description
stringlengths
0
8.24k
regex
stringlengths
1
26.3k
text
stringlengths
0
2.47M
title
stringlengths
1
150
created_at
stringlengths
24
24
он весь день мучался над четырьмя символами
(^.+\/)([^\.]+)\.([^\.]+)
upload/resize_cache/iblock/daa/455_475_075511db9cefbc414a902a46f1b8fae16/5_wIdyXJL7A.jpg
чуваку с ответов
2014-07-15T17:18:34.000Z
Find the ID/name of facebook users/pages in widgets, or links.
href=".[^"]*facebook\.com\/(.[^"]*)
<div class="fb-page" data-href="https://www.facebook.com/dreamsportingtrips" data-tabs="timeline" data-small-header="false" data-adapt-container-width="true" data-hide-cover="false" data-show-facepile="true"><div class="fb-xfbml-parse-ignore"><blockquote cite="https://www.facebook.com/dreamsportingtrips"><a href="https://www.facebook.com/dreamsportingtrips">Dream Sporting Trips</a></blockquote></div></div> <p>This works for links to facebook on images, or facebook widgets, etc</p>
Facebook ID in Links or Widgets
2015-12-30T03:21:17.000Z
^(\d+\.\d+)$
These 111.111 Not these 111..110....11 11.11.11.11
one deccmal point
2015-07-29T05:25:43.000Z
Div Matching Test
<div class="podEventRow[^>]+>(\s*<div class="[^>]+>\s*(<span[^>]+>|</span>|</?em>|[\s0-9/,.+-]+)+[^<]*</div>\s*)+</div>
<div class="podEventRow singleRow" data-plbtid="50139"> <div class="wideLeftColumn centered"><em>4.0, 4.5</em></div> <div class="priceColumn third " data-nav="pt=N#o=27/5#f=54849113#fp=962365111#so=0#c=1#ln=4.25" data-displayorder="27">6.400</div> <div class="priceColumn third " data-nav="pt=N#o=23/200#f=54849113#fp=962365112#so=0#c=1#ln=4.25" data-displayorder="28">1.115</div> </div>
Div Matching Test
2016-03-31T13:48:30.000Z
Stockfish output contains longer form containing the square of departure. **Buggy with anything other than pawn.**
^info depth (\d*) seldepth (\d*) .* pv (....) (....).*$
Stockfish 260322 by the Stockfish developers (see AUTHORS file) id name Stockfish 260322 id author the Stockfish developers (see AUTHORS file) option name Debug Log File type string default option name Threads type spin default 1 min 1 max 512 option name Hash type spin default 16 min 1 max 33554432 option name Clear Hash type button option name Ponder type check default false option name MultiPV type spin default 1 min 1 max 500 option name Skill Level type spin default 20 min 0 max 20 option name Move Overhead type spin default 10 min 0 max 5000 option name Slow Mover type spin default 100 min 10 max 1000 option name nodestime type spin default 0 min 0 max 10000 option name UCI_Chess960 type check default false option name UCI_AnalyseMode type check default false option name UCI_LimitStrength type check default false option name UCI_Elo type spin default 1350 min 1350 max 2850 option name UCI_ShowWDL type check default false option name SyzygyPath type string default <empty> option name SyzygyProbeDepth type spin default 1 min 1 max 100 option name Syzygy50MoveRule type check default true option name SyzygyProbeLimit type spin default 7 min 0 max 7 option name Use NNUE type check default true option name EvalFile type string default nn-6877cd24400e.nnue uciok info string NNUE evaluation using nn-6877cd24400e.nnue enabled info depth 1 seldepth 1 multipv 1 score cp 33 nodes 61 nps 30500 tbhits 0 time 2 pv e2e4 info depth 2 seldepth 2 multipv 1 score cp 94 nodes 135 nps 67500 tbhits 0 time 2 pv e2e4 a7a6 info depth 3 seldepth 3 multipv 1 score cp 40 nodes 616 nps 154000 tbhits 0 time 4 pv c2c4 a7a6 e2e4 info depth 4 seldepth 4 multipv 1 score cp 66 nodes 1702 nps 243142 tbhits 0 time 7 pv e2e4 d7d5 e4d5 info depth 5 seldepth 5 multipv 1 score cp 50 nodes 5888 nps 490666 tbhits 0 time 12 pv e2e4 d7d5 e4d5 d8d5 d2d4 info depth 6 seldepth 6 multipv 1 score cp 48 nodes 7583 nps 541642 tbhits 0 time 14 pv d2d4 c7c6 c2c4 g8f6 g1f3 e7e6 info depth 7 seldepth 7 multipv 1 score cp 42 nodes 13961 nps 734789 tbhits 0 time 19 pv c2c4 e7e6 d2d4 d7d5 b1c3 f8b4 c4d5 info depth 8 seldepth 13 multipv 1 score cp 57 nodes 25599 nps 914250 tbhits 0 time 28 pv e2e4 e7e6 b1c3 d7d5 d2d4 g8f6 e4e5 info depth 9 seldepth 12 multipv 1 score cp 58 nodes 39636 nps 1016307 tbhits 0 time 39 pv e2e4 e7e6 b1c3 d7d5 d2d4 f8b4 e4e5 c7c5 a2a3 b4c3 b2c3 info depth 10 seldepth 14 multipv 1 score cp 44 nodes 82932 nps 1168056 tbhits 0 time 71 pv e2e4 c7c5 g1f3 b8c6 d2d4 c5d4 f3d4 e7e6 b1c3 d7d6 f1e2 c8d7 e1g1 info depth 11 seldepth 16 multipv 1 score cp 61 nodes 172214 nps 1238949 tbhits 0 time 139 pv e2e4 c7c5 c2c3 b8c6 d2d4 d7d5 e4d5 d8d5 g1f3 info depth 12 seldepth 17 multipv 1 score cp 50 nodes 225430 nps 1259385 tbhits 0 time 179 pv e2e4 c7c5 c2c3 d7d5 e4d5 g8f6 g1f3 f6d5 g2g3 e7e6 f1g2 f8e7 e1g1 b8c6 d2d4 c5d4 info depth 13 seldepth 18 multipv 1 score cp 44 nodes 244420 nps 1266424 tbhits 0 time 193 pv e2e4 c7c5 c2c3 d7d5 e4d5 g8f6 f1b5 b8d7 g1f3 a7a6 b5e2 f6d5 e1g1 info depth 14 seldepth 19 multipv 1 score cp 39 nodes 421380 nps 1284695 tbhits 0 time 328 pv e2e4 c7c5 g1f3 e7e6 c2c3 d7d5 e4d5 d8d5 d2d4 g8f6 f1d3 c5d4 c3d4 d5d6 b1c3 f8e7 e1g1 b8c6 g1h1 info depth 15 seldepth 20 multipv 1 score cp 42 nodes 632326 nps 1311879 tbhits 0 time 482 pv e2e4 c7c5 g1f3 e7e6 d2d4 c5d4 f3d4 b8c6 b1c3 a7a6 g2g3 d8c7 f1g2 g8f6 e1g1 info depth 16 seldepth 22 multipv 1 score cp 47 nodes 683828 nps 1307510 tbhits 0 time 523 pv e2e4 c7c5 g1f3 d7d6 d2d4 c5d4 f3d4 g8f6 b1c3 b8c6 f2f3 e7e5 d4b3 f8e7 c1e3 e8g8 c3d5 f6d5 e4d5 c6a5 c2c3 c8f5 info depth 17 seldepth 29 multipv 1 score cp 54 nodes 1102665 nps 1309578 tbhits 0 time 842 pv e2e4 c7c5 g1f3 e7e6 d2d4 c5d4 f3d4 b8c6 b1c3 d8c7 c1e3 a7a6 d1f3 b7b5 f3g3 d7d6 d4c6 c7c6 a2a3 g8f6 f1d3 info depth 18 seldepth 23 multipv 1 score cp 53 nodes 1202283 nps 1312536 tbhits 0 time 916 pv e2e4 c7c5 g1f3 e7e6 d2d4 c5d4 f3d4 b8c6 b1c3 d8c7 c1e3 a7a6 d1f3 g8f6 e1c1 c6d4 e3d4 b7b5 g2g4 h7h6 f3g3 c7g3 h2g3 info depth 19 seldepth 30 multipv 1 score cp 46 nodes 2175429 nps 1287236 hashfull 703 tbhits 0 time 1690 pv e2e4 c7c5 g1f3 e7e6 d2d4 c5d4 f3d4 b8c6 b1c3 d8c7 c1e3 a7a6 d1f3 g8f6 d4c6 d7c6 f1e2 e6e5 f3g3 h7h5 f2f3 info depth 20 seldepth 28 multipv 1 score cp 45 nodes 2854524 nps 1262505 hashfull 823 tbhits 0 time 2261 pv e2e4 c7c6 d2d4 d7d5 e4e5 c8f5 b1d2 e7e6 d2b3 d8c7 g1f3 b8d7 c2c3 f7f6 f1d3 f5g4 c1f4 f6e5 d4e5 g7g5 f4g3 g4f3 g2f3 d7e5 info depth 21 seldepth 30 multipv 1 score cp 51 nodes 3656947 nps 1236290 hashfull 908 tbhits 0 time 2958 pv e2e4 c7c6 d2d4 d7d5 e4e5 c8f5 b1d2 e7e6 d2b3 b8d7 g1f3 g8e7 a2a4 a7a5 c2c3 e7g6 h2h4 h7h5 g2g3 d8b6 f1e2 f5g4 e1g1 g6e7 f1e1 e7f5 info depth 22 currmove c2c4 currmovenumber 2 info depth 22 currmove d2d4 currmovenumber 3 info depth 22 currmove g1f3 currmovenumber 4 info depth 22 currmove c2c3 currmovenumber 5 info depth 22 currmove f2f3 currmovenumber 6 info depth 22 currmove b1c3 currmovenumber 7 info depth 22 currmove e2e3 currmovenumber 8 info depth 22 currmove h2h4 currmovenumber 9 info depth 22 currmove g2g4 currmovenumber 10 info depth 22 currmove d2d3 currmovenumber 11 info depth 22 currmove g2g3 currmovenumber 12 info depth 22 currmove h2h3 currmovenumber 13 info depth 22 currmove a2a3 currmovenumber 14 info depth 22 currmove b2b3 currmovenumber 15 info depth 22 currmove a2a4 currmovenumber 16 info depth 22 currmove b2b4 currmovenumber 17 info depth 22 currmove f2f4 currmovenumber 18 info depth 22 currmove b1a3 currmovenumber 19 info depth 22 currmove g1h3 currmovenumber 20 info depth 22 seldepth 33 multipv 1 score cp 41 upperbound nodes 4232426 nps 1228214 hashfull 942 tbhits 0 time 3446 pv e2e4 c7c6 info depth 22 currmove e2e4 currmovenumber 1 info depth 22 currmove c2c4 currmovenumber 2 info depth 22 currmove d2d4 currmovenumber 3 info depth 22 currmove g1f3 currmovenumber 4 info depth 22 currmove b1c3 currmovenumber 5 info depth 22 currmove c2c3 currmovenumber 6 info depth 22 currmove d2d3 currmovenumber 7 info depth 22 currmove a2a3 currmovenumber 8 info depth 22 currmove g2g4 currmovenumber 9 info depth 22 currmove f2f4 currmovenumber 10 info depth 22 currmove e2e3 currmovenumber 11 info depth 22 currmove a2a4 currmovenumber 12 info depth 22 currmove f2f3 currmovenumber 13 info depth 22 currmove b2b3 currmovenumber 14 info depth 22 currmove g2g3 currmovenumber 15 info depth 22 currmove h2h3 currmovenumber 16 info depth 22 currmove b2b4 currmovenumber 17 info depth 22 currmove h2h4 currmovenumber 18 info depth 22 currmove b1a3 currmovenumber 19 info depth 22 currmove g1h3 currmovenumber 20 info depth 22 seldepth 33 multipv 1 score cp 37 nodes 4687580 nps 1220406 hashfull 960 tbhits 0 time 3841 pv e2e4 c7c6 d2d4 d7d5 e4e5 c8f5 b1d2 e7e6 d2b3 b8d7 g1f3 c6c5 c2c4 g8e7 d4c5 f5e4 c4d5 e4d5 f1b5 a7a6 b5a4 e7c6 c1e3 f8e7 e1g1 e8g8 a4c6 d5c6 info depth 23 currmove e2e4 currmovenumber 1 info depth 23 currmove c2c4 currmovenumber 2 info depth 23 currmove d2d4 currmovenumber 3 info depth 23 currmove g1f3 currmovenumber 4 info depth 23 currmove a2a3 currmovenumber 5 info depth 23 currmove b1c3 currmovenumber 6 info depth 23 currmove c2c3 currmovenumber 7 info depth 23 currmove a2a4 currmovenumber 8 info depth 23 currmove h2h3 currmovenumber 9 info depth 23 currmove f2f4 currmovenumber 10 info depth 23 currmove e2e3 currmovenumber 11 info depth 23 currmove b2b4 currmovenumber 12 info depth 23 currmove d2d3 currmovenumber 13 info depth 23 currmove b1a3 currmovenumber 14 info depth 23 currmove f2f3 currmovenumber 15 info depth 23 currmove g2g4 currmovenumber 16 info depth 23 currmove b2b3 currmovenumber 17 info depth 23 currmove h2h4 currmovenumber 18 info depth 23 currmove g2g3 currmovenumber 19 info depth 23 currmove g1h3 currmovenumber 20 info depth 23 seldepth 27 multipv 1 score cp 37 nodes 5038628 nps 1211791 hashfull 974 tbhits 0 time 4158 pv e2e4 c7c6 d2d4 d7d5 b1c3 d5e4 c3e4 c8f5 e4g3 f5g6 g1f3 b8d7 h2h4 h7h6 h4h5 g6h7 f1d3 h7d3 d1d3 e7e6 c1f4 d8a5 f4d2 a5c7 e1c1 g8f6 g3e4 f6e4 d3e4 d7f6 info depth 24 currmove e2e4 currmovenumber 1 info depth 24 seldepth 36 multipv 1 score cp 45 lowerbound nodes 5618017 nps 1192025 hashfull 984 tbhits 0 time 4713 pv e2e4 info depth 23 currmove e2e4 currmovenumber 1 info depth 24 seldepth 36 multipv 1 score cp 52 lowerbound nodes 5944736 nps 1187759 hashfull 988 tbhits 0 time 5005 pv e2e4 info depth 22 currmove e2e4 currmovenumber 1 info depth 22 currmove c2c4 currmovenumber 2 info depth 22 currmove c2c3 currmovenumber 3 info depth 22 currmove d2d4 currmovenumber 4 info depth 22 currmove b1c3 currmovenumber 5 info depth 22 currmove g1f3 currmovenumber 6 info depth 22 currmove a2a3 currmovenumber 7 info depth 22 currmove d2d3 currmovenumber 8 info depth 22 currmove b1a3 currmovenumber 9 info depth 22 currmove h2h3 currmovenumber 10 info depth 22 currmove a2a4 currmovenumber 11 info depth 22 currmove e2e3 currmovenumber 12 info depth 22 currmove g2g4 currmovenumber 13 info depth 22 currmove g1h3 currmovenumber 14 info depth 22 currmove h2h4 currmovenumber 15 info depth 22 currmove g2g3 currmovenumber 16 info depth 22 currmove b2b3 currmovenumber 17 info depth 22 currmove f2f3 currmovenumber 18 info depth 22 currmove b2b4 currmovenumber 19 info depth 22 currmove f2f4 currmovenumber 20 info depth 24 seldepth 36 multipv 1 score cp 47 nodes 6582753 nps 1180762 hashfull 993 tbhits 0 time 5575 pv e2e4 c7c6 d2d4 d7d5 b1c3 d5e4 c3e4 c8f5 e4g3 f5g6 g1f3 b8d7 h2h4 h7h6 c1f4 g8f6 h4h5 g6h7 f1d3 f6d5 g3e2 d5f4 e2f4 d8c7 d3h7 c7f4 h7d3 f4c7 d1e2 e7e6 info depth 25 currmove e2e4 currmovenumber 1 info depth 25 currmove c2c4 currmovenumber 2 info depth 25 currmove g1f3 currmovenumber 3 info depth 25 currmove d2d4 currmovenumber 4 info depth 25 currmove e2e3 currmovenumber 5 info depth 25 currmove b1c3 currmovenumber 6 info depth 25 currmove c2c3 currmovenumber 7 info depth 25 currmove h2h3 currmovenumber 8 info depth 25 currmove b2b3 currmovenumber 9 info depth 25 currmove a2a3 currmovenumber 10 info depth 25 currmove d2d3 currmovenumber 11 info depth 25 currmove b1a3 currmovenumber 12 info depth 25 currmove f2f3 currmovenumber 13 info depth 25 currmove g2g3 currmovenumber 14 info depth 25 currmove a2a4 currmovenumber 15 info depth 25 currmove b2b4 currmovenumber 16 info depth 25 currmove f2f4 currmovenumber 17 info depth 25 currmove g2g4 currmovenumber 18 info depth 25 currmove h2h4 currmovenumber 19 info depth 25 currmove g1h3 currmovenumber 20 info depth 25 seldepth 37 multipv 1 score cp 49 nodes 8743711 nps 1133045 hashfull 999 tbhits 0 time 7717 pv e2e4 e7e6 d2d4 d7d5 b1c3 g8f6 e4e5 f6d7 f2f4 c7c5 c1e3 b8c6 g1f3 a7a6 a2a3 c5d4 f3d4 f8c5 d1d2 c6d4 e3d4 c5d4 d2d4 b7b5 e1c1 d8b6 d4b6 d7b6 info depth 26 currmove e2e4 currmovenumber 1 info depth 26 seldepth 36 multipv 1 score cp 56 lowerbound nodes 9781040 nps 1098622 hashfull 999 tbhits 0 time 8903 pv e2e4 info depth 25 currmove e2e4 currmovenumber 1 info depth 25 currmove c2c4 currmovenumber 2 info depth 25 currmove g1f3 currmovenumber 3 info depth 25 currmove d2d4 currmovenumber 4 info depth 25 currmove b1c3 currmovenumber 5 info depth 25 currmove c2c3 currmovenumber 6 info depth 25 currmove d2d3 currmovenumber 7 info depth 25 currmove h2h3 currmovenumber 8 info depth 25 currmove a2a3 currmovenumber 9 info depth 25 currmove a2a4 currmovenumber 10 info depth 25 currmove f2f4 currmovenumber 11 info depth 25 currmove f2f3 currmovenumber 12 info depth 25 currmove b1a3 currmovenumber 13 info depth 25 currmove g1h3 currmovenumber 14 info depth 25 currmove g2g3 currmovenumber 15 info depth 25 currmove b2b3 currmovenumber 16 info depth 25 currmove e2e3 currmovenumber 17 info depth 25 currmove b2b4 currmovenumber 18 info depth 25 currmove g2g4 currmovenumber 19 info depth 25 currmove h2h4 currmovenumber 20 info depth 26 seldepth 37 multipv 1 score cp 40 upperbound nodes 10685983 nps 1089072 hashfull 1000 tbhits 0 time 9812 pv e2e4 c7c6 info depth 26 currmove e2e4 currmovenumber 1 info depth 26 currmove c2c4 currmovenumber 2 info depth 26 currmove d2d4 currmovenumber 3 info depth 26 currmove b1c3 currmovenumber 4 info depth 26 currmove g1f3 currmovenumber 5 info depth 26 currmove c2c3 currmovenumber 6 info depth 26 currmove a2a3 currmovenumber 7 info depth 26 currmove e2e3 currmovenumber 8 info depth 26 currmove g2g3 currmovenumber 9 info depth 26 currmove g2g4 currmovenumber 10 info depth 26 currmove b2b4 currmovenumber 11 info depth 26 currmove d2d3 currmovenumber 12 info depth 26 currmove h2h3 currmovenumber 13 info depth 26 currmove f2f4 currmovenumber 14 info depth 26 currmove h2h4 currmovenumber 15 info depth 26 currmove b1a3 currmovenumber 16 info depth 26 currmove b2b3 currmovenumber 17 info depth 26 currmove f2f3 currmovenumber 18 info depth 26 currmove a2a4 currmovenumber 19 info depth 26 currmove g1h3 currmovenumber 20 info depth 26 seldepth 37 multipv 1 score cp 44 nodes 11153846 nps 1080275 hashfull 1000 tbhits 0 time 10325 pv e2e4 c7c6 b1c3 d7d5 d2d4 d5e4 c3e4 c8f5 e4g3 f5g6 h2h4 h7h6 g1f3 b8d7 h4h5 g6h7 f1d3 h7d3 d1d3 d8c7 c1d2 e7e6 e1c1 f8e7 c1b1 g8f6 g3e4 a8d8 info depth 27 currmove e2e4 currmovenumber 1 info depth 27 currmove c2c4 currmovenumber 2 info depth 27 currmove d2d4 currmovenumber 3 info depth 27 currmove b1c3 currmovenumber 4 info depth 27 currmove g1f3 currmovenumber 5 info depth 27 currmove c2c3 currmovenumber 6 info depth 27 currmove a2a3 currmovenumber 7 info depth 27 currmove h2h3 currmovenumber 8 info depth 27 currmove a2a4 currmovenumber 9 info depth 27 currmove b1a3 currmovenumber 10 info depth 27 currmove d2d3 currmovenumber 11 info depth 27 currmove f2f3 currmovenumber 12 info depth 27 currmove f2f4 currmovenumber 13 info depth 27 currmove g2g3 currmovenumber 14 info depth 27 currmove g1h3 currmovenumber 15 info depth 27 currmove b2b3 currmovenumber 16 info depth 27 currmove e2e3 currmovenumber 17 info depth 27 currmove b2b4 currmovenumber 18 info depth 27 currmove g2g4 currmovenumber 19 info depth 27 currmove h2h4 currmovenumber 20 info depth 27 seldepth 39 multipv 1 score cp 36 upperbound nodes 13040174 nps 1060953 hashfull 1000 tbhits 0 time 12291 pv e2e4 c7c6 info depth 27 currmove e2e4 currmovenumber 1 info depth 27 currmove c2c4 currmovenumber 2 info depth 27 currmove d2d4 currmovenumber 3 info depth 27 currmove g1f3 currmovenumber 4 info depth 27 currmove d2d3 currmovenumber 5 info depth 27 currmove b1c3 currmovenumber 6 info depth 27 currmove a2a3 currmovenumber 7 info depth 27 currmove e2e3 currmovenumber 8 info depth 27 currmove h2h3 currmovenumber 9 info depth 27 currmove g2g3 currmovenumber 10 info depth 27 currmove b2b3 currmovenumber 11 info depth 27 currmove c2c3 currmovenumber 12 info depth 27 currmove g2g4 currmovenumber 13 info depth 27 currmove b1a3 currmovenumber 14 