.95, num_return_sequences=1, eos_token_id=tokenizer.eos_token_id) print(tokenizer.decode(outputs[0][len(inputs[0]):], skip_special_tokens=True)) ``` The complete chat template can be found within `tokenizer_config.json` located in the huggingface model repository. An example of chat template is as belows: ```bash <｜begin▁of▁sentence｜>User: {user_message_1} Assistant: {assistant_message_1}<｜end▁of▁sentence｜>User: {user_message_2} Assistant: ``` You can also add an optional system message: ```bash <｜begin▁of▁sentence｜>{system_message} User: {user_message_1} Assistant: {assistant_message_1}<｜end▁of▁sentence｜>User: {user_message_2} Assistant: ``` ### Inference with vLLM (recommended) To utilize [vLLM](https://github.com/vllm-project/vllm) for model inference, please merge this Pull Request into your vLLM codebase: https://github.com/vllm-project/vllm/pull/4650. ```python from transformers import AutoTokenizer from vllm import LLM, SamplingParams max_model_len, tp_size = 8192, 1 model_name = "deepseek-ai/DeepSeek-Coder-V2-Lite-Instruct" tokenizer = AutoTokenizer.from_pretrained(model_name) llm = LLM(model=model_name, tensor_parallel_size=tp_size, max_model_len=max_model_len, trust_remote_code=True, enforce_eager=True) sampling_params = SamplingParams(temperature=0.3, max_tokens=256, stop_token_ids=[tokenizer.eos_token_id]) messages_list = [ [{"role": "user", "content": "Who are you?"}], [{"role": "user", "content": "write a quick sort algorithm in python."}], [{"role": "user", "content": "Write a piece of quicksort code in C++."}], ] prompt_token_ids = [tokenizer.apply_chat_template(messages, add_generation_prompt=True) for messages in messages_list] outputs = llm.generate(prompt_token_ids=prompt_token_ids, sampling_params=sampling_params) generated_text = [output.outputs[0].text for output in outputs] print(generated_text) ``` ## 6. License This code repository is licensed under [the MIT License](https://github.com/deepseek-ai/DeepSeek-Coder-V2/blob/main/LICENSE-CODE). The use of DeepSeek-Coder-V2 Base/Instruct models is subject to [the Model License](https://github.com/deepseek-ai/DeepSeek-Coder-V2/blob/main/LICENSE-MODEL). DeepSeek-Coder-V2 series (including Base and Instruct) supports commercial use. ## 7. Contact If you have any questions, please raise an issue or contact us at [service@deepseek.com](service@deepseek.com).