info depth 27 currmove f2f3 currmovenumber 15 info depth 27 currmove a2a4 currmovenumber 16 info depth 27 currmove b2b4 currmovenumber 17 info depth 27 currmove f2f4 currmovenumber 18 info depth 27 currmove h2h4 currmovenumber 19 info depth 27 currmove g1h3 currmovenumber 20 info depth 27 seldepth 39 multipv 1 score cp 28 upperbound nodes 14051218 nps 1053235 hashfull 1000 tbhits 0 time 13341 pv e2e4 c7c6 info depth 27 currmove e2e4 currmovenumber 1 info depth 27 seldepth 39 multipv 1 score cp 36 lowerbound nodes 14688653 nps 1050840 hashfull 1000 tbhits 0 time 13978 pv e2e4 info depth 26 currmove e2e4 currmovenumber 1 info depth 26 currmove c2c4 currmovenumber 2 info depth 26 currmove d2d4 currmovenumber 3 info depth 26 currmove b1c3 currmovenumber 4 info depth 26 currmove g1f3 currmovenumber 5 info depth 26 currmove c2c3 currmovenumber 6 info depth 26 currmove f2f3 currmovenumber 7 info depth 26 currmove b1a3 currmovenumber 8 info depth 26 currmove g2g4 currmovenumber 9 info depth 26 currmove b2b4 currmovenumber 10 info depth 26 currmove h2h3 currmovenumber 11 info depth 26 currmove d2d3 currmovenumber 12 info depth 26 currmove a2a3 currmovenumber 13 info depth 26 currmove e2e3 currmovenumber 14 info depth 26 currmove h2h4 currmovenumber 15 info depth 26 currmove b2b3 currmovenumber 16 info depth 26 currmove g2g3 currmovenumber 17 info depth 26 currmove a2a4 currmovenumber 18 info depth 26 currmove f2f4 currmovenumber 19 info depth 26 currmove g1h3 currmovenumber 20 info depth 27 seldepth 39 multipv 1 score cp 45 nodes 15261303 nps 1051633 hashfull 1000 tbhits 0 time 14512 pv e2e4 c7c6 b1c3 d7d5 d2d4 d5e4 c3e4 c8f5 e4g3 f5g6 h2h4 h7h6 g1f3 b8d7 h4h5 g6h7 f1d3 h7d3 d1d3 e7e6 c1f4 d8a5 f4d2 a5c7 e1c1 f8e7 g3e4 a8d8 g2g4 g8f6 e4f6 d7f6 info depth 28 currmove e2e4 currmovenumber 1 info depth 28 seldepth 36 multipv 1 score cp 49 lowerbound nodes 17232727 nps 1036804 hashfull 1000 tbhits 0 time 16621 pv e2e4 info depth 27 currmove e2e4 currmovenumber 1 info depth 27 currmove c2c4 currmovenumber 2 info depth 27 currmove d2d4 currmovenumber 3 info depth 27 currmove b1c3 currmovenumber 4 info depth 27 currmove g1f3 currmovenumber 5 info depth 27 currmove c2c3 currmovenumber 6 info depth 27 currmove a2a3 currmovenumber 7 info depth 27 currmove f2f3 currmovenumber 8 info depth 27 currmove e2e3 currmovenumber 9 info depth 27 currmove b1a3 currmovenumber 10 info depth 27 currmove b2b4 currmovenumber 11 info depth 27 currmove g2g4 currmovenumber 12 info depth 27 currmove d2d3 currmovenumber 13 info depth 27 currmove g2g3 currmovenumber 14 info depth 27 currmove a2a4 currmovenumber 15 info depth 27 currmove h2h3 currmovenumber 16 info depth 27 currmove f2f4 currmovenumber 17 info depth 27 currmove b2b3 currmovenumber 18 info depth 27 currmove h2h4 currmovenumber 19 info depth 27 currmove g1h3 currmovenumber 20 info depth 28 seldepth 38 multipv 1 score cp 48 nodes 21293426 nps 1042364 hashfull 1000 tbhits 0 time 20428 pv e2e4 c7c6 b1c3 d7d5 d2d4 d5e4 c3e4 c8f5 e4g3 f5g6 h2h4 h7h6 g1f3 b8d7 h4h5 g6h7 f1d3 h7d3 d1d3 d8c7 c1d2 e7e6 e1c1 g8f6 c1b1 f8e7 g3e4 a8d8 g2g4 f6g4 h1g1 info depth 29 currmove e2e4 currmovenumber 1 info depth 29 currmove c2c4 currmovenumber 2 info depth 29 currmove d2d4 currmovenumber 3 info depth 29 currmove e2e3 currmovenumber 4 info depth 29 currmove g1f3 currmovenumber 5 info depth 29 currmove b1c3 currmovenumber 6 info depth 29 currmove c2c3 currmovenumber 7 info depth 29 currmove a2a3 currmovenumber 8 info depth 29 currmove b2b3 currmovenumber 9 info depth 29 currmove g2g3 currmovenumber 10 info depth 29 currmove h2h3 currmovenumber 11 info depth 29 currmove a2a4 currmovenumber 12 info depth 29 currmove g1h3 currmovenumber 13 info depth 29 currmove b1a3 currmovenumber 14 info depth 29 currmove h2h4 currmovenumber 15 info depth 29 currmove d2d3 currmovenumber 16 info depth 29 currmove f2f3 currmovenumber 17 info depth 29 currmove b2b4 currmovenumber 18 info depth 29 currmove f2f4 currmovenumber 19 info depth 29 currmove g2g4 currmovenumber 20 info depth 29 seldepth 38 multipv 1 score cp 39 upperbound nodes 24537602 nps 1043620 hashfull 1000 tbhits 0 time 23512 pv e2e4 c7c6 info depth 29 currmove e2e4 currmovenumber 1 info depth 29 currmove c2c4 currmovenumber 2 info depth 29 currmove d2d4 currmovenumber 3 info depth 29 currmove g1f3 currmovenumber 4 info depth 29 currmove b1c3 currmovenumber 5 info depth 29 currmove e2e3 currmovenumber 6 info depth 29 currmove c2c3 currmovenumber 7 info depth 29 currmove d2d3 currmovenumber 8 info depth 29 currmove a2a3 currmovenumber 9 info depth 29 currmove g2g3 currmovenumber 10 info depth 29 currmove f2f3 currmovenumber 11 info depth 29 currmove b2b3 currmovenumber 12 info depth 29 currmove b2b4 currmovenumber 13 info depth 29 currmove h2h3 currmovenumber 14 info depth 29 currmove a2a4 currmovenumber 15 info depth 29 currmove f2f4 currmovenumber 16 info depth 29 currmove g2g4 currmovenumber 17 info depth 29 currmove h2h4 currmovenumber 18 info depth 29 currmove b1a3 currmovenumber 19 info depth 29 currmove g1h3 currmovenumber 20 info depth 29 seldepth 38 multipv 1 score cp 38 nodes 26592674 nps 1036226 hashfull 1000 tbhits 0 time 25663 pv e2e4 c7c6 b1c3 d7d5 d2d4 d5e4 c3e4 c8f5 e4g3 f5g6 h2h4 h7h6 g1f3 b8d7 h4h5 g6h7 f1d3 h7d3 d1d3 e7e6 c1f4 f8b4 c2c3 b4e7 e1c1 d8a5 c1b1 g8f6 g3e4 f6h5 e4d6 e7d6 f4d6 a5d5 d6c7 h5f6 c3c4 info depth 30 currmove e2e4 currmovenumber 1 info depth 30 currmove c2c4 currmovenumber 2 info depth 30 currmove d2d4 currmovenumber 3 info depth 30 currmove g1f3 currmovenumber 4 info depth 30 currmove b1c3 currmovenumber 5 info depth 30 currmove g2g4 currmovenumber 6 info depth 30 currmove a2a3 currmovenumber 7 info depth 30 currmove c2c3 currmovenumber 8 info depth 30 currmove f2f3 currmovenumber 9 info depth 30 currmove g2g3 currmovenumber 10 info depth 30 currmove a2a4 currmovenumber 11 info depth 30 currmove d2d3 currmovenumber 12 info depth 30 currmove h2h3 currmovenumber 13 info depth 30 currmove f2f4 currmovenumber 14 info depth 30 currmove b2b4 currmovenumber 15 info depth 30 currmove b2b3 currmovenumber 16 info depth 30 currmove e2e3 currmovenumber 17 info depth 30 currmove h2h4 currmovenumber 18 info depth 30 currmove b1a3 currmovenumber 19 info depth 30 currmove g1h3 currmovenumber 20 info depth 30 seldepth 44 multipv 1 score cp 46 nodes 30130499 nps 1029715 hashfull 1000 tbhits 0 time 29261 pv e2e4 c7c6 b1c3 d7d5 d2d4 d5e4 c3e4 c8f5 e4g3 f5g6 h2h4 h7h6 g1f3 b8d7 h4h5 g6h7 f1d3 h7d3 d1d3 e7e6 c1f4 f8b4 c2c3 b4e7 g3e4 d7f6 f3e5 f6e4 d3e4 g8f6 e4e2 d8a5 f4e3 a5b5 g2g4 b5e2 e1e2 info depth 31 currmove e2e4 currmovenumber 1 info depth 31 seldepth 37 multipv 1 score cp 51 lowerbound nodes 33048607 nps 1021027 hashfull 1000 tbhits 0 time 32368 pv e2e4 info depth 30 currmove e2e4 currmovenumber 1 info depth 30 currmove c2c4 currmovenumber 2 info depth 30 currmove d2d4 currmovenumber 3 info depth 30 currmove b1c3 currmovenumber 4 info depth 30 currmove g1f3 currmovenumber 5 info depth 30 currmove h2h4 currmovenumber 6 info depth 30 currmove a2a3 currmovenumber 7 info depth 30 currmove c2c3 currmovenumber 8 info depth 30 currmove h2h3 currmovenumber 9 info depth 30 currmove f2f4 currmovenumber 10 info depth 30 currmove g1h3 currmovenumber 11 info depth 30 currmove d2d3 currmovenumber 12 info depth 30 currmove b2b4 currmovenumber 13 info depth 30 currmove b2b3 currmovenumber 14 info depth 30 currmove e2e3 currmovenumber 15 info depth 30 currmove f2f3 currmovenumber 16 info depth 30 currmove g2g3 currmovenumber 17 info depth 30 currmove a2a4 currmovenumber 18 info depth 30 currmove g2g4 currmovenumber 19 info depth 30 currmove b1a3 currmovenumber 20 info depth 31 seldepth 39 multipv 1 score cp 43 nodes 43757488 nps 981571 hashfull 1000 tbhits 0 time 44579 pv e2e4 e7e5 g1f3 b8c6 f1b5 a7a6 b5a4 g8f6 e1g1 f6e4 d2d4 b7b5 a4b3 d7d5 d4e5 c8e6 b1d2 e4c5 c2c3 d5d4 f3d4 c6d4 c3d4 d8d4 b3e6 c5e6 d2b3 d4d1 f1d1 e6c5 c1e3 c5b3 a2b3 info depth 32 currmove e2e4 currmovenumber 1 info depth 32 currmove c2c4 currmovenumber 2 info depth 32 currmove g1f3 currmovenumber 3 info depth 32 currmove e2e3 currmovenumber 4 info depth 32 currmove d2d4 currmovenumber 5 info depth 32 currmove g2g3 currmovenumber 6 info depth 32 currmove b1c3 currmovenumber 7 info depth 32 currmove b2b3 currmovenumber 8 info depth 32 currmove a2a3 currmovenumber 9 info depth 32 currmove a2a4 currmovenumber 10 info depth 32 currmove h2h3 currmovenumber 11 info depth 32 currmove d2d3 currmovenumber 12 info depth 32 currmove h2h4 currmovenumber 13 info depth 32 currmove c2c3 currmovenumber 14 info depth 32 currmove b1a3 currmovenumber 15 info depth 32 currmove g1h3 currmovenumber 16 info depth 32 currmove f2f3 currmovenumber 17 info depth 32 currmove b2b4 currmovenumber 18 info depth 32 currmove f2f4 currmovenumber 19 info depth 32 currmove g2g4 currmovenumber 20 info depth 32 seldepth 38 multipv 1 score cp 48 nodes 46914842 nps 965504 hashfull 1000 tbhits 0 time 48591 pv e2e4 e7e5 g1f3 b8c6 f1b5 a7a6 b5a4 g8f6 e1g1 f6e4 d2d4 b7b5 a4b3 d7d5 d4e5 c8e6 b1d2 e4c5 c2c3 d5d4 b3e6 c5e6 c3d4 c6d4 a2a4 f8e7 f3d4 d8d4 a4b5 a6a5 d1e2 d4b4 d2f3 e8g8 c1e3 a5a4 f1d1 info depth 33 currmove e2e4 currmovenumber 1 info depth 33 currmove c2c4 currmovenumber 2 info depth 33 currmove g1f3 currmovenumber 3 info depth 33 currmove b1c3 currmovenumber 4 info depth 33 currmove g2g3 currmovenumber 5 info depth 33 currmove e2e3 currmovenumber 6 info depth 33 currmove d2d4 currmovenumber 7 info depth 33 currmove d2d3 currmovenumber 8 info depth 33 currmove c2c3 currmovenumber 9 info depth 33 currmove a2a3 currmovenumber 10 info depth 33 currmove a2a4 currmovenumber 11 info depth 33 currmove f2f3 currmovenumber 12 info depth 33 currmove b2b3 currmovenumber 13 info depth 33 currmove h2h3 currmovenumber 14 info depth 33 currmove b2b4 currmovenumber 15 info depth 33 currmove f2f4 currmovenumber 16 info depth 33 currmove g2g4 currmovenumber 17 info depth 33 currmove h2h4 currmovenumber 18 info depth 33 currmove b1a3 currmovenumber 19 info depth 33 currmove g1h3 currmovenumber 20 info depth 33 seldepth 36 multipv 1 score cp 39 upperbound nodes 68306981 nps 980407 hashfull 1000 tbhits 0 time 69672 pv e2e4 e7e5 info depth 33 currmove e2e4 currmovenumber 1 info depth 33 currmove c2c4 currmovenumber 2 info depth 33 currmove g1f3 currmovenumber 3 info depth 33 currmove b1c3 currmovenumber 4 info depth 33 currmove e2e3 currmovenumber 5 info depth 33 currmove c2c3 currmovenumber 6 info depth 33 currmove d2d4 currmovenumber 7 info depth 33 currmove b2b4 currmovenumber 8 info depth 33 currmove a2a3 currmovenumber 9 info depth 33 currmove g2g3 currmovenumber 10 info depth 33 currmove b2b3 currmovenumber 11 info depth 33 currmove f2f3 currmovenumber 12 info depth 33 currmove d2d3 currmovenumber 13 info depth 33 currmove h2h3 currmovenumber 14 info depth 33 currmove a2a4 currmovenumber 15 info depth 33 currmove f2f4 currmovenumber 16 info depth 33 currmove g2g4 currmovenumber 17 info depth 33 currmove h2h4 currmovenumber 18 info depth 33 currmove b1a3 currmovenumber 19 info depth 33 currmove g1h3 currmovenumber 20 info depth 33 seldepth 42 multipv 1 score cp 31 upperbound nodes 72200243 nps 982543 hashfull 1000 tbhits 0 time 73483 pv e2e4 e7e5 info depth 33 currmove e2e4 currmovenumber 1 info depth 33 seldepth 42 multipv 1 score cp 39 lowerbound nodes 75421179 nps 982072 hashfull 1000 tbhits 0 time 76798 pv e2e4 info depth 32 currmove e2e4 currmovenumber 1 info depth 33 seldepth 42 multipv 1 score cp 53 lowerbound nodes 79320841 nps 983044 hashfull 1000 tbhits 0 time 80689 pv e2e4 info depth 31 currmove e2e4 currmovenumber 1 info depth 31 currmove c2c4 currmovenumber 2 info depth 31 currmove d2d4 currmovenumber 3 info depth 31 currmove g1f3 currmovenumber 4 info depth 31 currmove b1c3 currmovenumber 5 info depth 31 currmove c2c3 currmovenumber 6 info depth 31 currmove f2f4 currmovenumber 7 info depth 31 currmove h2h3 currmovenumber 8 info depth 31 currmove f2f3 currmovenumber 9 info depth 31 currmove a2a3 currmovenumber 10 info depth 31 currmove e2e3 currmovenumber 11 info depth 31 currmove a2a4 currmovenumber 12 info depth 31 currmove b2b4 currmovenumber 13 info depth 31 currmove d2d3 currmovenumber 14 info depth 31 currmove g2g4 currmovenumber 15 info depth 31 currmove b2b3 currmovenumber 16 info depth 31 currmove g2g3 currmovenumber 17 info depth 31 currmove h2h4 currmovenumber 18 info depth 31 currmove b1a3 currmovenumber 19 info depth 31 currmove g1h3 currmovenumber 20 info depth 33 seldepth 42 multipv 1 score cp 51 nodes 80549339 nps 983580 hashfull 1000 tbhits 0 time 81894 pv e2e4 c7c6 d2d4 d7d5 b1d2 d5e4 d2e4 c8f5 e4g3 f5g6 h2h4 h7h6 g1f3 b8d7 h4h5 g6h7 f1d3 h7d3 d1d3 e7e6 c1f4 d8a5 f4d2 a5c7 g3e4 f8e7 e1c1 a8d8 g2g4 g8f6 e4f6 d7f6 d1g1 c6c5 c1b1 c5d4 g4g5 h6g5 g1g5 info depth 34 currmove e2e4 currmovenumber 1 info depth 34 currmove c2c4 currmovenumber 2 info depth 34 currmove g2g3 currmovenumber 3 info depth 34 currmove d2d4 currmovenumber 4 info depth 34 currmove e2e3 currmovenumber 5 info depth 34 currmove b1c3 currmovenumber 6 info depth 34 currmove g1f3 currmovenumber 7 info depth 34 currmove a2a3 currmovenumber 8 info depth 34 currmove b2b4 currmovenumber 9 info depth 34 currmove c2c3 currmovenumber 10 info depth 34 currmove d2d3 currmovenumber 11 info depth 34 currmove h2h4 currmovenumber 12 info depth 34 currmove h2h3 currmovenumber 13 info depth 34 currmove b2b3 currmovenumber 14 info depth 34 currmove f2f4 currmovenumber 15 info depth 34 currmove g2g4 currmovenumber 16 info depth 34 currmove f2f3 currmovenumber 17 info depth 34 currmove a2a4 currmovenumber 18 info depth 34 currmove b1a3 currmovenumber 19 info depth 34 currmove g1h3 currmovenumber 20 info depth 34 seldepth 38 multipv 1 score cp 42 upperbound nodes 84852153 nps 985827 hashfull 1000 tbhits 0 time 86072 pv e2e4 c7c6 info depth 34 currmove e2e4 currmovenumber 1 info depth 34 seldepth 42 multipv 1 score cp 50 lowerbound nodes 87892743 nps 987758 hashfull 1000 tbhits 0 time 88982 pv e2e4 info depth 33 currmove e2e4 currmovenumber 1 info depth 33 currmove c2c4 currmovenumber 2 info depth 33 currmove d2d4 currmovenumber 3 info depth 33 currmove b1c3 currmovenumber 4 info depth 33 currmove g1f3 currmovenumber 5 info depth 33 currmove b2b3 currmovenumber 6 info depth 33 currmove h2h3 currmovenumber 7 info depth 33 currmove b2b4 currmovenumber 8 info depth 33 currmove c2c3 currmovenumber 9 info depth 33 currmove d2d3 currmovenumber 10 info depth 33 currmove a2a4 currmovenumber 11 info depth 33 currmove h2h4 currmovenumber 12 info depth 33 currmove f2f3 currmovenumber 13 info depth 33 currmove a2a3 currmovenumber 14 info depth 33 currmove e2e3 currmovenumber 15 info depth 33 currmove g2g3 currmovenumber 16 info depth 33 currmove f2f4 currmovenumber 17 info depth 33 currmove g1h3 currmovenumber 18 info depth 33 currmove g2g4 currmovenumber 19 info depth 33 currmove b1a3 currmovenumber 20 info depth 34 seldepth 47 multipv 1 score cp 58 nodes 112442405 nps 945919 hashfull 1000 tbhits 0 time 118871 pv e2e4 c7c6 b1c3 d7d5 d2d4 d5e4 c3e4 c8f5 e4g3 f5g6 h2h4 h7h6 g1f3 b8d7 h4h5 g6h7 f1d3 h7d3 d1d3 g8f6 c1f4 e7e6 e1c1 f8e7 c1b1 e8g8 g3e4 f6e4 d3e4 d7f6 e4e2 d8d5 f3e5 f8d8 c2c4 d5e4 e2e4 f6e4 info depth 35 currmove e2e4 currmovenumber 1 info depth 35 currmove c2c4 currmovenumber 2 info depth 35 currmove d2d4 currmovenumber 3 info depth 35 currmove b1c3 currmovenumber 4 info depth 35 currmove e2e3 currmovenumber 5 info depth 35 currmove g1f3 currmovenumber 6 info depth 35 currmove a2a3 currmovenumber 7 info depth 35 currmove c2c3 currmovenumber 8 info depth 35 currmove d2d3 currmovenumber 9 info depth 35 currmove g2g3 currmovenumber 10 info depth 35 currmove g2g4 currmovenumber 11 info depth 35 currmove f2f4 currmovenumber 12 info depth 35 currmove h2h3 currmovenumber 13 info depth 35 currmove f2f3 currmovenumber 14 info depth 35 currmove h2h4 currmovenumber 15 info depth 35 currmove b2b3 currmovenumber 16 info depth 35 currmove a2a4 currmovenumber 17 info depth 35 currmove b2b4 currmovenumber 18 info depth 35 currmove b1a3 currmovenumber 19 info depth 35 currmove g1h3 currmovenumber 20 info depth 35 seldepth 37 multipv 1 score cp 47 upperbound nodes 115879350 nps 943888 hashfull 1000 tbhits 0 time 122768 pv e2e4 c7c6 info depth 35 currmove e2e4 currmovenumber 1 info depth 35 seldepth 38 multipv 1 score cp 54 lowerbound nodes 121241537 nps 941338 hashfull 1000 tbhits 0 time 128797 pv e2e4 info depth 34 currmove e2e4 currmovenumber 1 info depth 34 currmove c2c4 currmovenumber 2 info depth 34 currmove d2d4 currmovenumber 3 info depth 34 currmove g1f3 currmovenumber 4 info depth 34 currmove b1c3 currmovenumber 5 info depth 34 currmove d2d3 currmovenumber 6 info depth 34 currmove c2c3 currmovenumber 7 info depth 34 currmove a2a3 currmovenumber 8 info depth 34 currmove h2h4 currmovenumber 9 info depth 34 currmove h2h3 currmovenumber 10 info depth 34 currmove f2f3 currmovenumber 11 info depth 34 currmove g2g3 currmovenumber 12 info depth 34 currmove e2e3 currmovenumber 13 info depth 34 currmove b2b3 currmovenumber 14 info depth 34 currmove a2a4 currmovenumber 15 info depth 34 currmove b2b4 currmovenumber 16 info depth 34 currmove f2f4 currmovenumber 17 info depth 34 currmove g2g4 currmovenumber 18 info depth 34 currmove b1a3 currmovenumber 19 info depth 34 currmove g1h3 currmovenumber 20 info depth 35 seldepth 40 multipv 1 score cp 39 upperbound nodes 125641961 nps 941222 hashfull 1000 tbhits 0 time 133488 pv e2e4 e7e5 info depth 35 currmove e2e4 currmovenumber 1 info depth 35 currmove c2c4 currmovenumber 2 info depth 35 currmove e2e3 currmovenumber 3 info depth 35 currmove d2d4 currmovenumber 4 info depth 35 currmove b1c3 currmovenumber 5 info depth 35 currmove g1f3 currmovenumber 6 info depth 35 currmove a2a3 currmovenumber 7 info depth 35 currmove c2c3 currmovenumber 8 info depth 35 currmove b2b3 currmovenumber 9 info depth 35 currmove g2g3 currmovenumber 10 info depth 35 currmove b2b4 currmovenumber 11 info depth 35 currmove d2d3 currmovenumber 12 info depth 35 currmove h2h3 currmovenumber 13 info depth 35 currmove f2f3 currmovenumber 14 info depth 35 currmove a2a4 currmovenumber 15 info depth 35 currmove f2f4 currmovenumber 16 info depth 35 currmove g2g4 currmovenumber 17 info depth 35 currmove h2h4 currmovenumber 18 info depth 35 currmove b1a3 currmovenumber 19 info depth 35 currmove g1h3 currmovenumber 20 info depth 35 seldepth 50 multipv 1 score cp 50 nodes 134687304 nps 944299 hashfull 1000 tbhits 0 time 142632 pv e2e4 c7c6 d2d4 d7d5 b1d2 d5e4 d2e4 c8f5 e4g3 f5g6 g1f3 b8d7 h2h4 h7h6 h4h5 g6h7 f1d3 h7d3 d1d3 g8f6 c1f4 e7e6 e1c1 f8e7 c1b1 e8g8 g3e4 f6e4 d3e4 d7f6 e4e1 d8d5 f3e5 d5e4 e1e4 f6e4 f4e3 e4f6 info depth 36 currmove e2e4 currmovenumber 1 info depth 36 currmove c2c4 currmovenumber 2 info depth 36 currmove d2d4 currmovenumber 3 info depth 36 currmove g1f3 currmovenumber 4 info depth 36 currmove c2c3 currmovenumber 5 info depth 36 currmove f2f4 currmovenumber 6 info depth 36 currmove b1c3 currmovenumber 7 info depth 36 currmove h2h3 currmovenumber 8 info depth 36 currmove d2d3 currmovenumber 9 info depth 36 currmove g2g3 currmovenumber 10 info depth 36 currmove b2b3 currmovenumber 11 info depth 36 currmove a2a4 currmovenumber 12 info depth 36 currmove a2a3 currmovenumber 13 info depth 36 currmove b2b4 currmovenumber 14 info depth 36 currmove e2e3 currmovenumber 15 info depth 36 currmove f2f3 currmovenumber 16 info depth 36 currmove g2g4 currmovenumber 17 info depth 36 currmove h2h4 currmovenumber 18 info depth 36 currmove b1a3 currmovenumber 19 info depth 36 currmove g1h3 currmovenumber 20 info depth 36 seldepth 32 multipv 1 score cp 40 upperbound nodes 136848113 nps 945370 hashfull 1000 tbhits 0 time 144756 pv e2e4 c7c6 info depth 36 currmove e2e4 currmovenumber 1 info depth 36 currmove c2c4 currmovenumber 2 info depth 36 currmove d2d4 currmovenumber 3 info depth 36 currmove b1c3 currmovenumber 4 info depth 36 currmove g1f3 currmovenumber 5 info depth 36 currmove g2g3 currmovenumber 6 info depth 36 currmove f2f4 currmovenumber 7 info depth 36 currmove a2a3 currmovenumber 8 info depth 36 currmove d2d3 currmovenumber 9 info depth 36 currmove c2c3 currmovenumber 10 info depth 36 currmove e2e3 currmovenumber 11 info depth 36 currmove b2b3 currmovenumber 12 info depth 36 currmove h2h3 currmovenumber 13 info depth 36 currmove f2f3 currmovenumber 14 info depth 36 currmove b2b4 currmovenumber 15 info depth 36 currmove a2a4 currmovenumber 16 info depth 36 currmove g2g4 currmovenumber 17 info depth 36 currmove h2h4 currmovenumber 18 info depth 36 currmove b1a3 currmovenumber 19 info depth 36 currmove g1h3 currmovenumber 20 info depth 36 seldepth 43 multipv 1 score cp 33 upperbound nodes 147079433 nps 948134 hashfull 1000 tbhits 0 time 155125 pv e2e4 e7e5 info depth 36 currmove e2e4 currmovenumber 1 info depth 36 seldepth 43 multipv 1 score cp 40 lowerbound nodes 152218885 nps 948374 hashfull 1000 tbhits 0 time 160505 pv e2e4 info depth 35 currmove e2e4 currmovenumber 1 info depth 35 currmove c2c4 currmovenumber 2 info depth 35 currmove d2d4 currmovenumber 3 info depth 35 currmove b1c3 currmovenumber 4 info depth 35 currmove c2c3 currmovenumber 5 info depth 35 currmove g1f3 currmovenumber 6 info depth 35 currmove g2g3 currmovenumber 7 info depth 35 currmove e2e3 currmovenumber 8 info depth 35 currmove f2f4 currmovenumber 9 info depth 35 currmove a2a3 currmovenumber 10 info depth 35 currmove a2a4 currmovenumber 11 info depth 35 currmove f2f3 currmovenumber 12 info depth 35 currmove b2b4 currmovenumber 13 info depth 35 currmove h2h4 currmovenumber 14 info depth 35 currmove d2d3 currmovenumber 15 info depth 35 currmove h2h3 currmovenumber 16 info depth 35 currmove g1h3 currmovenumber 17 info depth 35 currmove b1a3 currmovenumber 18 info depth 35 currmove b2b3 currmovenumber 19 info depth 35 currmove g2g4 currmovenumber 20 info depth 36 seldepth 43 multipv 1 score cp 48 nodes 161024080 nps 948081 hashfull 1000 tbhits 0 time 169842 pv e2e4 e7e5 g1f3 b8c6 f1b5 a7a6 b5a4 g8f6 e1g1 f6e4 d2d4 b7b5 a4b3 d7d5 d4e5 c8e6 b1d2 e4c5 c2c3 d5d4 b3e6 c5e6 c3d4 c6d4 a2a4 f8e7 f3d4 e6d4 d2e4 d4e6 d1f3 e8g8 f1d1 d8e8 e4f6 g7f6 e5f6 e7d6 c1h6 b5a4 f3h5 g8h8 info depth 37 currmove e2e4 currmovenumber 1 info depth 37 currmove c2c4 currmovenumber 2 info depth 37 currmove b1c3 currmovenumber 3 info depth 37 currmove d2d4 currmovenumber 4 info depth 37 currmove g1f3 currmovenumber 5 info depth 37 currmove e2e3 currmovenumber 6 info depth 37 currmove a2a3 currmovenumber 7 info depth 37 currmove c2c3 currmovenumber 8 info depth 37 currmove g2g3 currmovenumber 9 info depth 37 currmove b2b4 currmovenumber 10 info depth 37 currmove h2h3 currmovenumber 11 info depth 37 currmove f2f3 currmovenumber 12 info depth 37 currmove b2b3 currmovenumber 13 info depth 37 currmove d2d3 currmovenumber 14 info depth 37 currmove a2a4 currmovenumber 15 info depth 37 currmove f2f4 currmovenumber 16 info depth 37 currmove g2g4 currmovenumber 17 info depth 37 currmove h2h4 currmovenumber 18 info depth 37 currmove b1a3 currmovenumber 19 info depth 37 currmove g1h3 currmovenumber 20 info depth 37 seldepth 41 multipv 1 score cp 37 upperbound nodes 168507092 nps 947925 hashfull 1000 tbhits 0 time 177764 pv e2e4 e7e5 info depth 37 currmove e2e4 currmovenumber 1 info depth 37 currmove c2c4 currmovenumber 2 info depth 37 currmove b1c3 currmovenumber 3 info depth 37 currmove d2d4 currmovenumber 4 info depth 37 currmove g1f3 currmovenumber 5 info depth 37 currmove a2a3 currmovenumber 6 info depth 37 currmove e2e3 currmovenumber 7 info depth 37 currmove d2d3 currmovenumber 8 info depth 37 currmove c2c3 currmovenumber 9 info depth 37 currmove f2f3 currmovenumber 10 info depth 37 currmove g2g3 currmovenumber 11 info depth 37 currmove a2a4 currmovenumber 12 info depth 37 currmove f2f4 currmovenumber 13 info depth 37 currmove b2b3 currmovenumber 14 info depth 37 currmove h2h3 currmovenumber 15 info depth 37 currmove b2b4 currmovenumber 16 info depth 37 currmove g2g4 currmovenumber 17 info depth 37 currmove h2h4 currmovenumber 18 info depth 37 currmove b1a3 currmovenumber 19 info depth 37 currmove g1h3 currmovenumber 20 info depth 37 seldepth 43 multipv 1 score cp 29 upperbound nodes 193869101 nps 942099 hashfull 1000 tbhits 0 time 205784 pv e2e4 e7e5 info depth 37 currmove e2e4 currmovenumber 1 info depth 37 currmove c2c4 currmovenumber 2 info depth 37 currmove b1c3 currmovenumber 3 info depth 37 currmove c2c3 currmovenumber 4 info depth 37 currmove d2d4 currmovenumber 5 info depth 37 currmove g1f3 currmovenumber 6 info depth 37 currmove e2e3 currmovenumber 7 info depth 37 currmove f2f4 currmovenumber 8 info depth 37 currmove h2h3 currmovenumber 9 info depth 37 currmove a2a3 currmovenumber 10 info depth 37 currmove d2d3 currmovenumber 11 info depth 37 currmove g2g3 currmovenumber 12 info depth 37 currmove f2f3 currmovenumber 13 info depth 37 currmove h2h4 currmovenumber 14 info depth 37 currmove b2b3 currmovenumber 15 info depth 37 currmove a2a4 currmovenumber 16 info depth 37 currmove b2b4 currmovenumber 17 info depth 37 currmove g2g4 currmovenumber 18 info depth 37 currmove b1a3 currmovenumber 19 info depth 37 currmove g1h3 currmovenumber 20 info depth 37 seldepth 44 multipv 1 score cp 33 nodes 211513309 nps 947148 hashfull 1000 tbhits 0 time 223316 pv e2e4 e7e5 g1f3 b8c6 f1c4 g8f6 d2d3 f8c5 e1g1 d7d6 c2c3 a7a6 c4b3 h7h6 a2a4 e8g8 h2h3 c5a7 b1d2 c8e6 f1e1 e6b3 d1b3 d8d7 d2f1 d7e6 b3c2 f8e8 c1e3 a7e3 f1e3 d6d5 a4a5 a8d8 b2b4 d5e4 d3e4 info depth 38 currmove e2e4 currmovenumber 1 info depth 38 currmove c2c4 currmovenumber 2 info depth 38 currmove b1c3 currmovenumber 3 info depth 38 currmove g2g3 currmovenumber 4 info depth 38 currmove e2e3 currmovenumber 5 info depth 38 currmove g1f3 currmovenumber 6 info depth 38 currmove d2d4 currmovenumber 7 info depth 38 currmove a2a3 currmovenumber 8 info depth 38 currmove f2f4 currmovenumber 9 info depth 38 currmove d2d3 currmovenumber 10 info depth 38 currmove h2h3 currmovenumber 11 info depth 38 currmove f2f3 currmovenumber 12 info depth 38 currmove c2c3 currmovenumber 13 info depth 38 currmove b2b3 currmovenumber 14 info depth 38 currmove a2a4 currmovenumber 15 info depth 38 currmove b2b4 currmovenumber 16 info depth 38 currmove g2g4 currmovenumber 17 info depth 38 currmove h2h4 currmovenumber 18 info depth 38 currmove b1a3 currmovenumber 19 info depth 38 currmove g1h3 currmovenumber 20 info depth 38 seldepth 45 multipv 1 score cp 25 upperbound nodes 262255119 nps 935990 hashfull 1000 tbhits 0 time 280190 pv e2e4 e7e5 info depth 38 currmove e2e4 currmovenumber 1 info depth 38 seldepth 45 multipv 1 score cp 33 lowerbound nodes 268046346 nps 934447 hashfull 1000 tbhits 0 time 286850 pv e2e4 info depth 37 currmove e2e4 currmovenumber 1 info depth 37 currmove c2c4 currmovenumber 2 info depth 37 currmove d2d4 currmovenumber 3 info depth 37 currmove g1f3 currmovenumber 4 info depth 37 currmove b1c3 currmovenumber 5 info depth 37 currmove d2d3 currmovenumber 6 info depth 37 currmove c2c3 currmovenumber 7 info depth 37 currmove f2f4 currmovenumber 8 info depth 37 currmove a2a3 currmovenumber 9 info depth 37 currmove b2b3 currmovenumber 10 info depth 37 currmove b1a3 currmovenumber 11 info depth 37 currmove h2h3 currmovenumber 12 info depth 37 currmove g2g3 currmovenumber 13 info depth 37 currmove e2e3 currmovenumber 14 info depth 37 currmove f2f3 currmovenumber 15 info depth 37 currmove a2a4 currmovenumber 16 info depth 37 currmove b2b4 currmovenumber 17 info depth 37 currmove g2g4 currmovenumber 18 info depth 37 currmove h2h4 currmovenumber 19 info depth 37 currmove g1h3 currmovenumber 20 info depth 38 seldepth 45 multipv 1 score cp 31 nodes 331489615 nps 937380 hashfull 1000 tbhits 0 time 353634 pv e2e4 e7e5 g1f3 b8c6 f1c4 f8c5 d2d3 g8f6 c2c3 a7a6 e1g1 d7d6 c4b3 c5a7 a2a4 e8g8 h2h3 h7h6 c1e3 a7e3 f2e3 c8e6 b1d2 e6b3 d1b3 d8d7 a4a5 c6e7 c3c4 f8b8 info depth 39 currmove e2e4 currmovenumber 1 info depth 39 currmove c2c4 currmovenumber 2 info depth 39 currmove g1f3 currmovenumber 3 info depth 39 currmove b1c3 currmovenumber 4 info depth 39 currmove d2d4 currmovenumber 5 info depth 39 currmove c2c3 currmovenumber 6 info depth 39 currmove d2d3 currmovenumber 7 info depth 39 currmove e2e3 currmovenumber 8 info depth 39 currmove f2f4 currmovenumber 9 info depth 39 currmove a2a3 currmovenumber 10 info depth 39 currmove f2f3 currmovenumber 11 info depth 39 currmove g2g3 currmovenumber 12 info depth 39 currmove g2g4 currmovenumber 13 info depth 39 currmove b2b3 currmovenumber 14 info depth 39 currmove h2h3 currmovenumber 15 info depth 39 currmove a2a4 currmovenumber 16 info depth 39 currmove b2b4 currmovenumber 17 info depth 39 currmove h2h4 currmovenumber 18 info depth 39 currmove b1a3 currmovenumber 19 info depth 39 currmove g1h3 currmovenumber 20 info depth 39 seldepth 32 multipv 1 score cp 23 upperbound nodes 357649860 nps 941223 hashfull 1000 tbhits 0 time 379984 pv e2e4 e7e5 info depth 39 currmove e2e4 currmovenumber 1 info depth 39 seldepth 39 multipv 1 score cp 31 lowerbound nodes 366903936 nps 943716 hashfull 1000 tbhits 0 time 388786 pv e2e4 info depth 38 currmove e2e4 currmovenumber 1 info depth 39 seldepth 39 multipv 1 score cp 41 lowerbound nodes 376984643 nps 946298 hashfull 1000 tbhits 0 time 398378 pv e2e4 info depth 37 currmove e2e4 currmovenumber 1 info depth 37 currmove c2c4 currmovenumber 2 info depth 37 currmove d2d4 currmovenumber 3 info depth 37 currmove g1f3 currmovenumber 4 info depth 37 currmove b1c3 currmovenumber 5 info depth 37 currmove d2d3 currmovenumber 6 info depth 37 currmove f2f4 currmovenumber 7 info depth 37 currmove c2c3 currmovenumber 8 info depth 37 currmove g2g3 currmovenumber 9 info depth 37 currmove e2e3 currmovenumber 10 info depth 37 currmove h2h3 currmovenumber 11 info depth 37 currmove f2f3 currmovenumber 12 info depth 37 currmove a2a4 currmovenumber 13 info depth 37 currmove a2a3 currmovenumber 14 info depth 37 currmove b2b3 currmovenumber 15 info depth 37 currmove b2b4 currmovenumber 16 info depth 37 currmove g2g4 currmovenumber 17 info depth 37 currmove h2h4 currmovenumber 18 info depth 37 currmove b1a3 currmovenumber 19 info depth 37 currmove g1h3 currmovenumber 20 info depth 39 seldepth 42 multipv 1 score cp 40 nodes 392897469 nps 950347 hashfull 1000 tbhits 0 time 413425 pv e2e4 e7e5 g1f3 b8c6 f1c4 f8c5 d2d3 g8f6 c2c3 a7a6 e1g1 d7d6 c4b3 c5a7 a2a4 e8g8 h2h3 c8e6 b3e6 f7e6 c1e3 a7e3 f2e3 d6d5 b1d2 d8d6 b2b4 h7h6 d1b3 d5e4 d3e4 d6d3 f1e1 a8d8 a1d1 g8h8 info depth 40 currmove e2e4 currmovenumber 1 info depth 40 currmove c2c4 currmovenumber 2 info depth 40 currmove b1c3 currmovenumber 3 info depth 40 currmove d2d4 currmovenumber 4 info depth 40 currmove g2g3 currmovenumber 5 info depth 40 currmove a2a3 currmovenumber 6 info depth 40 currmove g1f3 currmovenumber 7 info depth 40 currmove b2b4 currmovenumber 8 info depth 40 currmove d2d3 currmovenumber 9 info depth 40 currmove e2e3 currmovenumber 10 info depth 40 currmove f2f3 currmovenumber 11 info depth 40 currmove b2b3 currmovenumber 12 info depth 40 currmove c2c3 currmovenumber 13 info depth 40 currmove h2h3 currmovenumber 14 info depth 40 currmove a2a4 currmovenumber 15 info depth 40 currmove f2f4 currmovenumber 16 info depth 40 currmove g2g4 currmovenumber 17 info depth 40 currmove h2h4 currmovenumber 18 info depth 40 currmove b1a3 currmovenumber 19 info depth 40 currmove g1h3 currmovenumber 20 info depth 40 seldepth 35 multipv 1 score cp 31 upperbound nodes 403868274 nps 952890 hashfull 1000 tbhits 0 time 423835 pv e2e4 e7e5 info depth 40 currmove e2e4 currmovenumber 1 info depth 40 currmove c2c4 currmovenumber 2 info depth 40 currmove d2d4 currmovenumber 3 info depth 40 seldepth 42 multipv 1 score cp 39 lowerbound nodes 481290316 nps 967493 hashfull 1000 tbhits 0 time 497461 pv d2d4 info depth 39 currmove d2d4 currmovenumber 1 info depth 39 currmove e2e4 currmovenumber 2 info depth 39 currmove b1c3 currmovenumber 3 info depth 39 currmove c2c3 currmovenumber 4 info depth 39 currmove e2e3 currmovenumber 5 info depth 39 currmove g1f3 currmovenumber 6 info depth 39 currmove c2c4 currmovenumber 7 info depth 39 currmove a2a3 currmovenumber 8 info depth 39 currmove f2f3 currmovenumber 9 info depth 39 currmove h2h4 currmovenumber 10 info depth 39 currmove g2g3 currmovenumber 11 info depth 39 currmove a2a4 currmovenumber 12 info depth 39 currmove h2h3 currmovenumber 13 info depth 39 currmove b2b3 currmovenumber 14 info depth 39 currmove b1a3 currmovenumber 15 info depth 39 currmove d2d3 currmovenumber 16 info depth 39 currmove b2b4 currmovenumber 17 info depth 39 currmove f2f4 currmovenumber 18 info depth 39 currmove g2g4 currmovenumber 19 info depth 39 currmove g1h3 currmovenumber 20 info depth 40 seldepth 43 multipv 1 score cp 28 nodes 577650027 nps 970483 hashfull 1000 tbhits 0 time 595219 pv d2d4 d7d5 c2c4 e7e6 b1c3 g8f6 c4d5 e6d5 c1g5 c7c6 e2e3 h7h6 g5h4 f8e7 f1d3 f6e4 h4e7 d8e7 d3e4 d5e4 g1e2 e8g8 d1c2 f7f5 e1g1 b8a6 a2a3 c8e6 e2f4 e6f7 f2f3 e4f3 f1f3 info depth 41 currmove d2d4 currmovenumber 1 info depth 41 currmove e2e4 currmovenumber 2 info depth 41 currmove g1f3 currmovenumber 3 info depth 41 currmove b1c3 currmovenumber 4 info depth 41 currmove c2c3 currmovenumber 5 info depth 41 currmove d2d3 currmovenumber 6 info depth 41 currmove g2g3 currmovenumber 7 info depth 41 currmove h2h4 currmovenumber 8 info depth 41 currmove a2a4 currmovenumber 9 info depth 41 currmove b1a3 currmovenumber 10 info depth 41 currmove a2a3 currmovenumber 11 info depth 41 currmove b2b3 currmovenumber 12 info depth 41 currmove e2e3 currmovenumber 13 info depth 41 currmove f2f3 currmovenumber 14 info depth 41 currmove h2h3 currmovenumber 15 info depth 41 currmove b2b4 currmovenumber 16 info depth 41 currmove c2c4 currmovenumber 17 info depth 41 currmove f2f4 currmovenumber 18 info depth 41 currmove g2g4 currmovenumber 19 info depth 41 currmove g1h3 currmovenumber 20 info depth 41 seldepth 43 multipv 1 score cp 23 upperbound nodes 708293749 nps 969057 hashfull 1000 tbhits 0 time 730910 pv d2d4 d7d5 info depth 41 currmove d2d4 currmovenumber 1 info depth 41 seldepth 43 multipv 1 score cp 31 lowerbound nodes 715239762 nps 968982 hashfull 1000 tbhits 0 time 738135 pv d2d4 info depth 40 currmove d2d4 currmovenumber 1 info depth 40 currmove e2e4 currmovenumber 2 info depth 40 currmove b1c3 currmovenumber 3 info depth 40 currmove e2e3 currmovenumber 4 info depth 40 currmove c2c4 currmovenumber 5 info depth 40 currmove g1f3 currmovenumber 6 info depth 40 currmove c2c3 currmovenumber 7 info depth 40 currmove g1h3 currmovenumber 8 info depth 40 currmove f2f3 currmovenumber 9 info depth 40 currmove h2h4 currmovenumber 10 info depth 40 currmove a2a3 currmovenumber 11 info depth 40 currmove b2b3 currmovenumber 12 info depth 40 currmove f2f4 currmovenumber 13 info depth 40 currmove g2g4 currmovenumber 14 info depth 40 currmove a2a4 currmovenumber 15 info depth 40 currmove g2g3 currmovenumber 16 info depth 40 currmove h2h3 currmovenumber 17 info depth 40 currmove b2b4 currmovenumber 18 info depth 40 currmove b1a3 currmovenumber 19 info depth 40 currmove d2d3 currmovenumber 20 info depth 41 seldepth 43 multipv 1 score cp 40 nodes 728755526 nps 966673 hashfull 1000 tbhits 0 time 753880 pv d2d4 d7d5 c2c4 e7e6 b1c3 g8f6 c4d5 e6d5 c1g5 c7c6 e2e3 h7h6 g5h4 f8e7 f1d3 e8g8 h4g3 f8e8 h2h3 e7f8 g1f3 f6e4 g3h2 c8f5 d1c2 b8d7 e1g1 d8f6 a2a4 f5g6 d3e4 g6e4 c3e4 e8e4 a4a5 info depth 42 currmove d2d4 currmovenumber 1 info depth 42 seldepth 43 multipv 1 score cp 44 lowerbound nodes 804597684 nps 962084 hashfull 1000 tbhits 0 time 836307 pv d2d4 info depth 41 currmove d2d4 currmovenumber 1 info depth 41 currmove e2e4 currmovenumber 2 info depth 41 currmove b1c3 currmovenumber 3 info depth 41 currmove c2c4 currmovenumber 4 info depth 41 currmove g2g4 currmovenumber 5 info depth 41 currmove g1f3 currmovenumber 6 info depth 41 currmove c2c3 currmovenumber 7 info depth 41 currmove h2h3 currmovenumber 8 info depth 41 currmove a2a4 currmovenumber 9 info depth 41 currmove d2d3 currmovenumber 10 info depth 41 currmove a2a3 currmovenumber 11 info depth 41 currmove h2h4 currmovenumber 12 info depth 41 currmove b2b3 currmovenumber 13 info depth 41 currmove b1a3 currmovenumber 14 info depth 41 currmove f2f4 currmovenumber 15 info depth 41 currmove e2e3 currmovenumber 16 info depth 41 currmove f2f3 currmovenumber 17 info depth 41 currmove g2g3 currmovenumber 18 info depth 41 currmove b2b4 currmovenumber 19 info depth 41 currmove g1h3 currmovenumber 20 info depth 42 seldepth 43 multipv 1 score cp 40 nodes 811582626 nps 961564 hashfull 1000 tbhits 0 time 844023 pv d2d4 d7d5 c2c4 e7e6 b1c3 g8f6 c4d5 e6d5 c1g5 c7c6 e2e3 h7h6 g5h4 f8e7 f1d3 e8g8 h4g3 c6c5 g1e2 b8c6 h2h3 c5d4 e3d4 f6h5 e1g1 h5g3 f2g3 e7f6 d3c2 c8e6 a1c1 g7g6 c2b3 f6g7 g1h2 a8c8 e2f4 info depth 43 currmove d2d4 currmovenumber 1 info depth 43 currmove e2e4 currmovenumber 2 info depth 43 currmove b1c3 currmovenumber 3 info depth 43 currmove g1f3 currmovenumber 4 info depth 43 currmove c2c3 currmovenumber 5 info depth 43 currmove a2a3 currmovenumber 6 info depth 43 currmove d2d3 currmovenumber 7 info depth 43 currmove c2c4 currmovenumber 8 info depth 43 currmove f2f4 currmovenumber 9 info depth 43 currmove f2f3 currmovenumber 10 info depth 43 currmove a2a4 currmovenumber 11 info depth 43 currmove g2g3 currmovenumber 12 info depth 43 currmove e2e3 currmovenumber 13 info depth 43 currmove g1h3 currmovenumber 14 info depth 43 currmove h2h3 currmovenumber 15 info depth 43 currmove h2h4 currmovenumber 16 info depth 43 currmove b2b3 currmovenumber 17 info depth 43 currmove b2b4 currmovenumber 18 info depth 43 currmove g2g4 currmovenumber 19 info depth 43 currmove b1a3 currmovenumber 20 info depth 43 seldepth 36 multipv 1 score cp 33 upperbound nodes 878362967 nps 954105 hashfull 1000 tbhits 0 time 920614 pv d2d4 d7d5 info depth 43 currmove d2d4 currmovenumber 1 info depth 43 currmove e2e4 currmovenumber 2 info depth 43 currmove b1c3 currmovenumber 3 info depth 43 currmove g1f3 currmovenumber 4 info depth 43 currmove c2c3 currmovenumber 5 info depth 43 currmove g2g3 currmovenumber 6 info depth 43 currmove f2f4 currmovenumber 7 info depth 43 currmove a2a3 currmovenumber 8 info depth 43 currmove f2f3 currmovenumber 9 info depth 43 currmove c2c4 currmovenumber 10 info depth 43 currmove d2d3 currmovenumber 11 info depth 43 currmove g2g4 currmovenumber 12 info depth 43 currmove b2b3 currmovenumber 13 info depth 43 currmove e2e3 currmovenumber 14 info depth 43 currmove h2h3 currmovenumber 15 info depth 43 currmove a2a4 currmovenumber 16 info depth 43 currmove b2b4 currmovenumber 17 info depth 43 currmove h2h4 currmovenumber 18 info depth 43 currmove b1a3 currmovenumber 19 info depth 43 currmove g1h3 currmovenumber 20 info depth 43 seldepth 43 multipv 1 score cp 25 upperbound nodes 930015454 nps 943707 hashfull 1000 tbhits 0 time 985491 pv d2d4 d7d5 info depth 43 currmove d2d4 currmovenumber 1 info depth 43 seldepth 46 multipv 1 score cp 33 lowerbound nodes 1001912055 nps 940813 hashfull 1000 tbhits 0 time 1064942 pv d2d4 info depth 42 currmove d2d4 currmovenumber 1 info depth 43 seldepth 47 multipv 1 score cp 47 lowerbound nodes 1135618243 nps 933383 hashfull 1000 tbhits 0 time 1216669 pv d2d4 info depth 41 currmove d2d4 currmovenumber 1 info depth 41 currmove e2e4 currmovenumber 2 info depth 41 currmove b1c3 currmovenumber 3 info depth 41 currmove g1f3 currmovenumber 4 info depth 41 currmove c2c4 currmovenumber 5 info depth 41 currmove a2a4 currmovenumber 6 info depth 41 currmove e2e3 currmovenumber 7 info depth 41 currmove c2c3 currmovenumber 8 info depth 41 currmove b2b3 currmovenumber 9 info depth 41 currmove a2a3 currmovenumber 10 info depth 41 currmove g2g3 currmovenumber 11 info depth 41 currmove g1h3 currmovenumber 12 info depth 41 currmove h2h3 currmovenumber 13 info depth 41 currmove d2d3 currmovenumber 14 info depth 41 currmove f2f3 currmovenumber 15 info depth 41 currmove b1a3 currmovenumber 16 info depth 41 currmove b2b4 currmovenumber 17 info depth 41 currmove f2f4 currmovenumber 18 info depth 41 currmove g2g4 currmovenumber 19 info depth 41 currmove h2h4 currmovenumber 20 info depth 43 seldepth 47 multipv 1 score cp 30 nodes 1200353499 nps 925672 hashfull 1000 tbhits 0 time 1296737 pv d2d4 d7d5 c2c4 e7e6 b1c3 f8b4 c4d5 e6d5 a2a3 b4c3 b2c3 c7c5 e2e3 c5c4 e3e4 b8c6 g1e2 d5e4 e2g3 c6a5 g3e4 g8e7 f1c4 a5c4 d1a4 c8d7 a4c4 e8g8 e1g1 a8c8 c4e2 d7c6 f2f3 f8e8 e2d3 info depth 44 currmove d2d4 currmovenumber 1 info depth 44 currmove e2e4 currmovenumber 2 info depth 44 currmove c2c4 currmovenumber 3 info depth 44 currmove e2e3 currmovenumber 4 info depth 44 currmove c2c3 currmovenumber 5 info depth 44 currmove g1f3 currmovenumber 6 info depth 44 currmove d2d3 currmovenumber 7 info depth 44 currmove a2a3 currmovenumber 8 info depth 44 currmove b1a3 currmovenumber 9 info depth 44 currmove b1c3 currmovenumber 10 info depth 44 currmove b2b3 currmovenumber 11 info depth 44 currmove a2a4 currmovenumber 12 info depth 44 currmove b2b4 currmovenumber 13 info depth 44 currmove g2g4 currmovenumber 14 info depth 44 currmove h2h4 currmovenumber 15 info depth 44 currmove f2f3 currmovenumber 16 info depth 44 currmove g2g3 currmovenumber 17 info depth 44 currmove h2h3 currmovenumber 18 info depth 44 currmove f2f4 currmovenumber 19 info depth 44 currmove g1h3 currmovenumber 20 info depth 44 seldepth 46 multipv 1 score cp 26 upperbound nodes 1428557872 nps 921249 hashfull 1000 tbhits 0 time 1550674 pv d2d4 g8f6 info depth 44 currmove d2d4 currmovenumber 1 info depth 44 seldepth 49 multipv 1 score cp 34 lowerbound nodes 1560716314 nps 923004 hashfull 1000 tbhits 0 time 1690909 pv d2d4 info depth 43 currmove d2d4 currmovenumber 1 info depth 43 currmove e2e4 currmovenumber 2 info depth 43 currmove c2c4 currmovenumber 3 info depth 43 currmove g1f3 currmovenumber 4 info depth 43 currmove e2e3 currmovenumber 5 info depth 43 currmove a2a3 currmovenumber 6 info depth 43 currmove b1c3 currmovenumber 7 info depth 43 currmove a2a4 currmovenumber 8 info depth 43 currmove h2h3 currmovenumber 9 info depth 43 currmove c2c3 currmovenumber 10 info depth 43 currmove g2g3 currmovenumber 11 info depth 43 currmove f2f4 currmovenumber 12 info depth 43 currmove f2f3 currmovenumber 13 info depth 43 currmove b2b3 currmovenumber 14 info depth 43 currmove b1a3 currmovenumber 15 info depth 43 currmove d2d3 currmovenumber 16 info depth 43 currmove h2h4 currmovenumber 17 info depth 43 currmove g1h3 currmovenumber 18 info depth 43 currmove b2b4 currmovenumber 19 info depth 43 currmove g2g4 currmovenumber 20 info depth 44 seldepth 49 multipv 1 score cp 43 nodes 1631166965 nps 913238 hashfull 1000 tbhits 0 time 1786134 pv d2d4 g8f6 c2c4 e7e6 g1f3 d7d5 b1c3 d5c4 e2e4 f8b4 f1c4 f6e4 e1g1 e4f6 d1a4 b8c6 f3e5 a8b8 f1d1 e8g8 e5c6 b7c6 a4a7 c8b7 a7a4 d8e7 a2a3 b4d6 a4c2 c6c5 d4c5 d6c5 b2b4 c5b6 c2e2 b8d8 c1e3 d8d1 a1d1 f8d8 d1d8 e7d8 c3b5 d8a8 e3b6 info depth 45 currmove d2d4 currmovenumber 1 info depth 45 currmove e2e4 currmovenumber 2 info depth 45 currmove b1c3 currmovenumber 3 info depth 45 currmove h2h4 currmovenumber 4 info depth 45 currmove g2g3 currmovenumber 5 info depth 45 currmove c2c3 currmovenumber 6 info depth 45 currmove d2d3 currmovenumber 7 info depth 45 currmove g1f3 currmovenumber 8 info depth 45 currmove f2f4 currmovenumber 9 info depth 45 currmove a2a3 currmovenumber 10 info depth 45 currmove e2e3 currmovenumber 11 info depth 45 currmove c2c4 currmovenumber 12 info depth 45 currmove h2h3 currmovenumber 13 info depth 45 currmove b2b3 currmovenumber 14 info depth 45 currmove f2f3 currmovenumber 15 info depth 45 currmove a2a4 currmovenumber 16 info depth 45 currmove b2b4 currmovenumber 17 info depth 45 currmove g2g4 currmovenumber 18 info depth 45 currmove b1a3 currmovenumber 19 info depth 45 currmove g1h3 currmovenumber 20 info depth 45 seldepth 49 multipv 1 score cp 32 upperbound nodes 1918489174 nps 904847 hashfull 1000 tbhits 0 time 2120235 pv d2d4 g8f6 info depth 45 currmove d2d4 currmovenumber 1 info depth 45 seldepth 49 multipv 1 score cp 39 lowerbound nodes 1924259461 nps 904759 hashfull 1000 tbhits 0 time 2126819 pv d2d4 info depth 44 currmove d2d4 currmovenumber 1 info depth 44 currmove e2e4 currmovenumber 2 info depth 44 currmove g2g3 currmovenumber 3 info depth 44 currmove c2c4 currmovenumber 4 info depth 44 currmove b2b4 currmovenumber 5 info depth 44 currmove g1f3 currmovenumber 6 info depth 44 currmove e2e3 currmovenumber 7 info depth 44 currmove c2c3 currmovenumber 8 info depth 44 currmove b1c3 currmovenumber 9 info depth 44 currmove g2g4 currmovenumber 10 info depth 44 currmove h2h3 currmovenumber 11 info depth 44 currmove f2f3 currmovenumber 12 info depth 44 currmove a2a3 currmovenumber 13 info depth 44 currmove a2a4 currmovenumber 14 info depth 44 currmove h2h4 currmovenumber 15 info depth 44 currmove b2b3 currmovenumber 16 info depth 44 currmove d2d3 currmovenumber 17 info depth 44 currmove f2f4 currmovenumber 18 info depth 44 currmove b1a3 currmovenumber 19 info depth 44 currmove g1h3 currmovenumber 20 info depth 45 seldepth 52 multipv 1 score cp 24 upperbound nodes 2376888963 nps 901207 hashfull 1000 tbhits 0 time 2637450 pv d2d4 g8f6 info depth 45 currmove d2d4 currmovenumber 1 info depth 45 currmove e2e4 currmovenumber 2 info depth 45 seldepth 52 multipv 1 score cp 37 lowerbound nodes 2833214147 nps 906880 hashfull 1000 tbhits 0 time 3124132 pv e2e4 info depth 44 currmove e2e4 currmovenumber 1 info depth 44 currmove d2d4 currmovenumber 2 info depth 44 currmove g1f3 currmovenumber 3 info depth 44 currmove b1c3 currmovenumber 4 info depth 44 currmove c2c3 currmovenumber 5 info depth 44 currmove d2d3 currmovenumber 6 info depth 44 currmove h2h3 currmovenumber 7 info depth 44 currmove c2c4 currmovenumber 8 info depth 44 currmove a2a3 currmovenumber 9 info depth 44 currmove f2f3 currmovenumber 10 info depth 44 currmove h2h4 currmovenumber 11 info depth 44 currmove a2a4 currmovenumber 12 info depth 44 currmove f2f4 currmovenumber 13 info depth 44 currmove b2b3 currmovenumber 14 info depth 44 currmove g2g3 currmovenumber 15 info depth 44 currmove g1h3 currmovenumber 16 info depth 44 currmove e2e3 currmovenumber 17 info depth 44 currmove b2b4 currmovenumber 18 info depth 44 currmove g2g4 currmovenumber 19 info depth 44 currmove b1a3 currmovenumber 20 info depth 45 seldepth 52 multipv 1 score cp 30 nodes 3061449302 nps 898010 hashfull 1000 tbhits 0 time 3409147 pv e2e4 e7e5 g1f3 b8c6 f1c4 f8c5 d2d3 g8f6 e1g1 d7d6 c2c3 e8g8 b2b4 c5b6 b1d2 c6e7 h2h3 e7g6 d3d4 a7a5 d4e5 g6e5 f3e5 d6e5 a2a4 a5b4 c3b4 d8d4 a1a3 f6e4 info depth 46 currmove e2e4 currmovenumber 1 info depth 46 seldepth 49 multipv 1 score cp 38 lowerbound nodes 3590976839 nps 896147 hashfull 1000 tbhits 0 time 4007129 pv e2e4 info depth 45 currmove e2e4 currmovenumber 1 info depth 45 currmove d2d4 currmovenumber 2 info depth 45 currmove g1f3 currmovenumber 3 info depth 45 currmove b1c3 currmovenumber 4 info depth 45 currmove d2d3 currmovenumber 5 info depth 45 currmove h2h3 currmovenumber 6 info depth 45 currmove h2h4 currmovenumber 7 info depth 45 currmove e2e3 currmovenumber 8 info depth 45 currmove g2g3 currmovenumber 9 info depth 45 currmove c2c4 currmovenumber 10 info depth 45 currmove c2c3 currmovenumber 11 info depth 45 currmove b1a3 currmovenumber 12 info depth 45 currmove b2b3 currmovenumber 13 info depth 45 currmove a2a4 currmovenumber 14 info depth 45 currmove b2b4 currmovenumber 15 info depth 45 currmove a2a3 currmovenumber 16 info depth 45 currmove f2f3 currmovenumber 17 info depth 45 currmove f2f4 currmovenumber 18 info depth 45 currmove g2g4 currmovenumber 19 info depth 45 currmove g1h3 currmovenumber 20 info depth 46 seldepth 49 multipv 1 score cp 30 nodes 3630740184 nps 895254 hashfull 1000 tbhits 0 time 4055540 pv e2e4 e7e5 g1f3 b8c6 f1b5 g8f6 e1g1 f6e4 f1e1 e4d6 f3e5 c6e5 e1e5 f8e7 b5f1 e8g8 d2d4 e7f6 e5e1 f8e8 c1f4 e8e1 d1e1 d6e8 c2c3 d7d5 b1d2 f6e7 e1e3 c8f5 h2h3 c7c6 a1e1 e7f8 c3c4 d5c4 f1c4 info depth 47 currmove e2e4 currmovenumber 1 info depth 47 seldepth 52 multipv 1 score cp 39 lowerbound nodes 3953331872 nps 894913 hashfull 1000 tbhits 0 time 4417556 pv e2e4 info depth 46 currmove e2e4 currmovenumber 1 info depth 46 currmove d2d4 currmovenumber 2 info depth 46 currmove b1c3 currmovenumber 3 info depth 46 currmove c2c3 currmovenumber 4 info depth 46 currmove f2f4 currmovenumber 5 info depth 46 currmove g1f3 currmovenumber 6 info depth 46 currmove h2h3 currmovenumber 7 info depth 46 currmove b1a3 currmovenumber 8 info depth 46 currmove a2a4 currmovenumber 9 info depth 46 currmove g2g3 currmovenumber 10 info depth 46 currmove a2a3 currmovenumber 11 info depth 46 currmove d2d3 currmovenumber 12 info depth 46 currmove f2f3 currmovenumber 13 info depth 46 currmove h2h4 currmovenumber 14 info depth 46 currmove g2g4 currmovenumber 15 info depth 46 currmove e2e3 currmovenumber 16 info depth 46 currmove c2c4 currmovenumber 17 info depth 46 currmove b2b3 currmovenumber 18 info depth 46 currmove b2b4 currmovenumber 19 info depth 46 currmove g1h3 currmovenumber 20 info depth 47 seldepth 52 multipv 1 score cp 38 nodes 4657320740 nps 894984 hashfull 1000 tbhits 0 time 5203803 pv e2e4 c7c5 g1f3 d7d6 d2d4 c5d4 f3d4 g8f6 b1c3 a7a6 f1e2 e7e5 d4b3 f8e7 e1g1 e8g8 e2f3 b7b5 a2a4 c8b7 a4b5 a6b5 a1a8 b7a8 c1g5 b5b4 g5f6 e7f6 c3d5 a8d5 d1d5 d8c7 b3a5 g7g6 a5c4 f6e7 f1d1 b8d7 c4d6 c7c2 d6c4 e7c5 info depth 48 currmove e2e4 currmovenumber 1 info depth 48 currmove d2d4 currmovenumber 2 info depth 48 currmove e2e3 currmovenumber 3 info depth 48 currmove g1f3 currmovenumber 4 info depth 48 currmove c2c4 currmovenumber 5 info depth 48 currmove b1c3 currmovenumber 6 info depth 48 currmove c2c3 currmovenumber 7 info depth 48 currmove a2a3 currmovenumber 8 info depth 48 currmove f2f4 currmovenumber 9 info depth 48 currmove a2a4 currmovenumber 10 info depth 48 currmove b2b3 currmovenumber 11 info depth 48 currmove d2d3 currmovenumber 12 info depth 48 currmove h2h4 currmovenumber 13 info depth 48 currmove h2h3 currmovenumber 14 info depth 48 currmove g2g3 currmovenumber 15 info depth 48 currmove b2b4 currmovenumber 16 info depth 48 currmove g1h3 currmovenumber 17 info depth 48 currmove f2f3 currmovenumber 18 info depth 48 currmove g2g4 currmovenumber 19 info depth 48 currmove b1a3 currmovenumber 20 info depth 48 seldepth 48 multipv 1 score cp 30 upperbound nodes 5102206641 nps 890960 hashfull 1000 tbhits 0 time 5726636 pv e2e4 e7e5 info depth 48 currmove e2e4 currmovenumber 1 info depth 48 seldepth 48 multipv 1 score cp 37 lowerbound nodes 5197445102 nps 891929 hashfull 1000 tbhits 0 time 5827192 pv e2e4 info depth 47 currmove e2e4 currmovenumber 1 info depth 47 currmove d2d4 currmovenumber 2 info depth 47 currmove b1c3 currmovenumber 3 info depth 47 currmove c2c3 currmovenumber 4 info depth 47 currmove g1f3 currmovenumber 5 info depth 47 currmove d2d3 currmovenumber 6 info depth 47 currmove a2a3 currmovenumber 7 info depth 47 currmove a2a4 currmovenumber 8 info depth 47 currmove e2e3 currmovenumber 9 info depth 47 currmove c2c4 currmovenumber 10 info depth 47 currmove g2g3 currmovenumber 11 info depth 47 currmove f2f3 currmovenumber 12 info depth 47 currmove b2b3 currmovenumber 13 info depth 47 currmove h2h3 currmovenumber 14 info depth 47 currmove b2b4 currmovenumber 15 info depth 47 currmove f2f4 currmovenumber 16 info depth 47 currmove g2g4 currmovenumber 17 info depth 47 currmove h2h4 currmovenumber 18 info depth 47 currmove b1a3 currmovenumber 19 info depth 47 currmove g1h3 currmovenumber 20 info depth 48 seldepth 55 multipv 1 score cp 37 nodes 5768095042 nps 896234 hashfull 1000 tbhits 0 time 6435920 pv e2e4 e7e5 g1f3 b8c6 f1b5 a7a6 b5a4 g8f6 e1g1 f6e4 d2d4 b7b5 a4b3 d7d5 d4e5 c8e6 c2c3 f8c5 d1d3 f7f5 e5f6 d8f6 c1e3 c5e3 d3e3 e8g8 b1d2 a8e8 d2e4 d5e4 f3g5 e6b3 a2b3 c6e5 g5e4 f6g6 f2f3 f8f3 f1f3 e5f3 e3f3 e8e4 f3h3 c7c5 info depth 49 currmove e2e4 currmovenumber 1 info depth 49 seldepth 49 multipv 1 score cp 44 lowerbound nodes 6274569798 nps 890619 hashfull 1000 tbhits 0 time 7045174 pv e2e4 info depth 48 currmove e2e4 currmovenumber 1 info depth 48 currmove d2d4 currmovenumber 2 info depth 48 currmove b1c3 currmovenumber 3 info depth 48 currmove g1f3 currmovenumber 4 info depth 48 currmove c2c3 currmovenumber 5 info depth 48 currmove c2c4 currmovenumber 6 info depth 48 currmove a2a4 currmovenumber 7 info depth 48 currmove f2f4 currmovenumber 8 info depth 48 currmove f2f3 currmovenumber 9 info depth 48 currmove b2b4 currmovenumber 10 info depth 48 currmove d2d3 currmovenumber 11 info depth 48 currmove h2h3 currmovenumber 12 info depth 48 currmove g2g4 currmovenumber 13 info depth 48 currmove g2g3 currmovenumber 14 info depth 48 currmove a2a3 currmovenumber 15 info depth 48 currmove b2b3 currmovenumber 16 info depth 48 currmove e2e3 currmovenumber 17 info depth 48 currmove h2h4 currmovenumber 18 info depth 48 currmove b1a3 currmovenumber 19 info depth 48 currmove g1h3 currmovenumber 20 info depth 49 seldepth 51 multipv 1 score cp 32 nodes 6515996845 nps 895936 hashfull 1000 tbhits 0 time 7272836 pv e2e4 e7e5 g1f3 b8c6 f1b5 a7a6 b5a4 g8f6 e1g1 f8e7 f1e1 b7b5 a4b3 e8g8 c2c3 c6a5 b3c2 d7d5 e4d5 e5e4 c2e4 f6e4 e1e4 f8e8 d2d4 c8b7 e4e2 b7d5 b1d2 c7c5 e2e1 c5d4 f3d4 e7f6 d2f3 a5c4 a2a4 e8e1 d1e1 info depth 50 currmove e2e4 currmovenumber 1 info depth 50 seldepth 52 multipv 1 score cp 42 lowerbound nodes 6770999436 nps 901134 hashfull 1000 tbhits 0 time 7513865 pv e2e4 info depth 49 currmove e2e4 currmovenumber 1 info depth 49 currmove d2d4 currmovenumber 2 info depth 49 currmove b1c3 currmovenumber 3 info depth 49 currmove c2c3 currmovenumber 4 info depth 49 currmove g1f3 currmovenumber 5 info depth 49 currmove f2f4 currmovenumber 6 info depth 49 currmove b1a3 currmovenumber 7 info depth 49 currmove f2f3 currmovenumber 8 info depth 49 currmove d2d3 currmovenumber 9 info depth 49 currmove h2h4 currmovenumber 10 info depth 49 currmove a2a4 currmovenumber 11 info depth 49 currmove g2g3 currmovenumber 12 info depth 49 currmove a2a3 currmovenumber 13 info depth 49 currmove b2b3 currmovenumber 14 info depth 49 currmove e2e3 currmovenumber 15 info depth 49 currmove h2h3 currmovenumber 16 info depth 49 currmove b2b4 currmovenumber 17 info depth 49 currmove c2c4 currmovenumber 18 info depth 49 currmove g2g4 currmovenumber 19 info depth 49 currmove g1h3 currmovenumber 20 info depth 50 seldepth 52 multipv 1 score cp 27 upperbound nodes 7734384603 nps 915098 hashfull 1000 tbhits 0 time 8451967 pv e2e4 e7e5 info depth 50 currmove e2e4 currmovenumber 1 info depth 50 currmove d2d4 currmovenumber 2 info depth 50 currmove e2e3 currmovenumber 3 info depth 50 currmove b1c3 currmovenumber 4 info depth 50 currmove h2h3 currmovenumber 5 info depth 50 currmove g1f3 currmovenumber 6 info depth 50 currmove c2c4 currmovenumber 7 info depth 50 currmove h2h4 currmovenumber 8 info depth 50 currmove f2f3 currmovenumber 9 info depth 50 currmove g2g3 currmovenumber 10 info depth 50 currmove d2d3 currmovenumber 11 info depth 50 currmove c2c3 currmovenumber 12 info depth 50 currmove a2a3 currmovenumber 13 info depth 50 currmove b2b4 currmovenumber 14 info depth 50 currmove a2a4 currmovenumber 15 info depth 50 currmove b2b3 currmovenumber 16 info depth 50 currmove g1h3 currmovenumber 17 info depth 50 currmove f2f4 currmovenumber 18 info depth 50 currmove g2g4 currmovenumber 19 info depth 50 currmove b1a3 currmovenumber 20 info depth 50 seldepth 56 multipv 1 score cp 23 nodes 9547990033 nps 910151 hashfull 1000 tbhits 0 time 10490554 pv e2e4 e7e5 g1f3 b8c6 f1b5 g8f6 e1g1 f6e4 f1e1 e4d6 f3e5 c6e5 e1e5 f8e7 b5f1 e8g8 d2d4 d6e8 c2c4 e7f6 e5e1 d7d5 c4d5 d8d5 c1e3 c8e6 b1c3 d5a5 c3e4 a8d8 b2b4 a5d5 d1c2 c7c6 a1d1 d5a2 c2a2 e6a2 d1a1 a2d5 e4f6 e8f6 a1a7 d8d7 f2f3 f8d8 e3f2 d5e6 info depth 51 currmove e2e4 currmovenumber 1 info depth 51 seldepth 51 multipv 1 score cp 33 lowerbound nodes 9608545544 nps 909836 hashfull 1000 tbhits 0 time 10560743 pv e2e4 info depth 50 currmove e2e4 currmovenumber 1 info depth 51 seldepth 59 multipv 1 score cp 40 lowerbound nodes 9818672036 nps 909431 hashfull 1000 tbhits 0 time 10796489 pv e2e4 info depth 49 currmove e2e4 currmovenumber 1 info depth 49 currmove d2d4 currmovenumber 2 info depth 49 currmove g1f3 currmovenumber 3 info depth 49 currmove b1c3 currmovenumber 4 info depth 49 currmove d2d3 currmovenumber 5 info depth 49 currmove c2c3 currmovenumber 6 info depth 49 currmove f2f3 currmovenumber 7 info depth 49 currmove h2h3 currmovenumber 8 info depth 49 currmove a2a3 currmovenumber 9 info depth 49 currmove c2c4 currmovenumber 10 info depth 49 currmove f2f4 currmovenumber 11 info depth 49 currmove g2g3 currmovenumber 12 info depth 49 currmove b2b3 currmovenumber 13 info depth 49 currmove e2e3 currmovenumber 14 info depth 49 currmove a2a4 currmovenumber 15 info depth 49 currmove b2b4 currmovenumber 16 info depth 49 currmove g2g4 currmovenumber 17 info depth 49 currmove h2h4 currmovenumber 18 info depth 49 currmove b1a3 currmovenumber 19 info depth 49 currmove g1h3 currmovenumber 20 info depth 51 seldepth 59 multipv 1 score cp 33 nodes 9832259931 nps 909409 hashfull 1000 tbhits 0 time 10811694 pv e2e4 e7e5 g1f3 b8c6 f1b5 g8f6 e1g1 f6e4 f1e1 e4d6 f3e5 c6e5 e1e5 f8e7 b5f1 e8g8 d2d4 e7f6 e5e1 f8e8 c2c3 e8e1 d1e1 d6f5 c1f4 c7c6 b1d2 d7d5 a2a4 a7a5 f4c7 d8f8 f1d3 g7g6 d3f5 c8f5 e1e3 f6d8 c7d8 a8d8 a1e1 f5d7 e3f4 d8e8 info depth 52 currmove e2e4 currmovenumber 1 info depth 52 seldepth 55 multipv 1 score cp 42 lowerbound nodes 10434596347 nps 908656 hashfull 1000 tbhits 0 time 11483540 pv e2e4 info depth 51 currmove e2e4 currmovenumber 1 info depth 51 currmove d2d4 currmovenumber 2 info depth 51 currmove c2c3 currmovenumber 3 info depth 51 currmove g1f3 currmovenumber 4 info depth 51 currmove b1c3 currmovenumber 5 info depth 51 currmove f2f3 currmovenumber 6 info depth 51 currmove h2h3 currmovenumber 7 info depth 51 currmove g2g3 currmovenumber 8 info depth 51 currmove d2d3 currmovenumber 9 info depth 51 currmove a2a3 currmovenumber 10 info depth 51 currmove b2b3 currmovenumber 11 info depth 51 currmove e2e3 currmovenumber 12 info depth 51 currmove a2a4 currmovenumber 13 info depth 51 currmove b2b4 currmovenumber 14 info depth 51 currmove c2c4 currmovenumber 15 info depth 51 currmove f2f4 currmovenumber 16 info depth 51 currmove g2g4 currmovenumber 17 info depth 51 currmove h2h4 currmovenumber 18 info depth 51 currmove b1a3 currmovenumber 19 info depth 51 currmove g1h3 currmovenumber 20 info depth 52 seldepth 55 multipv 1 score cp 26 upperbound nodes 11085265250 nps 908218 hashfull 1000 tbhits 0 time 12205500 pv e2e4 e7e5 info depth 52 currmove e2e4 currmovenumber 1 info depth 52 currmove d2d4 currmovenumber 2 info depth 52 currmove b1c3 currmovenumber 3 info depth 52 currmove g1f3 currmovenumber 4 info depth 52 currmove c2c3 currmovenumber 5 info depth 52 currmove h2h3 currmovenumber 6 info depth 52 currmove g2g3 currmovenumber 7 info depth 52 currmove f2f3 currmovenumber 8 info depth 52 currmove d2d3 currmovenumber 9 info depth 52 currmove h2h4 currmovenumber 10 info depth 52 currmove g2g4 currmovenumber 11 info depth 52 currmove b2b4 currmovenumber 12 info depth 52 currmove a2a3 currmovenumber 13 info depth 52 currmove c2c4 currmovenumber 14 info depth 52 currmove f2f4 currmovenumber 15 info depth 52 currmove a2a4 currmovenumber 16 info depth 52 currmove e2e3 currmovenumber 17 info depth 52 currmove b1a3 currmovenumber 18 info depth 52 currmove b2b3 currmovenumber 19 info depth 52 currmove g1h3 currmovenumber 20 info depth 52 seldepth 57 multipv 1 score cp 29 nodes 11265326121 nps 908198 hashfull 1000 tbhits 0 time 12404036 pv e2e4 e7e5 g1f3 b8c6 f1b5 g8f6 e1g1 f6e4 f1e1 e4d6 f3e5 c6e5 e1e5 f8e7 b5f1 e8g8 d2d4 e7f6 e5e1 f8e8 c2c3 e8e1 d1e1 d8e7 e1e7 f6e7 h2h3 d6e8 a2a4 d7d5 a4a5 a8b8 c1e3 e8d6 e3f4 g7g5 f4h2 f7f5 a5a6 b7a6 info depth 53 currmove e2e4 currmovenumber 1 info depth 53 seldepth 57 multipv 1 score cp 37 lowerbound nodes 11404770369 nps 907066 hashfull 1000 tbhits 0 time 12573242 pv e2e4 info depth 52 currmove e2e4 currmovenumber 1 info depth 52 currmove d2d4 currmovenumber 2 info depth 52 currmove g1f3 currmovenumber 3 info depth 52 currmove b1c3 currmovenumber 4 info depth 52 currmove d2d3 currmovenumber 5 info depth 52 currmove c2c4 currmovenumber 6 info depth 52 currmove c2c3 currmovenumber 7 info depth 52 currmove b2b4 currmovenumber 8 info depth 52 currmove g2g3 currmovenumber 9 info depth 52 currmove b1a3 currmovenumber 10 info depth 52 currmove a2a3 currmovenumber 11 info depth 52 currmove f2f3 currmovenumber 12 info depth 52 currmove h2h3 currmovenumber 13 info depth 52 currmove g1h3 currmovenumber 14 info depth 52 currmove g2g4 currmovenumber 15 info depth 52 currmove b2b3 currmovenumber 16 info depth 52 currmove e2e3 currmovenumber 17 info depth 52 currmove a2a4 currmovenumber 18 info depth 52 currmove f2f4 currmovenumber 19 info depth 52 currmove h2h4 currmovenumber 20 info depth 53 seldepth 57 multipv 1 score cp 34 nodes 14974244738 nps 901712 hashfull 1000 tbhits 0 time 16606443 pv e2e4 c7c6 b1c3 d7d5 g1f3 d5e4 c3e4 g8f6 e4f6 e7f6 f1e2 f8d6 e1g1 e8g8 d2d4 f8e8 f1e1 c8e6 c2c4 b8d7 h2h3 d7f8 e2f1 d8d7 d1a4 h7h6 c1d2 a7a6 a4b3 e6f5 d2a5 f8e6 a1d1 e6g5 f3e5 d7c8 e5d3 e8e1 d1e1 g5e6 a5c3 c8d7 d4d5 info depth 54 currmove e2e4 currmovenumber 1 info depth 54 seldepth 57 multipv 1 score cp 41 lowerbound nodes 15638652565 nps 899917 hashfull 1000 tbhits 0 time 17377880 pv e2e4 info depth 53 currmove e2e4 currmovenumber 1 info depth 53 currmove d2d4 currmovenumber 2 info depth 53 currmove b1c3 currmovenumber 3 info depth 53 currmove c2c3 currmovenumber 4 info depth 53 currmove h2h4 currmovenumber 5 info depth 53 currmove c2c4 currmovenumber 6 info depth 53 currmove g1f3 currmovenumber 7 info depth 53 currmove f2f3 currmovenumber 8 info depth 53 currmove d2d3 currmovenumber 9 info depth 53 currmove b2b3 currmovenumber 10 info depth 53 currmove a2a3 currmovenumber 11 info depth 53 currmove g2g3 currmovenumber 12 info depth 53 currmove f2f4 currmovenumber 13 info depth 53 currmove b1a3 currmovenumber 14 info depth 53 currmove e2e3 currmovenumber 15 info depth 53 currmove h2h3 currmovenumber 16 info depth 53 currmove a2a4 currmovenumber 17 info depth 53 currmove b2b4 currmovenumber 18 info depth 53 currmove g2g4 currmovenumber 19 info depth 53 currmove g1h3 currmovenumber 20 info depth 54 seldepth 57 multipv 1 score cp 32 nodes 23363483807 nps 883357 hashfull 1000 tbhits 0 time 26448493 pv e2e4 c7c6 b1c3 d7d5 g1f3 c8g4 h2h3 g4f3 d1f3 e7e6 g2g3 g8f6 f1g2 f8b4 e1g1 e8g8 f3e2 b4c3 d2c3 f6e4 g2e4 d5e4 f1d1 b8d7 e2e4 d8e8 a2a4 f7f5 e4c4 g8h8 d1d6 d7b6 c4b3 e8h5 a4a5 b6d5 c3c4 d5f6 b3b7 e6e5 b7c6 f6e4 d6e6 a8c8 c6b7 h5d1 g1g2 info depth 55 currmove e2e4 currmovenumber 1 info depth 55 seldepth 55 multipv 1 score cp 41 lowerbound nodes 27218395056 nps 874166 hashfull 1000 tbhits 0 time 31136405 pv e2e4 info depth 54 currmove e2e4 currmovenumber 1 info depth 54 currmove d2d4 currmovenumber 2 info depth 54 currmove g1f3 currmovenumber 3 info depth 54 currmove b1c3 currmovenumber 4 info depth 54 currmove d2d3 currmovenumber 5 info depth 54 currmove c2c3 currmovenumber 6 info depth 54 currmove c2c4 currmovenumber 7 info depth 54 currmove b1a3 currmovenumber 8 info depth 54 currmove b2b4 currmovenumber 9 info depth 54 currmove g2g3 currmovenumber 10 info depth 54 currmove g1h3 currmovenumber 11 info depth 54 currmove a2a4 currmovenumber 12 info depth 54 currmove a2a3 currmovenumber 13 info depth 54 currmove b2b3 currmovenumber 14 info depth 54 currmove f2f3 currmovenumber 15 info depth 54 currmove e2e3 currmovenumber 16 info depth 54 currmove h2h3 currmovenumber 17 info depth 54 currmove f2f4 currmovenumber 18 info depth 54 currmove g2g4 currmovenumber 19 info depth 54 currmove h2h4 currmovenumber 20 info depth 55 seldepth 58 multipv 1 score cp 44 nodes 32769832013 nps 865820 hashfull 1000 tbhits 0 time 37848280 pv e2e4 e7e6 d2d4 d7d5 e4e5 c7c5 c2c3 b8c6 g1f3 c8d7 f1e2 g8e7 e1g1 e7g6 f1e1 f8e7 a2a3 e8g8 c1e3 d7e8 b1d2 c5d4 c3d4 f7f6 e5f6 e7f6 d2b3 e6e5 d4e5 g6e5 e3c5 f8f7 a1c1 b7b6 c5d4 c6d4 b3d4 f7e7 d1b3 g8h8 e2b5 e5f3 d4f3 e7e1 c1e1 info depth 56 currmove e2e4 currmovenumber 1 info depth 56 currmove d2d4 currmovenumber 2 info depth 56 currmove c2c4 currmovenumber 3 info depth 56 currmove a2a3 currmovenumber 4 info depth 56 currmove b1c3 currmovenumber 5 info depth 56 currmove c2c3 currmovenumber 6 info depth 56 currmove g1f3 currmovenumber 7 info depth 56 currmove d2d3 currmovenumber 8 info depth 56 currmove b2b3 currmovenumber 9 info depth 56 currmove g2g4 currmovenumber 10 info depth 56 currmove e2e3 currmovenumber 11 info depth 56 currmove h2h4 currmovenumber 12 info depth 56 currmove f2f3 currmovenumber 13 info depth 56 currmove g2g3 currmovenumber 14 info depth 56 currmove a2a4 currmovenumber 15 info depth 56 currmove b1a3 currmovenumber 16 info depth 56 currmove h2h3 currmovenumber 17 info depth 56 currmove b2b4 currmovenumber 18 info depth 56 currmove f2f4 currmovenumber 19 info depth 56 currmove g1h3 currmovenumber 20 info depth 56 seldepth 58 multipv 1 score cp 34 upperbound nodes 35665222170 nps 864616 hashfull 1000 tbhits 0 time 41249776 pv e2e4 e7e6 info depth 56 currmove e2e4 currmovenumber 1 info depth 56 currmove d2d4 currmovenumber 2 info depth 56 currmove g1f3 currmovenumber 3 info depth 56 currmove c2c4 currmovenumber 4 info depth 56 currmove c2c3 currmovenumber 5 info depth 56 currmove b1c3 currmovenumber 6 info depth 56 currmove e2e3 currmovenumber 7 info depth 56 currmove b2b4 currmovenumber 8 info depth 56 currmove a2a4 currmovenumber 9 info depth 56 currmove g1h3 currmovenumber 10 info depth 56 currmove a2a3 currmovenumber 11 info depth 56 currmove g2g3 currmovenumber 12 info depth 56 currmove h2h3 currmovenumber 13 info depth 56 currmove b2b3 currmovenumber 14 info depth 56 currmove d2d3 currmovenumber 15 info depth 56 currmove f2f3 currmovenumber 16 info depth 56 currmove f2f4 currmovenumber 17 info depth 56 currmove g2g4 currmovenumber 18 info depth 56 currmove h2h4 currmovenumber 19 info depth 56 currmove b1a3 currmovenumber 20 info depth 56 seldepth 58 multipv 1 score cp 26 upperbound nodes 42149922465 nps 873252 hashfull 1000 tbhits 0 time 48267756 pv e2e4 e7e5 info depth 56 currmove e2e4 currmovenumber 1 info depth 56 currmove d2d4 currmovenumber 2 info depth 56 currmove g1f3 currmovenumber 3 info depth 56 seldepth 63 multipv 1 score cp 34 lowerbound nodes 83488049837 nps 955007 hashfull 1000 tbhits 0 time 87421354 pv g1f3 info depth 55 currmove g1f3 currmovenumber 1 info depth 55 currmove e2e4 currmovenumber 2 info depth 55 currmove d2d4 currmovenumber 3 info depth 55 currmove c2c4 currmovenumber 4 info depth 55 currmove g2g3 currmovenumber 5 info depth 55 currmove c2c3 currmovenumber 6 info depth 55 currmove e2e3 currmovenumber 7 info depth 55 currmove b1c3 currmovenumber 8 info depth 55 currmove d2d3 currmovenumber 9 info depth 55 currmove h2h3 currmovenumber 10 info depth 55 currmove a2a4 currmovenumber 11 info depth 55 currmove f2f4 currmovenumber 12 info depth 55 currmove f2f3 currmovenumber 13 info depth 55 currmove h2h4 currmovenumber 14 info depth 55 currmove a2a3 currmovenumber 15 info depth 55 currmove b2b3 currmovenumber 16 info depth 55 currmove b2b4 currmovenumber 17 info depth 55 currmove g2g4 currmovenumber 18 info depth 55 currmove b1a3 currmovenumber 19 info depth 55 currmove g1h3 currmovenumber 20 info depth 56 seldepth 63 multipv 1 score cp 33 nodes 95203126340 nps 951599 hashfull 1000 tbhits 0 time 100045424 pv g1f3 d7d5 d2d4 g8f6 c2c4 e7e6 b1c3 f8e7 c1f4 e8g8 e2e3 b7b6 c4d5 f6d5 c3d5 d8d5 f4c7 e7b4 f3d2 b8c6 f2f3 c8d7 e1f2 c6d4 d2e4 d4b5 d1d5 e6d5 f1b5 d7b5 e4d6 b4d6 c7d6 f8c8 h1c1 f7f6 d6b4 a7a5 b4d2 a5a4 d2b4 c8c1 info depth 57 currmove g1f3 currmovenumber 1 info depth 57 currmove e2e4 currmovenumber 2 info depth 57 currmove f2f4 currmovenumber 3 info depth 57 currmove c2c3 currmovenumber 4 info depth 57 currmove d2d4 currmovenumber 5 info depth 57 seldepth 58 multipv 1 score cp 40 lowerbound nodes 113695096917 nps 947793 hashfull 1000 tbhits 0 time 119957702 pv d2d4 info depth 56 currmove d2d4 currmovenumber 1 info depth 56 currmove g1f3 currmovenumber 2 info depth 56 currmove e2e4 currmovenumber 3 info depth 56 currmove g2g3 currmovenumber 4 info depth 56 currmove b1c3 currmovenumber 5 info depth 56 currmove c2c4 currmovenumber 6 info depth 56 currmove a2a4 currmovenumber 7 info depth 56 currmove c2c3 currmovenumber 8 info depth 56 currmove d2d3 currmovenumber 9 info depth 56 currmove a2a3 currmovenumber 10 info depth 56 currmove e2e3 currmovenumber 11 info depth 56 currmove f2f4 currmovenumber 12 info depth 56 currmove h2h3 currmovenumber 13 info depth 56 currmove b2b3 currmovenumber 14 info depth 56 currmove f2f3 currmovenumber 15 info depth 56 currmove b2b4 currmovenumber 16 info depth 56 currmove g2g4 currmovenumber 17 info depth 56 currmove h2h4 currmovenumber 18 info depth 56 currmove b1a3 currmovenumber 19 info depth 56 currmove g1h3 currmovenumber 20 info depth 57 seldepth 58 multipv 1 score cp 38 nodes 127481224950 nps 941581 hashfull 1000 tbhits 0 time 135390484 pv d2d4 d7d5 c2c4 c7c6 e2e3 g8f6 g1f3 c8f5 b1c3 e7e6 f3h4 f5g6 f1e2 f8e7 e1g1 a7a6 g2g3 d8c7 h4g6 h7g6 d1d3 b8d7 e2f3 e8g8 c1d2 d7b6 b2b3 e7b4 f1d1 a6a5 f3g2 b6c8 c3b1 c8d6 a2a3 b4d2 b1d2 b7b6 d1c1 c7b7 c4c5 b6c5 info depth 58 currmove d2d4 currmovenumber 1 info depth 58 currmove g1f3 currmovenumber 2 info depth 58 currmove e2e4 currmovenumber 3 info depth 58 currmove c2c4 currmovenumber 4 info depth 58 currmove b1c3 currmovenumber 5 info depth 58 currmove h2h3 currmovenumber 6 info depth 58 currmove c2c3 currmovenumber 7 info depth 58 currmove g2g3 currmovenumber 8 info depth 58 currmove h2h4 currmovenumber 9 info depth 58 currmove d2d3 currmovenumber 10 info depth 58 currmove f2f4 currmovenumber 11 info depth 58 currmove f2f3 currmovenumber 12 info depth 58 currmove a2a4 currmovenumber 13 info depth 58 currmove a2a3 currmovenumber 14 info depth 58 currmove b2b3 currmovenumber 15 info depth 58 currmove e2e3 currmovenumber 16 info depth 58 currmove b2b4 currmovenumber 17 info depth 58 currmove g2g4 currmovenumber 18 info depth 58 currmove b1a3 currmovenumber 19 info depth 58 currmove g1h3 currmovenumber 20 info depth 58 seldepth 54 multipv 1 score cp 29 upperbound nodes 151209938605 nps 946827 hashfull 1000 tbhits 0 time 159701599 pv d2d4 d7d5 info depth 58 currmove d2d4 currmovenumber 1 info depth 58 currmove g1f3 currmovenumber 2 info depth 58 currmove b1c3 currmovenumber 3 info depth 58 currmove c2c3 currmovenumber 4 info depth 58 currmove c2c4 currmovenumber 5 info depth 58 currmove e2e4 currmovenumber 6 info depth 58 currmove f2f3 currmovenumber 7 info depth 58 currmove d2d3 currmovenumber 8 info depth 58 currmove a2a3 currmovenumber 9 info depth 58 currmove b2b4 currmovenumber 10 info depth 58 currmove h2h3 currmovenumber 11 info depth 58 currmove b2b3 currmovenumber 12 info depth 58 currmove e2e3 currmovenumber 13 info depth 58 currmove f2f4 currmovenumber 14 info depth 58 currmove g2g3 currmovenumber 15 info depth 58 currmove b1a3 currmovenumber 16 info depth 58 currmove a2a4 currmovenumber 17 info depth 58 currmove g2g4 currmovenumber 18 info depth 58 currmove h2h4 currmovenumber 19 info depth 58 currmove g1h3 currmovenumber 20 info depth 58 seldepth 56 multipv 1 score cp 22 upperbound nodes 179757540798 nps 965051 hashfull 1000 tbhits 0 time 186267352 pv d2d4 g8f6 info depth 58 currmove d2d4 currmovenumber 1 info depth 58 seldepth 60 multipv 1 score cp 29 lowerbound nodes 179836284473 nps 964958 hashfull 1000 tbhits 0 time 186366874 pv d2d4 info depth 57 currmove d2d4 currmovenumber 1 info depth 57 currmove g1f3 currmovenumber 2 info depth 57 currmove c2c4 currmovenumber 3 info depth 57 currmove b1c3 currmovenumber 4 info depth 57 currmove e2e3 currmovenumber 5 info depth 57 currmove e2e4 currmovenumber 6 info depth 57 currmove c2c3 currmovenumber 7 info depth 57 currmove f2f3 currmovenumber 8 info depth 57 currmove b2b3 currmovenumber 9 info depth 57 currmove f2f4 currmovenumber 10 info depth 57 currmove h2h3 currmovenumber 11 info depth 57 currmove g2g3 currmovenumber 12 info depth 57 currmove a2a4 currmovenumber 13 info depth 57 currmove b2b4 currmovenumber 14 info depth 57 currmove a2a3 currmovenumber 15 info depth 57 currmove g1h3 currmovenumber 16 info depth 57 currmove d2d3 currmovenumber 17 info depth 57 currmove g2g4 currmovenumber 18 info depth 57 currmove h2h4 currmovenumber 19 info depth 57 currmove b1a3 currmovenumber 20 info depth 58 seldepth 60 multipv 1 score cp 30 nodes 181835452677 nps 964418 hashfull 1000 tbhits 0 time 188544097 pv d2d4 g8f6 c2c4 e7e6 g1f3 d7d5 g2g3 f8b4 c1d2 b4e7 f1g2 e8g8 d1c2 c7c6 e1g1 b8d7 e2e3 a7a5 f1c1 h7h6 a2a3 f8e8 b2b3 b7b6 c4d5 c6d5 g2f1 c8b7 b1c3 d8b8 c3b5 e8c8 c2b2 c8c1 a1c1 b8d8 b3b4 b7a6 d2e1 e7f8 a3a4 a5b4 e1b4 f8b4 b2b4 info depth 59 currmove d2d4 currmovenumber 1 info depth 59 currmove g1f3 currmovenumber 2 info depth 59 currmove e2e3 currmovenumber 3 info depth 59 currmove c2c4 currmovenumber 4 info depth 59 currmove b1c3 currmovenumber 5 info depth 59 currmove g1h3 currmovenumber 6 info depth 59 currmove e2e4 currmovenumber 7 info depth 59 currmove c2c3 currmovenumber 8 info depth 59 currmove a2a3 currmovenumber 9 info depth 59 currmove b2b3 currmovenumber 10 info depth 59 currmove d2d3 currmovenumber 11 info depth 59 currmove f2f3 currmovenumber 12 info depth 59 currmove g2g3 currmovenumber 13 info depth 59 currmove h2h3 currmovenumber 14 info depth 59 currmove a2a4 currmovenumber 15 info depth 59 currmove b2b4 currmovenumber 16 info depth 59 currmove f2f4 currmovenumber 17 info depth 59 currmove g2g4 currmovenumber 18 info depth 59 currmove h2h4 currmovenumber 19 info depth 59 currmove b1a3 currmovenumber 20 info depth 59 seldepth 57 multipv 1 score cp 21 upperbound nodes 197360655776 nps 962413 hashfull 1000 tbhits 0 time 205068414 pv d2d4 g8f6 info depth 59 currmove d2d4 currmovenumber 1 info depth 59 seldepth 57 multipv 1 score cp 29 lowerbound nodes 201786466038 nps 964680 hashfull 1000 tbhits 0 time 209174409 pv d2d4 info depth 58 currmove d2d4 currmovenumber 1 info depth 58 currmove g1f3 currmovenumber 2 info depth 58 currmove c2c4 currmovenumber 3 info depth 58 currmove c2c3 currmovenumber 4 info depth 58 currmove g2g3 currmovenumber 5 info depth 58 currmove b1c3 currmovenumber 6 info depth 58 currmove h2h4 currmovenumber 7 info depth 58 currmove e2e3 currmovenumber 8 info depth 58 currmove f2f4 currmovenumber 9 info depth 58 currmove h2h3 currmovenumber 10 info depth 58 currmove b2b4 currmovenumber 11 info depth 58 currmove e2e4 currmovenumber 12 info depth 58 currmove a2a3 currmovenumber 13 info depth 58 currmove b2b3 currmovenumber 14 info depth 58 currmove d2d3 currmovenumber 15 info depth 58 currmove f2f3 currmovenumber 16 info depth 58 currmove a2a4 currmovenumber 17 info depth 58 currmove g2g4 currmovenumber 18 info depth 58 currmove b1a3 currmovenumber 19 info depth 58 currmove g1h3 currmovenumber 20 info depth 59 seldepth 59 multipv 1 score cp 24 nodes 203211183233 nps 965371 hashfull 1000 tbhits 0 time 210500417 pv d2d4 g8f6 c2c4 e7e6 g2g3 f8b4 b1d2 d7d5 f1g2 e8g8 g1f3 b7b6 e1g1 c8b7 f3e5 a7a5 a2a3 b4e7 b2b3 c7c5 c1b2 b8c6 e5c6 b7c6 a3a4 a8c8 c4d5 e6d5 a1c1 c6b7 d4c5 e7c5 d2f3 f6e4 d1d3 c8a8 f3d4 d8f6 b2a1 f6g6 d4b5 a8d8 e2e3 info depth 60 currmove d2d4 currmovenumber 1 info depth 60 seldepth 60 multipv 1 score cp 33 lowerbound nodes 225823801873 nps 970578 hashfull 1000 tbhits 0 time 232669164 pv d2d4 info depth 59 currmove d2d4 currmovenumber 1 info depth 59 currmove g1f3 currmovenumber 2 info depth 59 currmove e2e3 currmovenumber 3 info depth 59 currmove a2a3 currmovenumber 4 info depth 59 currmove h2h4 currmovenumber 5 info depth 59 currmove b1c3 currmovenumber 6 info depth 59 currmove e2e4 currmovenumber 7 info depth 59 currmove a2a4 currmovenumber 8 info depth 59 currmove b2b3 currmovenumber 9 info depth 59 currmove c2c3 currmovenumber 10 info depth 59 currmove d2d3 currmovenumber 11 info depth 59 currmove f2f3 currmovenumber 12 info depth 59 currmove g2g3 currmovenumber 13 info depth 59 currmove h2h3 currmovenumber 14 info depth 59 currmove b2b4 currmovenumber 15 info depth 59 currmove c2c4 currmovenumber 16 info depth 59 currmove f2f4 currmovenumber 17 info depth 59 currmove g2g4 currmovenumber 18 info depth 59 currmove b1a3 currmovenumber 19 info depth 59 currmove g1h3 currmovenumber 20 info depth 60 seldepth 60 multipv 1 score cp 28 nodes 233302460620 nps 969418 hashfull 1000 tbhits 0 time 240662245 pv d2d4 g8f6 c2c4 e7e6 g1f3 d7d5 b1c3 f8e7 c1f4 e8g8 e2e3 b7b6 a1c1 c8b7 h2h3 e7d6 f4d6 c7d6 f1d3 d5c4 d3c4 h7h6 e1g1 b8c6 f3d2 a8c8 f1e1 d8e7 c4f1 a7a6 a2a4 c6b4 e3e4 a6a5 d1b3 info depth 61 currmove d2d4 currmovenumber 1 info depth 61 seldepth 56 multipv 1 score cp 36 lowerbound nodes 256782523565 nps 976653 hashfull 1000 tbhits 0 time 262920705 pv d2d4 info depth 60 currmove d2d4 currmovenumber 1 info depth 60 currmove g1f3 currmovenumber 2 info depth 60 currmove e2e3 currmovenumber 3 info depth 60 currmove b1c3 currmovenumber 4 info depth 60 currmove h2h3 currmovenumber 5 info depth 60 currmove c2c3 currmovenumber 6 info depth 60 currmove g2g3 currmovenumber 7 info depth 60 currmove a2a3 currmovenumber 8 info depth 60 currmove d2d3 currmovenumber 9 info depth 60 currmove e2e4 currmovenumber 10 info depth 60 currmove h2h4 currmovenumber 11 info depth 60 currmove b2b3 currmovenumber 12 info depth 60 currmove f2f3 currmovenumber 13 info depth 60 currmove a2a4 currmovenumber 14 info depth 60 currmove b2b4 currmovenumber 15 info depth 60 currmove c2c4 currmovenumber 16 info depth 60 currmove f2f4 currmovenumber 17 info depth 60 currmove g2g4 currmovenumber 18 info depth 60 currmove b1a3 currmovenumber 19 info depth 60 currmove g1h3 currmovenumber 20 info depth 61 seldepth 60 multipv 1 score cp 31 nodes 279649357783 nps 979670 hashfull 1000 tbhits 0 time 285452560 pv d2d4 g8f6 g1f3 d7d5 c2c4 e7e6 b1c3 c7c6 e2e3 a7a6 b2b3 f8b4 c1d2 e8g8 f1d3 b8d7 e1g1 d8e7 h2h3 h7h6 a1c1 a6a5 c3a4 d5c4 b3c4 e6e5 d3b1 e5e4 d2b4 a5b4 f3d2 c6c5 d4c5 f8e8 a4b6 d7b6 c5b6 e7c5 d1c2 c8d7 d2b3 c5h5 c4c5 d7h3 g2h3 info depth 62 currmove d2d4 currmovenumber 1 info depth 62 currmove g1f3 currmovenumber 2 info depth 62 currmove e2e3 currmovenumber 3 info depth 62 currmove b1c3 currmovenumber 4 info depth 62 currmove e2e4 currmovenumber 5 info depth 62 currmove d2d3 currmovenumber 6 info depth 62 currmove g2g3 currmovenumber 7 info depth 62 currmove a2a3 currmovenumber 8 info depth 62 currmove b2b3 currmovenumber 9 info depth 62 currmove c2c4 currmovenumber 10 info depth 62 currmove c2c3 currmovenumber 11 info depth 62 currmove h2h3 currmovenumber 12 info depth 62 currmove b1a3 currmovenumber 13 info depth 62 currmove b2b4 currmovenumber 14 info depth 62 currmove f2f3 currmovenumber 15 info depth 62 currmove a2a4 currmovenumber 16 info depth 62 currmove f2f4 currmovenumber 17 info depth 62 currmove g2g4 currmovenumber 18 info depth 62 currmove h2h4 currmovenumber 19 info depth 62 currmove g1h3 currmovenumber 20 info depth 62 seldepth 61 multipv 1 score cp 24 upperbound nodes 342692938831 nps 980422 hashfull 1000 tbhits 0 time 349536085 pv d2d4 g8f6 info depth 62 currmove d2d4 currmovenumber 1 info depth 62 seldepth 61 multipv 1 score cp 32 lowerbound nodes 345189203261 nps 980063 hashfull 1000 tbhits 0 time 352211133 pv d2d4 info depth 61 currmove d2d4 currmovenumber 1 info depth 61 currmove g1f3 currmovenumber 2 info depth 61 currmove b2b4 currmovenumber 3 info depth 61 currmove b2b3 currmovenumber 4 info depth 61 currmove c2c3 currmovenumber 5 info depth 61 currmove e2e4 currmovenumber 6 info depth 61 currmove g2g3 currmovenumber 7 info depth 61 currmove g2g4 currmovenumber 8 info depth 61 currmove e2e3 currmovenumber 9 info depth 61 currmove c2c4 currmovenumber 10 info depth 61 currmove a2a4 currmovenumber 11 info depth 61 currmove a2a3 currmovenumber 12 info depth 61 currmove b1c3 currmovenumber 13 info depth 61 currmove g1h3 currmovenumber 14 info depth 61 currmove d2d3 currmovenumber 15 info depth 61 currmove b1a3 currmovenumber 16 info depth 61 currmove f2f3 currmovenumber 17 info depth 61 currmove h2h3 currmovenumber 18 info depth 61 currmove f2f4 currmovenumber 19 info depth 61 currmove h2h4 currmovenumber 20 info depth 62 seldepth 66 multipv 1 score cp 27 nodes 350405823574 nps 978848 hashfull 1000 tbhits 0 time 357977466 pv d2d4 g8f6 c2c4 e7e6 g1f3 d7d5 b1c3 f8e7 c1f4 e8g8 e2e3 b7b6 f1d3 c8a6 c4d5 f6d5 c3d5 d8d5 e1g1 a6d3 d1d3 d5b7 a1c1 f8c8 f3g5 e7g5 f4g5 b8d7 e3e4 c7c5 d4d5 e6d5 e4d5 h7h6 g5f4 d7f8 f1d1 c8d8 b2b4 f8e6 f4g3 c5b4 d5d6 d8d7 d3b5 a8c8 b5b4 c8c1 d1c1 info depth 63 currmove d2d4 currmovenumber 1 info depth 63 seldepth 59 multipv 1 score cp 36 lowerbound nodes 402850490630 nps 978803 hashfull 1000 tbhits 0 time 411574411 pv d2d4 info depth 62 currmove d2d4 currmovenumber 1 info depth 62 currmove g1f3 currmovenumber 2 info depth 62 currmove c2c3 currmovenumber 3 info depth 62 currmove c2c4 currmovenumber 4 info depth 62 currmove e2e3 currmovenumber 5 info depth 62 currmove b1c3 currmovenumber 6 info depth 62 currmove a2a4 currmovenumber 7 info depth 62 currmove h2h3 currmovenumber 8 info depth 62 currmove b1a3 currmovenumber 9 info depth 62 currmove g2g3 currmovenumber 10 info depth 62 currmove e2e4 currmovenumber 11 info depth 62 currmove b2b4 currmovenumber 12 info depth 62 currmove f2f4 currmovenumber 13 info depth 62 currmove a2a3 currmovenumber 14 info depth 62 currmove g2g4 currmovenumber 15 info depth 62 currmove d2d3 currmovenumber 16 info depth 62 currmove b2b3 currmovenumber 17 info depth 62 currmove f2f3 currmovenumber 18 info depth 62 currmove h2h4 currmovenumber 19 info depth 62 currmove g1h3 currmovenumber 20 info depth 63 seldepth 63 multipv 1 score cp 26 nodes 422208097819 nps 983585 hashfull 1000 tbhits 0 time 429254108 pv d2d4 g8f6 g1f3 d7d5 c2c4 e7e6 b1c3 f8e7 c1f4 e8g8 e2e3 b8d7 c4c5 f6h5 a2a3 h5f4 e3f4 b7b6 b2b4 c7c6 f1d3 a7a5 e1g1 c8a6 g2g3 h7h6 c3a4 e7f6 d3a6 a8a6 d1d3 b6b5 a4c3 d8a8 c3a2 f6d8 g1g2 d7f6 f1e1 a6a7 d3d1 a5b4 a2b4 d8c7 d1c1 f6e4 h2h4 c7a5 info depth 64 currmove d2d4 currmovenumber 1
Get first move and depth from Stockfish output
2022-04-14T16:22:08.000Z
Username with dash
@(?:[a-z]-?)+(?<!-)\w+
good @good-1 @rizalibnu @rizal-ibnu @rizal_ibnu @rizal ibnu rizalibnu @Rizalibnu @muhamad-rizal-ibnu-abdulah oriyodrsd wiueisdjfsdk sdkjfksd sdfsnfkh askjdksj zsdsjksjd sdas @muhamad-rizal-ibnu-abdulah
username with dash
2018-10-09T10:00:18.000Z
^.*(\/Summary\/).*(chelaxe\.ru).*$
^.*(\/Summary\/).*(chelaxe\.ru).*$
2015-03-18T17:23:10.000Z
Log Format - combined + cookie at the end. Pattern Desc - combined for all groups.
((?:(?:25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?)\.){3}(?:25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?))[, ].{1,}\[([0-3][0-9]\/\w{3}\/[0-9]{4}):([0-2][0-9]:[0-5][0-9]:[0-5][0-9]) ((?:\+|\-)[0-9]{4})\].{1,}"(GET|POST|HEAD|PUT|DELETE|TRACE|CONNECT) ([\/\w\.\-\?\_\=\*\$\%\:]+).{1,}" (\b\d{3}) (\d+|-) "((?:(?:http(?:s)?:\/\/.)?(www\.)?[-a-zA-Z0-9@:%._\+~#=]{2,256}\.[a-z]{2,24}\b[-a-zA-Z0-9@:%_\+.~#?&\/\/=]*)|-)" "([^"]+)" "([^"]+)"$
94.185.250.10 - - [06/Aug/2015:11:34:23 +0200] "GET / HTTP/1.1" 200 686 "-" "Mozilla/5.0 (Windows NT 6.3; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/44.0.2403.125 Safari/537.36" "username=John Doe; testCookie=testValue"
Apache/Nginx Logs parsing
2015-08-11T10:29:53.000Z
\d+\s?(women|men)
OR I GI N AL AR TI CL E Home-based interval training increases endurance capacity in adults with complex congenital heart disease Camilla Sandberg RPT, PhD 1,2 | Magnus Hedstr€ om MD 1 | Karin Wadell RPT, PhD 2 | Mikael Dellborg MD, PhD 3 | Anders Ahnfelt MD 3 | Anna-Klara Zetterstr€ om RPT 4 | Amanda € Ohrn RPT 4 | Bengt Johansson MD, PhD 1 1 Heart Center and Department of Public Health and Clinical Medicine, Umeå University, Umeå, Sweden 2 Department of Community Medicine and Rehabilitation, Physiotherapy, Umeå University, Umeå, Sweden 3 Department of Molecular and Clinical Medicine, Sahlgrenska Academy, University of Gothenburg, Gothenburg, Sweden 4 Department of Physiotherapy and Occupational Therapy, Sahlgrenska University Hospital, Gothenburg, Sweden Correspondence Camilla Sandberg, RPT, PhD, Heart Center and Department of Public Health and Clinical Medicine, Umeå University, SE-90185, Umeå, Sweden. Email: camilla.sandberg@umu.se Funding information Swedish Heart-Lung Foundation, Grant/ Award Numbers: 20100355, 20130472; Heart Foundation of Northern Sweden; Research Foundation of The Swedish Heart and Lung Association, Grant/Award Num- ber: E116/12, E115/13, E129/14; Research Foundation of Healthcare Professions within Cardiology, Umeå University; Väster- bottens läns landsting, Umeå, Sweden, Grant/Award Number: 316351; and ALF- LUA grants at Sahlgrenska University Hos- pital, G€ oteborg, Sweden Abstract Objective: The beneficial effects of exercise training in acquired heart failure and coronary artery disease are well known and have been implemented in current treatment guidelines. Knowledge on appropriate exercise training regimes for adults with congenital heart disease is limited, thus further studies are needed. The aim of this study was to examine the effect of home-based interval exercise training on maximal endurance capacity and peak exercise capacity. Design: Randomized controlled trial. Methods: Twenty-six adults with complex congenital heart disease were recruited from special- ized units for adult congenital heart disease. Patients were randomized to either an intervention group—12 weeks of home-based interval exercise training on a cycle ergometer (n516), or a con- trol group (n510). The latter was instructed to maintain their habitual physical activities. An incremental cardiopulmonary exercise test and a constant work rate cardiopulmonary exercise test at 75% of peak workload were performed preintervention and postintervention. Results: Twenty-three patients completed the protocol and were followed (intervention n513, control n510). Postintervention exercise time at constant work rate cardiopulmonary exercise test increased in the intervention group compared to controls (median[range] 12[–4 to 52]min vs 0 [–4 to 5]min, P5.001). At incremental cardiopulmonary exercise test, peak VO 2 increased 15% within the intervention group (P5.019) compared to 2% within the control group (P5.8). How- ever, in comparison between the groups no difference was found (285[–200 to 535] ml/min vs 17 [–380 to 306] ml/min, P5.10). In addition, peak workload at incremental cardiopulmonary exer- cise test increased in the intervention group compared to controls (20[–10 to 70]W vs 0[–20 to 15]W, P5.003). Conclusion: Home-based interval exercise training increased endurance capacity and peak exer- cise capacity in adults with complex congenital heart disease. Aerobic endurance might be more relevant than peak oxygen uptake with regard to daily activities, and therefore a more clinically rel- evant measure to evaluate. K EY WO RD S adult, cardiopulmonary exercise testing, congenital heart disease, constant work rate, exercise training, interval training 254 | V C 2017 Wiley Periodicals, Inc. wileyonlinelibrary.com/journal/chd Congenital Heart Disease. 2018;13:254–262. Received: 3 January 2017 | Revised: 21 August 2017 | Accepted: 19 October 2017 DOI: 10.1111/chd.12562 1 | INTRODUCTION During the past decades there have been substantial improvements in survival and reduction in the need of reoperations for adults with congenital heart disease (CHD), especially among those with more complex lesions. 1–3 There is a well-known impairment in exercise capacity in these patients compared to healthy controls. 4,5 To what extent this impairment is due to abnormal cardiovascular physiology, per se, or to other factors such as physical inactivity or lack of exercise training, that is, deconditioning, is unknown. Fur- thermore, reduced exercise capacity is an important prognostic predictor of cardiovascular morbidity and mortality. 6 In addition, impaired muscle function has been observed, especially in adults with CHD that have complex lesions. 7–10 According to current rec- ommendations of the European Society of Cardiology, adults with CHD are encouraged to be physically active and exercise training should be prescribed individually. 11 However, due largely to the low numbers of studies on effects of exercise training in adults with CHD, there are no specific recommendations regarding train- ing mode, intensity, duration, and frequency. 12,13 Previous studies show that exercise training seems to be safe and to have positive effects on aerobic exercise capacity without adverse effect on ven- tricular function. 14–21 Home-based continuous moderate exercise training on an cycle ergometer increased the exercise capacity in adults with a systemic right ventricle. 17 In patients with acquired heart failure, interval training was shown to improve exercise capacity more than continuous moderate exercise training. 22 Inter- val training at moderate to high intensity (75%–95% of maximum HR) was also reported to be safe and increase exercise capacity in these patients. 15,18 To improve adherence to study protocol, home-based exercise training has been used in a number of previ- ous studies. 17,23,24 Incremental cardiopulmonary exercise testing (incremental CPET) on a cycle ergometer or treadmill is frequently used and often considered the “gold standard” when evaluating aerobic exercise capacity and change in aerobic capacity after intervention. 25,26 Changes in peak aerobic capacity, total exercise time and peak work load are variables commonly used to report study results. 12 Constant work rate CPET is a method commonly used to evaluate endurance exercise capacity in patients with chronic obstructive pulmonary dis- ease (COPD) 27 and it has emerged as the most responsive test method to evaluate change in exercise capacity in these patients after rehabilitation intervention. 28 At present, this test has not been used to evaluate outcome of exercise training in the setting of adult CHD. The present study was a randomized controlled trial that used CPET aimed to evaluate the effect of home-based interval exercise training on submaximal exercise capacity (endurance) and peak exercise capacity (peak work load, peak oxygen uptake) in adults with complex CHD. The hypothesis was that interval training increases endurance capacity as well as peak exercise capacity in an intervention group compared to a control group. 2 | METHODS 2.1 | Study population Twenty-six patients (13 women) with complex CHD and reduced exer- cise capacity were recruited from specialized units for adults with CHD in the northern health care region (Umeå) and the region of Västra G€ otaland (G€ oteborg) in Sweden. The inclusion criteria were complex CHD, as defined by Erikssen et al., 1 (eg, palliated with variants of Fontan procedure [Fontan/TCPC], pulmonary atresia [PA], tetralogy of Fallot [ToF], congenitally corrected transposition of the great arteries [ccTGA], dextro-transposition of the great arteries repaired with Mustard or Sen- ning procedure [d-TGA]), clinically stable condition over the past 3 months, adult age (?18 years of age), and informed consent. The patients with PA, as well as those with ToF, had undergone surgical repair and were not cyanotic. The exclusion criteria were present strat- egy for executing exercise training?2 times/week aimed at increasing or sustaining exercise capacity, arrhythmia or other adverse events (eg, important symptoms, drop in blood pressure) at CPET, clinically relevant arrhythmia, intellectual disability or mental illness affecting independent decision making, extracardiac disease affecting physical activity, peak VO 2 >30ml/kg/min at run-in CPET, or no internet access. At the time of screening (October 25, 2012) the outpatient register of CHD in the northern health care region, 391 patients were registered. Seventy- seven patients met the inclusion criteria of complex CHD. Of these, 39 patients met at least one exclusion criteria. Thus, 38 patients were eligi- ble and were asked to participate; 17 declined participation, 1 was excluded due to arrhythmia (short periods of atrial fibrillation) and 1 was excluded due to peak VO 2 ?30 ml/kg/min at run-in CPET and 19 (53%) were finally included. There were no differences regarding age and sex between those who declined participation and those who par- ticipated. In the region of Västra G€ otaland, a convenience sample was collected, that is, when patients fulfilling the inclusion criteria were scheduled for a regular follow-up visit they were asked to participate. Thus, these patients were not strictly consecutively recruited. Eight patients were tested with run-in CPET, of these 1 was excluded due to arrhythmia. This gave an additional 7 patients. Finally, a total of 26 patients were included and were randomized to an exercise-training group, that is, intervention group (n516), or a control group (n510). Two patients that had been randomized to the intervention group dis- continued study participation due to personal reasons. For another patient, the exercise training was discontinued after 14 training sessions due to the patient experiencing discomfort and possible arrhythmia. Therefore, 23 patients consisting of 13 in the intervention group and 10 in the control group were followed after intervention. All patients gave their written informed consent for participation. The study was approved by the regional Ethics Review Board in Umeå (Dnr 2011-51- 31 M, 2011-03-29, and 2012-143-32 M, 2012-04-04). 2.2 | Exercise capacity At the incremental CPET peak VO 2 , peak work load, respiratory exchange ratio (RER) and peak heart rate were registered. 25 To ensure standardization, the participants were instructed that when rating ?17 SANDBERG ET AL . | 255 (very hard) on the Borg Rated Perceived Exertion scale, 29 this corre- sponded to perceived exertion of “not coping with an additional increase of work load.” The subsequent endurance test, constant work rate CPET, was performed at 75% of peak work load that had been achieved at the initial incremental CPET. The exercise test duration was the main outcome. 27,30 In one patient in the intervention group, the postintervention constant work rate CPET was not performed due to technical issues. Therefore, for this patient we only used the incre- mental CPET data. For pre- and postexercise tests the Jaeger Oxycon Pro CareFusion (GmbH, Hoechberg, Germany) or Schiller CS-200 Ergo- spirometry (Schiller AG, Baar, Switzerland) was used for analysis of breathing-gases. 2.3 | Randomization process The present study was a two-armed randomized controlled trial. Patients were randomly assigned to intervention or control group in the ratio of 2:1 that was applied by computer generated block random- ization. The group allocation sequence was kept in an opaque, sealed, and stapled envelope to prevent prior knowledge, and was revealed to patients and researchers after completion of run-in tests. At the first center, the technicians performing the tests and the physician (MH) analyzing the tests were blinded for group allocation. Furthermore, the patients were instructed not to reveal their group allocation. At the second center, the investigators were not blinded. However, the tests strictly followed the prespecified protocol. 2.4 | Exercise training protocol The exercise training was home-based and was performed three times a week for 12 weeks on a cycle ergometer with a manually adjusted brake system (Tunturi T 20/Tunturi, Tunturi- Hellberg Oy Ltd, Åbo, Fin- land or Bremshey BF3, Escalade Int. Ltd, Nottingham, UK). The time between completion of the run-in tests, and start of intervention was approximately 1 week due to delivery of the cycle ergometers. To indi- vidually adjust the intensity of the exercise training protocol, the train- ing heart rate (THR) was calculated according to the Karvonen method based on the individual peak heart rate. 31 In addition to the heart rate intervals, patients were instructed to achieve perceived exertion corre- sponding to BORG 15–16. 29 All patients randomized to exercise train- ing received one occasion with familiarization training. The exercise training had an initial 8 min warm-up without load or with very low load. During the first 2 weeks the protocol consisted of three intervals at THR 75%-80%, and thereafter four intervals. The duration of the inter- vals was also individually adjusted according to total exercise time dur- ing the initial constant work rate CPET. When the total time at constant work rate CPET was less than 5 minutes, the interval time was calculated as total exercise time minus 1 minute. The maximum interval time was 5 minutes. The intervals were separated by an active recovery periods of 3 minutes without load or with very low load (Sup- porting Information Figure S1). During the exercise training sessions, participants wore a heart rate monitor (Polar RS 300X, Polar Electro Oy, Kempele, Finland). The registered heart rate was regularly transferred to a personal webpage that was accessed by the physio- therapist and participant. A weekly contact by phone was used to pro- mote compliance, to provide feedback, and, when appropriate, to increase training time if a shorter interval time than 5 minutes. The par- ticipants were instructed to pay attention to symptoms such as dizzi- ness, palpitations, chest pain, and other experiences of discomfort, and if these occurred, abort exercise and contact investigators. The maxi- mum number of training sessions was 36 and the goal was that every participant should complete a minimum of 28 (78%) sessions. The patients randomized to control group were instructed to continue with their habitual physical activities. 2.5 | Questionnaires In addition to exercise test data, self-reported quality of life was eval- uated using the EuroQol Vertical Visual Analogue Scale (EQ-VAS). 32 The Hospital Anxiety and Depression scale (HADS) 33,34 was used for assessing prevalence of anxiety and depression. Finally, self-efficacy for exercise was evaluated using the Exercise Self-Efficacy Scale (ESE). 35 All three scales are validated and were used preintervention and postintervention. 2.6 | Statistics The data were tested for normality. Data are presented as mean 61 standard deviation (SD) or median with range (min-max). Differences in means, ranks, and ratios were tested by Student’s t test, Mann- Whitney U test, or chi-square test as appropriate. Paired samples t test and Wilcoxon’s signed ranks test were applied for within group comparisons. The null-hypothesis was rejected for P values<.05. All calculations were performed using SPSS 22 (IBM, Armonk, NY, USA). 3 | RESULTS Twenty-three patients were analyzed after follow-up that included 13 in the intervention group and 10 in the control group. There were no differences in baseline data between the intervention group and con- trol group (Tables 1–3). In the population, the mean predicted peak heart rate was 88%67.5% and the mean predicted peak VO 2 was 72%613.7%. Moreover, there were no differences between interven- tion group and control group regarding these data. 3.1 | Exercise capacity The median test duration at constant work rate CPET increased 89% post intervention in the intervention group compared to no change in the control group (median[range] 12[–4 to 52] min vs 0[–4 to 5] min, P5.001). Furthermore, the peak workload (20[–10 to 70] W vs 0[–20 to 15] W, P5.003) at incremental CPET increased post intervention in the intervention group compared to the controls. The peak VO 2 (ml/ min) at incremental CPET increased 15% within the intervention group (P5.019) compared to no change (2%) within the control group (P5.8). The results were similar regarding VO 2 indexed for body 256 | SANDBERG ET AL . weight and peak O 2 pulse. However, in comparison between the inter- vention group and control group no differences were found regarding absolute peak VO 2 (ml/min) or peak VO 2 indexed to body weight (ml/ kg/min) (285[–200 to 535] ml/min vs 17[–380 to 306] ml/min, P5.10) (3.6[–2.6 to 6.4] ml/kg/min vs 0.6[–3.5 to 4.9] ml/kg/min, P5.12). Furthermore, the increase in peak O 2 pulse did not differ between the groups (1.3[–1.7 to 4.2] ml/heartbeat vs 0.4[–1.2 to 2.4], P5.21 (Table 2, Figure 1A–D). 3.2 | EQ-VAS, HADS, and ESE No differences were found within or between groups preintervention and postintervention regarding self-reported QoL, prevalence of anxi- ety and depression or exercise self-efficacy (Table 3). 3.3 | Compliance Compliance to exercise training protocol, defined as the number of completed training sessions in relation to the possible number of ses- sions, was in mean 79%617 (median 83%, 47%–100%). The number of registered exercise occasions ranged from 17 to 36 of 36 possible occasions. 3.4 | Adverse event In one case, the exercise training was discontinued due to the patient experiencing discomfort and possible arrhythmia during a session of exercise training. No arrhythmia was detected on a subsequent exer- cise test or at Holter registration. No other adverse events occurred. TABLE 1 Descriptive data on included patients All patients (n523) Intervention group (n513) Controls (n510) P value Sex M n (%) 12(52) 8(62) 4(40) .31 F n (%) 11(48) 5(39) 6(60) Age, years Median(IQR) 30.1(22.9–36.6) 31.3(26.9–36.6) 26.3(22.9–35.6) .38 Height, m Mean6SD 1.72(0.10) 1.72(0.09) 1.72(0.10) .85 Weight, kg Mean6SD 77(15) 77(10) 76(21) .90 BMI, kg/m 2 Mean6SD 25.8(3.9) 26.0(3.6) 25.5(4) .77 Diagnosis n (%) ToF 5(22) 4(31) 1(10) .19 ccTGA 3(13) 3(23) 0(0) d-TGA 5(22) 2(15) 3(30) TCPC 5(22) 3(23) 2(20) PA 2(9) 0(0) 2(20) Complete AV-septal defect 1(4) 0(0) 1(10) Ebstein 1(4) 0(0) 1(10) Miscellaneous 1(4) 1(8) 0(0) Surgical intervention, yes n (%) 21(91) 11(85) 10(100) .19 Age at intervention, years* median(IQR) 3.1(1.1–6.8) 3.6(1.2–7.6) 3.0(0.7-6.1) .74 PM, yes n (%) 2(9) 2(15) 0(0) .19 Cardiovascular medication, yes n (%) 10(44) 5(39) 5 (50) .58 ACE/ARB n (%) 6(26) 4(31) 2(20) .56 Beta-blockers n (%) 2(9) 1(8) 1(10) .85 Diuretics n (%) 2(9) 1(8) 1(10) .85 Warfarin n (%) 5(22) 3(23) 2(20) .86 Aspirin n (%) 3(13) 2(15) 1(10) .70 Abbreviations: ACE, angiotensin converting enzyme; ARB, angiotensin receptor-2 blockers; AV, atrioventricular; ccTGA, congenitally corrected transposi- tion of the great arteries; d-TGA, dextro-transposition of the great arteries; F, female; IQR, interquartile range; M, male; n, number; PA, pulmonary atre- sia; PM, pacemaker; TCPC, total cavo-pulmonary connection; ToF, tetralogy of Fallot. *Age at TCPC surgery or correction or ToF. Presented P values represent comparison between intervention group and controls. Mann-Whitney U test was applied in comparison of age and age at intervention; in all other comparisons chi-square or Student’s t test was used. SANDBERG ET AL . | 257 4 | DISCUSSION This is the first study to evaluate endurance capacity in addition to peak aerobic capacity after exercise training in adults with complex CHD. The present study shows that home-based high intensity interval training on a cycle ergometer has a great impact on endurance capacity as well as on maximum exercise capacity in adults with complex CHD. 4.1 | Exercise capacity Peak VO 2 (ml/min) increased within the intervention group but not in comparison to the control group. However, the peak work rate for the intervention group increased in comparison to the control group which altogether indicates an improvement in peak aerobic capacity. The increase in peak VO 2 in previous studies was approximately 8%, 14,15,18 and in the present study the corresponding increase within the inter- vention group was 15%. An increase in aerobic capacity could be of significance in daily activities. In patients with complex congenital heart lesions, especially with impaired NYHA class, activities of daily living might be in line with or even exceed their individual exercise capacity. 5 In these cases, an exercise training induced improvement of exercise capacity could play an important role in coping with activities of daily living. In adults with complex CHD, the central adaption to exercise training is usually blunted, 36,37 which might lead peripheral mecha- nisms, that is, increased muscle capillarization and oxidative capacity, to play an even greater role in the response to exercise training. 38 The important increase in endurance capacity may actually reflect this mechanism. It is noteworthy that modest increases in peak VO 2 (ml/ min) and peak work rate after exercise training corresponded to a sub- stantial increase in time duration at constant work rate CPET; this result was previously reported in patients with COPD. 28,39 Our results imply that endurance capacity might be a more clinically relevant mea- sure of change in exercise capacity after exercise training in adults with complex CHD. 4.2 | Exercise testing Peak VO 2 derived from incremental CPET is frequently used and often considered the “gold standard” measure of peak aerobic exercise capacity. 25,26 When assessing the peak aerobic exercise capacity, it is important that the test is performed with maximum effort. The RER?1.10 is considered as a measure of maximum effort being reached. 25 In the present study, this limit was reached by the majority of the participants (Table 2). However, in adults with complex CHD dif- ficulties in reaching this limit was previously reported. 6,40 This phenom- enon was to some extent also observed in our population. Pulmonary limitation of the exercise capacity has been proposed to cause this lim- ited ability to reach RER ?1.10. 25 Recently, submaximal outcome measures calculated from the incremental CPET, that is, ventilatory anaerobic threshold (VAT), oxygen uptake efficiency slope (OUES), and VE/VCO 2 slope, have emerged as useful in evaluation of exercise capacity and as prognostic tools. Furthermore, these parameters do not require a test performed with maximum effort. 26,40,41 In our study, we TABLE 2 Preintervention, postintervention, and change in cardiopulmonary exercise test data in intervention group vs control group Preintervention Postintervention Change after intervention Intervention group Control group P Intervention group Control group P Intervention group Control group P CPET incremental VO 2 peak, ml/min 1865 (1191–2355) 1601 (1215–2650) .74 1870 (1040–2642) 1688 (1326–2367) .26 285 (–200 to 535) 17 (–380 to 306) .10 VO 2 peak, ml/kg/min 23.4 (14.8–29.4) 23.6 (18.1–28.1) .98 26.9 (13.0–33.6) 24.8 (18.1–28.4) .23 3.6 (–2.6 to 6.4) 0.6 (–3.5 to 4.9) .12 Peak O 2 pulse, ml/heartbeat 10.3 (7.3–13.7) 9.5 (6.8–15.1) .99 12.0 (8.3–15.0) 10.8 (8.2–14.0) .48 1.3 (–1.7 to 8.5) 0.4 (–1.2 to 2.4) .21 Peak workload, W 155 (100–220) 150 (110–200) .69 170 (90–240) 140 (110–200) .07 20 (–10 to 70) 0 (–20 to 15) .003 RER 1.19 (0.99-1.51) 1.22 (1.02-1.36) .61 1.20 (1.13-1.40) 1.20 (0.98-1.29) .52 Constant work rate at 75% of peak workload: Test duration min 14 (4–33) 9 (3–20) .11 28 (8–68) 9 (5–16) .001 12 (–4 to 52) 0 (–4 to 5) .001 Abbreviations: CPET, cardiopulmonary exercise test; RER, respiratory exchange ratio. Data are presented as median (range). Bold text indicates a P value<.05. 258 | SANDBERG ET AL . took this a step further and used a submaximal exercise test in addition to the incremental CPET and found a substantially larger (median change 12 min, 89%) increase in submaximal exercise capacity in com- parison to peak VO 2 (15%). With reference to the patients’ perform- ance capacity in daily activities, increased endurance might better illustrate the benefits of improved aerobic capacity and thereby be a more clinically relevant measure. The increase in endurance capacity we found is in line with previous studies in patients with COPD. Pors- zasz et al. 39 reported a mean increase of 11.668.1 minutes in duration at constant work rate CPET after exercise training, while Cambach et al. 42 reported a mean increase of approximately 7 minutes in dura- tion. An increase of 1.6–3.3 minutes has been suggested as a minimal clinically important difference in response to exercise training in patients with COPD. 43,44 In our intervention group, all patients except one increased the time duration at constant work rate CPET above this suggested level of minimal clinical importance. This particular patient did not comply fully with the exercise training protocol fulfilling only 17 of 36 (47%) of the possible exercise training sessions. 4.3 | Exercise training protocol As stated in the current recommendations on physical activity and rec- reational sports in adults with CHD, exercise prescriptions should be individualized. 11 We aimed to provide the patients in the intervention group with an individually adjusted exercise training protocol based on the results of the cardiopulmonary exercise tests. Different modes of exercise training, for example, walking, interval training with step aero- bics, and moderate continuous training on a cycle ergometer have been used in previous studies. 17,18,23,24 The present study is the first to use home-based moderate to high intensity interval exercise training on a cycle ergometer in a population of adults with different complex con- genital heart lesions. Studies in adults with systemic right ventricle have shown that home-based exercise training is safe, feasible and effective with regard to exercise capacity without negative effects on the systemic right ventricle. 17,18,24 In patients with heart failure, inter- val training was reported to improve exercise capacity more than a moderate continuous exercise training mode. 22 The present study FIGURE 1 A-D, Individual cardiopulmonary exercise test data at baseline, at 12-week follow-up and change from baseline to follow-up in intervention group TABLE 3 Preintervention, postintervention and change in data regarding self-reported prevalence of anxiety and depression (HADS), quality of life (EQ5D VAS), and exercise self-efficacy (ESE) Preintervention Postintervention Change after intervention Intervention group Control group P Intervention group Control group P Intervention group Control group P HADS Anxiety 4(1–9) 4(0–7) .69 5(2–9) 6(0–8) .72 1(–3 to 3) 1(0–3) .28 HADS Depression 2(0–9) 2(0–5) .26 2(0–5) 2(0–6) .97 0(–4 to 2) 0(–1 to 4) .18 EQ-VAS 77.5(35.0–99.0) 89.5(70.0–99.0) .10 78.8(48.0–99.0) 85.5(35.0–99.0) .31 0(–21.0 to 25.0) 0(–55.0 to 9.0) .42 ESE 32(16–39) 30(15–40) .88 28(11–40) 29(18–40) .67 25(–12 to 8) 21(–6 to 6) .23 Abbreviations: EQ-VAS, EuroQol Vertical Visual Analogue Scale; ESE, Exercise Self-Efficacy Scale; HADS, Hospital and Anxiety and Depression scale. Data are presented as median (range). SANDBERG ET AL . | 259 showed that home-based interval exercise training increased endur- ance capacity as well as peak aerobic exercise capacity in adults with complex congenital heart lesions. The finding of markedly increased endurance capacity, in addition to peak capacity, contributes important information to previous exercise training studies in this population. 4.4 | Quality of life In CHD, self-reported quality of life is known to be associated with physical activity level. 45 Here, we report that self-reported quality of life remained unchanged after intervention which is in line with results previously shown by others. 15 In contrast, positive effects of exercise on quality of life has been reported. 23 The population in the present study rated their quality of life as rather high preintervention which might explain the unchanged results. 4.5 | Compliance As many patients with complex heart lesions are in the “middle of life” and occupied with studies, work, children, and family activities, a home-based exercise training protocol was chosen to improve adher- ence to study protocol. In addition, participants were contacted by phone every week, which probably also contributed to compliance. The mean compliance in the present study (79%) was in line with previously presented results (68%-77%). 14,17,18 4.6 | Limitations As in previously presented studies on exercise training in adults with CHD, our study population was rather small which somewhat limits the generalizability of the results. However, the results are in line with pre- vious studies which further strengthen exercise training as a part of the rehabilitation of adults with complex CHD. Furthermore, our study population consisted of patients with different complex diagnoses that to a greater extent reflect the diversity seen in the clinic, thus enhanc- ing the generalizability. This study was performed at two centers. The center recruiting 5 patients (22%) was not able to keep the investigators performing the exercise tests strictly blinded for group allocation. However, there was a prespecified protocol that was strictly followed in both centers. Fur- thermore, the same center had a different recruitment strategy that possibly could involve patients with more frequent clinical visits and thus potentially patients with more complex lesions. However, the numbers are small and the two patients performing the exercise proto- col did not obviously differ from the rest of the study population. One concern of the constant work rate CPET that has been dis- cussed previously in patients with COPD is the power/duration rela- tionship. 28 This means that the endurance time varies depending on the workload (power) used during the test. However, there is no con- sensus on optimal power to use which complicates comparison of results between studies. To standardize, we used 75% of peak work rate that was used previously in COPD patients. 39,42 4.7 | Conclusions Home-based interval exercise training increased the endurance capacity at 75% of peak work load by 12 minutes as well as peak exer- cise capacity in adults with different complex congenital heart lesions. Substantially increased endurance capacity in the spectrum of daily activities is what most patients need. Therefore, endurance capacity might be a more clinically relevant target than solely peak oxygen uptake in patients with complex congenital heart lesions. ACKNOWLEDGMENT We are grateful to the personnel at the department of Clinical Phys- iology at the Heart Center, Umeå University Hospital who con- ducted the exercise tests and to the staff at the GUCH-center in G€ oteborg. CLINICAL TRIAL REGISTRATION ClinicalTrials.gov, identification:NCT01671566 CONFLICT OF INTEREST None AUTHOR CONTRIBUTIONS All authors read and approved the final version of the manuscript. Concept/design: Camilla Sandberg, Magnus Hedstr€ om, Karin Wadell, Mikael Dellborg, Bengt Johansson Data collection: Camilla Sandberg, Magnus Hedstr€ om, Mikael Dell- borg, Anders Ahnfelt, Anna-Klara Zetterstr€ om Amanda € Ohrn, Bengt Johansson Data analysis: Camilla Sandberg, Magnus Hedstr€ om, Mikael Dellborg, Bengt Johansson Interpretation: Camilla Sandberg, Magnus Hedstr€ om, Mikael Dellborg, Anders Ahnfelt, Bengt Johansson Drafting: Camilla Sandberg, Karin Wadell, Bengt Johansson Critical revision: Camilla Sandberg, Magnus Hedstr€ om, Karin Wadell, Mikael Dellborg, Anders Ahnfelt, Anna-Klara Zetterstr€ om, Amanda € Ohrn, Bengt Johansson Approval of article: Camilla Sandberg, Magnus Hedstr€ om, Karin Wadell, Mikael Dellborg, Anders Ahnfelt, Anna-Klara Zetterstr€ om, Amanda € Ohrn, Bengt Johansson ORCID Camilla Sandberg RPT, PhD http://orcid.org/0000-0002-4043-7130 REFERENCES [1] Erikssen G, Liestøl K, Seem E, et al. Achievements in congenital heart defect surgery: a prospective, 40-year study of 7038 patients. Circulation. 2015;131(4):337–346. [2] Raissadati A, Nieminen H, Jokinen E, Sairanen H. Progress in late results among pediatric cardiac surgery patients: a population-based 6-decade study with 98% follow-up. Circulation. 2015;131(4): 347–353. 260 | SANDBERG ET AL . [3] Moons P, Bovijn L, Budts W, Belmans A, Gewillig M. Temporal trends in survival to adulthood among patients born with congenital heart disease from 1970 to 1992 in Belgium. Circulation. 2010;122 (22):2264–2272. [4] Fredriksen PM, Veldtman G, Hechter S, et al. Aerobic capacity in adults with various congenital heart diseases. Am J Cardiol. 2001;87 (3):310–314. [5] Kempny A, Dimopoulos K, Uebing A, et al. Reference values for exercise limitations among adults with congenital heart disease. Relation to activities of daily life–single centre experience and review of published data. Eur Heart J. 2012;33(11):1386–1396. [6] Diller GP, Dimopoulos K, Okonko D, et al. Exercise intolerance in adult congenital heart disease: comparative severity, correlates, and prognostic implication. Circulation. 2005;112(6):828–835. [7] Greutmann M, Le TL, Tobler D, et al. Generalised muscle weakness in young adults with congenital heart disease. Heart. 2011;97(14): 1164–1168. [8] Kr€ o€ onstr€ om LA, Johansson L, Zetterstr€ om AK, Dellborg M, Eriksson P, Cider Å. Muscle function in adults with congenital heart disease. Int J Cardiol. 2014;170(3):358–363. [9] Sandberg C, Thil? en U, Wadell K, Johansson B. Adults with complex congenital heart disease have impaired skeletal muscle function and reduced confidence in performing exercise training. Eur J Prev Car- diol. 2014;22(12):1523–1530. [10] Cordina R, O’meagher S, Gould H, et al. Skeletal muscle abnormal- ities and exercise capacity in adults with a Fontan circulation. Heart. 2013;99(20):1530–1534. [11] Budts W, B€ orjesson M, Chessa M, et al. Physical activity in adoles- cents and adults with congenital heart defects: individualized exer- cise prescription. Eur Heart J. 2013;34(47):3669–3674. [12] Duppen N, Takken T, Hopman MTE, et al. Systematic review of the effects of physical exercise training programmes in children and young adults with congenital heart disease. Int J Cardiol. 2013;168 (3):1779–1787. [13] Chaix MA, Marcotte F, Dore A, et al. Risks and benefits of exercise training in adults with congenital heart disease. Can J Cardiol. 2016; 32(4):459–466. [14] Therrien J, Fredriksen P, Walker M, Granton J, Reid GJ, Webb G. A pilot study of exercise training in adult patients with repaired tetral- ogy of Fallot. Can J Cardiol. 2003;19:685–689. [15] Winter MM, van der Bom T, de Vries LC, et al. Exercise training improves exercise capacity in adult patients with a systemic right ven- tricle: a randomized clinical trial. Eur Heart J. 2012;33(11):1378–1385. [16] Cordina RL, O’meagher S, Karmali A, et al. Resistance training improves cardiac output, exercise capacity and tolerance to positive airway pressure in Fontan physiology. Int J Cardiol. 2013;168(2): 780–788. [17] Westhoff-Bleck M, Schieffer B, Tegtbur U, et al. Aerobic training in adults after atrial switch procedure for transposition of the great arteries improves exercise capacity without impairing systemic right ventricular function. Int J Cardiol. 2013;170(1):24–29. [18] Shafer KM, Janssen L, Carrick-Ranson G, et al. Cardiovascular response to exercise training in the systemic right ventricle of adults with transposition of the great arteries. J Physiol. 2015;593 (11):2447–2458. [19] Duppen N, Etnel JR, Spaans L, et al. Does exercise training improve cardiopulmonary fitness and daily physical activity in children and young adults with corrected tetralogy of Fallot or Fontan circula- tion? A randomized controlled trial. Am Heart J. 2015;170(3): 606–614. [20] Duppen N, Geerdink LM, Kuipers IM, et al. Regional ventricular per- formance and exercise training in children and young adults after repair of tetralogy of Fallot: randomized controlled pilot study. Cir- culation Cardiovasc Imaging. 2015;8(4):e002006. [21] Duppen N, Kapusta L, de Rijke YB, et al. The effect of exercise training on cardiac remodelling in children and young adults with corrected tetralogy of Fallot or Fontan circulation: A randomized controlled trial. Int J Cardiol. 2015;179:97–104. [22] Wisløff U, Støylen A, Loennechen JP, et al. Superior cardiovascular effect of aerobic interval training versus moderate continuous train- ing in heart failure patients: a randomized study. Circulation. 2007; 115(24):3086–3094. [23] Dua JS, Cooper AR, Fox KR, Graham Stuart A. Exercise training in adults with congenital heart disease: Feasibility and benefits. Int J Cardiol. 2010;138(2):196–205. [24] Winter MM, van der Bom T, de Vries LC, et al. Exercise training improves exercise capacity in adult patients with a systemic right ventricle: a randomized clinical trial. Eur Heart J. 2011;33(11): 1378–1385. [25] Balady GJ, Arena R, Sietsema K, et al. Clinician’s Guide to cardiopul- monary exercise testing in adults: a scientific statement from the American Heart Association. Circulation. 2010;122(2):191–225. [26] Mezzani A, Agostoni P, Cohen-Solal A, et al. Standards for the use of cardiopulmonary exercise testing for the functional evaluation of cardiac patients: a report from the Exercise Physiology Section of the European Association for Cardiovascular Prevention and Reha- bilitation. Eur J Cardiovasc Prev Rehabil. 2009;16(3):249–267. [27] Clinical exercise testing with reference to lung diseases: indications, standardization and interpretation strategies. ERS Task Force on Standardization of Clinical Exercise Testing. European Respiratory Society. Eur Respir J. 1997;10:2662–2689. [28] Borel B, Provencher S, Saey D, Maltais F. Responsiveness of various exercise-testing protocols to therapeutic interventions in COPD. Pulm Med. 2013;2013:410748. [29] Borg G. Borgs Perceived Exertion and Pain Scales. West Yorkshire, UK: Human Kinetics; 1998:46–49. [30] Ferrazza AM, Martolini D, Valli G, Palange P. Cardiopulmonary exer- cise testing in the functional and prognostic evaluation of patients with pulmonary diseases. Respiration. 2009;77(1):3–17. [31] Kenney WL, Wilmore JH, Costill DL. Physiology of Sport and Exer- cise. 5th ed. West Yorkshire, UK: Human Kinetics; 2012:471–521. [32] The EuroQol Group. EuroQol–a new facility for the measurement of health-related quality of life. Health Policy. 1990;16:199–208. [33] Zigmond AS, Snaith RP. The hospital anxiety and depression scale. Acta Psychiatr Scand. 1983;67(6):361–370. [34] Bjelland I, Dahl AA, Haug TT, Neckelmann D. The validity of the hospital anxiety and depression scale. An updated literature review. J Psychosom Res. 2002;52(2):69–77. [35] Ahlstr€ om I, Hellstr€ om K, Emtner M, Anens E. Reliability of the Swedish version of the Exercise Self-Efficacy Scale (S-ESES): a test- retest study in adults with neurological disease. Physiother Theory Pract. 2015;31(3):194–199. [36] Ohuchi H, Hiraumi Y, Tasato H, et al. Comparison of the right and left ventricle as a systemic ventricle during exercise in patients with congenital heart disease. Am Heart J. 1999;137(6):1185–1194. [37] Norozi K, Wessel A, Alpers V, et al. Chronotropic incompetence in adolescents and adults with congenital heart disease after cardiac surgery. J Card Fail. 2007;13(4):263–268. [38] Bassareo PP, Saba L, Solla P, Barbanti C, Marras AR, Mercuro G. Factors influencing adaptation and performance at physical exercise SANDBERG ET AL . | 261 in complex congenital heart diseases after surgical repair. Biomed Res Int. 2014;2014:862372. [39] Porszasz J, Emtner M, Goto S, Somfay A, Whipp BJ, Casaburi R. Exercise training decreases ventilatory requirements and exercise- induced hyperinflation at submaximal intensities in patients with COPD. Chest. 2005;128(4):2025–2034. [40] Buys R, Cornelissen V, Van De Bruaene A, et al. Measures of exer- cise capacity in adults with congenital heart disease. Int J Cardiol. 2011;153(1):26–30. [41] Reybrouck T, Mertens L, Brusselle S, et al. Oxygen uptake versus exercise intensity: a new concept in assessing cardiovascular exer- cise function in patients with congenital heart disease. Heart. 2000; 84(1):46–52. [42] Cambach W, Chadwick-Straver R, Wagenaar R, van Keimpema A, Kemper H. The effects of a community-based pulmonary rehabilita- tion programme on exercise tolerance and quality of life: a random- ized controlled trial. Eur Respir J. 1997;10(1):104–113. [43] Casaburi R. Factors determining constant work rate exercise toler- ance in COPD and their role in dictating the minimal clinically important difference in response to interventions. COPD. 2005;2(1): 131–136. [44] Laviolette L, Bourbeau J, Bernard S, et al. Assessing the impact of pulmonary rehabilitation on functional status in COPD. Thorax. 2008;63(2):115–121. [45] Sandberg C, Engstr€ om KG, Dellborg M, Thil? en U, Wadell K, Johans- son B. The level of physical exercise is associated with self-reported health status (EQ-5D) in adults with congenital heart disease. Eur J Prev Cardiol. 2015;22(2):240–248. SUPPORTING INFORMATION Additional Supporting Information may be found online in the sup- porting information tab for this article. FIGURE S1 Example of the interval exercise training protocol. The exercise training session had an initial 8 min warm-up without load or with very low load. During the first two weeks, the protocol con- sisted of three intervals and thereafter four intervals. The work load during each interval was adjusted by the patient to reach the indi- vidual training heart rate. The patients were also instructed to reach a perceived exertion corresponding to 14-16 on the Borg scale. The intervals were separated by an active recovery periods of 3 minutes without load or with very low load. Each session ended with a cool down period of approximately 5 min How to cite this article: Sandberg C, Hedstr€ om M, Wadell K, et al. Home-based interval training increases endurance capac
`Scale12
2018-11-02T16:04:26.000Z
This is useful for parsing *Australian street addresses*. It discards initial rubbish, then extracts: 1. BND or CNR, which is useful for geolocating by boundaries 2. *Numbers*. If you use the `regex` Python library, you could get a list of numbers preceding a street name 3. *Name*, e.g. Bourke 4. *Type*, e.g. Road Also discards trailing rubbish Detailed explanation as verbose regex below (?ix) # case insensitive and verbose flag (?:^[A-Z\W]*\W+(?!bnd|cnr)\W+)? # discard initial rubbish (names not including BND/CNR) if present (?:(?!\b(?:{0})\b) # not starting with road type (?P<numbers>\d+-\d+|\d+[A-Z]?)\W+)*? # capture numbers if present, including extension letter (?:\W+(?:AND|&)\W+)* # do not capture AND/& if present (?:(?:(?P<geo>BND|CNR) # capture BND/CNR if present (GEO var) (?:\WOF|\WBY)?)\W+)* # do not capture OF/BY following BND/CNR (?P<name> # capture street name (NAME var) (?:(?!\b(?:{0})\b) # not starting with road type [A-Z]+\W*)+)\W+ # contains letters and non-words only (?:(?P<type>{0}\W))+ # capture street type (TYPE var) and ignores trailing rubbish (?:\W|$) # non-word or end of string
(?ix)(?:^[A-Z\W]*\W+(?!bnd|cnr)\W+)?(?:(?!\b(?:RD|HWY|TRAIL|St|R)\b)(?P<numbers>\d+-\d+|\d+[A-Z]?)\W+)*?(?:\W+(?:AND|&)\W+)*(?:(?:(?P<geo>BND|CNR)(?:\WOF|\WBY)?)\W+)*(?P<name>(?:(?!\b(?:RD|HWY|TRAIL|St|R)\b)[A-Z]+\W*)+)\W+(?:(?P<type>RD|HWY|TRAIL|St|R)\W)+
convention centre, bnd by swanston st and avoca st cnr the hyatt and roland st 123 hudson st BND BY THOMAS RAIL TRAIL, 7 SNOW WHITE HWY & MICKEY RD, 337-343 BOGEYMAN RD, 4, 8, 9-13, 16-18 Fictional Rd & 17B Elm St near junction
discard rubbish, GEO, NUMBERS, NAME, TYPE
2017-10-09T00:04:42.000Z
Prints a statement if expression evaluates to true, otherwise prints an alternative expression
<if (?'name'\w+)(?'op'[=!<>][=]?)(?'value'.+?)>(?'true'.+?)(?:<else>(?'false'.*))?<\/if>
<if varName==TRUE>This will be printed if true <else>Otherwise this will be printed if false </if>
if, ternary
2020-06-06T18:58:33.000Z
proc_notes_(January|February|March|April|May|June|July|August|September|October|November|December)\d{4}.txt
proc_notes_April2020.txt
HCPCS Quarterly File Name Update Date File
2020-04-23T18:48:13.000Z
[ ^\s]([ ]{1,})[ ^\s]
5382948 EGELSTON^ELIZABETH 0102126763 1942-09-17 00:00:00.000 F 2003-02-09 00:00:00.000 1899-12-30 19:39:10.000 CT03011350 28465 1.2.124.113532.10.7.222.5.20030209.190851.3087742 NULL UNKNOWN^RADNET CT NULL PE CHEST 764A NULL BODY Northwestern Memorial Hosp. NMH5_OC0 NULL NULL NULL 4 467 544 NULL 2003-04-27 22:56:55.000 NULL 2003-04-27 23:14:42.000 8 2009-06-07 09:22:07.640 2015-11-14 03:54:07.407 2015-11-14 03:54:08.290 NULL NULL CT NULL 5706865 5382948 CT 1.2.840.113619.2.55.1.1762864829.1989.1044811980.588.5 5 Recon 2: ROUTINE PE NULL 5.7 ROUTINE PE NULL 1.2.124.113532.10.7.222.5.20030209.190851.3087742.9814.0.12 4 200 NULL NULL NULL 8 NULL NULL NULL 7276786 5706865 3 NULL 4 NULL 0102126763\1_2_124_113532_10_7_222_5_\7276786.0 NULL 289158 NULL 3 ASP_NMH_99_LIB2 \\asp1nsx02\ASP_NMH_99_LIB2\Incoming \\asp1nsx02\ASP_NMH_99_LIB2\Images LOCAL
Find spaces in a column aligned text file
2016-08-26T17:26:47.000Z
TRN.*FRLPD\s+FRPLY.*\s*FRLPD\/([\w\s]*).*FRPLY\/([\w\s]*)\/
1.TORNEAMPLE/ERIC 2 HHL RT HK1 LYS IN23NOV OUT26NOV PAST 3 TRN 2C 87 6609 AF 31DEC 1 FRPLY FRLPD HK PAST * 4 TRN 2C 87 6628 AF 01JAN 4 FRLPD FRPLY HK1 1800 2007 FRLPD/LYON PART DIEU//FRPLY/PARIS GARE LYON /TGD * 5 MIS 1A HK1 PAR 23MAY-ARCHIVAGES 6 AP 04.74.07.68.39
Pattern to get trains station names.
2015-12-01T18:34:41.000Z
^(?:(?:(?:0?[13578]|1[02])(\/|-|\.)31)\1|(?:(?:0?[1,3-9]|1[0-2])(\/?|-|\.)(?:29|30)\2))(?:(?:1[6-9]|[2-9]\d)?\d{2})$|^(?:(?:0?2)(\/?|-|\.)(?:29)\3(?:(?:(?:1[6-9]|[2-9]\d)?(?:0[48]|[2468][048]|[13579][26])|(?:(?:16|[2468][048]|[3579][26])00))))$|^(?:(?:0?[1-9])|(?:1[0-2]))(\/?|-|\.)(?:0?[1-9]|1\d|2[0-8])\4(?:(?:1[6-9]|[2-9]\d)?\d{2})$
12/01/1986 02/29/2016 02/29/2015 13/31/1986 12/31/1980 1/32/2015 1/31/2015 01012016 01/01/2016 1/1/2016 1/1/16 01/01/16 01-01-2016 1-1-2016 1-1-16 01-01-16
Date Validation
2015-08-12T19:25:09.000Z
(?:<\s*(\w+).*(?:>|\/>))
<!DOCTYPE html> <html lang="en"> <head> <title></title> <meta charset="UTF-8"> <link href="content/css/app.css" rel="stylesheet"> </head> <body> <div class="max-cols-12 grid-borders"> <div> 1 </div> <div class="col-span-2"> 2 </div> <div> 3 </div> <div> 4 </div> <div> 5 </div> <div> 6 </div> <div> 1 </div> <div> 2 </div> <div> 3 </div> <div> 4 </div> <div> 5 </div> <div> 6 </div> </div> <div> 1 </div> <div class="col-span-2"> 2 </div> <div> 3 </div> <div> 4 </div> <div> 5 </div> <div> 6 </div> <div> 1 </div> <div> 2 </div> <div> 3 </div> <div> 4 </div> <div> 5 </div> <div> 6 </div> </div> </body> </html>
html tag name
2016-07-27T13:05:54.000Z
This regular expression matches are two numeric digits from till 99 excluding 00. Match starts from 01 to 99.
(^([0-9][1-9])$|^([1-9][0-9])$)
100
Two Numeric Digits from 1 to 99 excluding '00'
2016-09-13T12:21:30.000Z
(?=\"video\_title\"\:\"[a-zA-Z0-9 ]+\"\,\"defaultQuality\"\:)(.+?)(?=\"\}\]\,\"video\_unavailable\_country\"\:)
<!doctype html> <html class="xv-responsive" lang="en"> <head> <title>bubble butt mature - XVIDEOS.COM</title> <meta charset="utf-8"> <!--[if IE]><meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"><![endif]--> <meta name="viewport" content="width=device-width, initial-scale=1.0" /> <meta name="keywords" content="xvideos,xvideos.com, x videos,x video,porn,video,videos,none,others"/> <meta name="description" content="XVIDEOS bubble butt mature free"/> <meta name="verify-v1" content="3Awl+ctS3GOag+hKJiSg9SQQ2MR/GwV8H/PAgMhGhcM="/> <meta name="RATING" content="RTA-5042-1996-1400-1577-RTA"/> <meta http-equiv="pics-Label" content='(pics-1.1 "http://www.icra.org/pics/vocabularyv03/" l gen true for "http://xvideos.com" r (n 3 s 3 v 0 l 3 oa 0 ob 0 oc 0 od 0 oe 0 of 0 og 0 oh 0 c 3) gen true for "http://www.xvideos.com" r (n 3 s 3 v 0 l 3 oa 0 ob 0 oc 0 od 0 oe 0 of 0 og 0 oh 0 c 3))'/> <link rel="meta" href="https://www.xvideos.com/labels.rdf" type="application/rdf xml" title="ICRA labels"/> <meta property="og:title" content="bubble butt mature" /> <meta property="og:type" content="video.movie" /> <meta property="og:url" content="http://www.xvideos.com/video36169375/bubble_butt_mature" /> <meta property="og:duration" content="464" /> <meta property="og:image" content="http://img-hw.xvideos-cdn.com/videos/thumbs169ll/3b/76/45/3b7645d885aad5dc1b7c5266fbb5f50e/3b7645d885aad5dc1b7c5266fbb5f50e.6.jpg" /> <meta property="og:video" content="https://static-hw.xvideos.com/swf/xv-player.swf?id_video=36169375" /> <meta property="og:video:type" content="application/x-shockwave-flash" /> <meta property="og:video:width" content="510" /> <meta property="og:video:height" content="400" /> <link rel="search" type="application/opensearchdescription+xml" title="XVideos" href="/rss/rss.xml"> <meta name="format-detection" content="telephone=no"> <link rel="apple-touch-icon" sizes="180x180" href="/apple-touch-icon.png"> <link rel="icon" type="image/png" sizes="32x32" href="/favicon-32x32.png"> <link rel="icon" type="image/png" sizes="16x16" href="/favicon-16x16.png"> <link rel="manifest" href="/manifest.json"> <link rel="mask-icon" href="/safari-pinned-tab.svg" color="#de2600"> <meta name="theme-color" content="#000000"> <link rel="stylesheet" href="https://static-hw.xvideos.com/v-3839f2d896a/v3/css/default/main.css"> <script>if(!window.xv){window.xv={};}window.xv.conf={"sitename":"default","domains":{"slave":"https://www.xvideos.com","static":"https://static-hw.xvideos.com","premium":"https://www.xvideos.red"},"dyn":{"pagefilter":"straight","ref":"N","id":36169375,"i18nvers":{"front":{"en":"e6a78fc6499"},"xvplayer":{"en":"a4163c6c777"}},"nb_thumbs_cols":[],"premium_domain":"https:\/\/www.xvideos.red","has_premium":true,"is_premium":false,"disp_removeads":false,"gentime":1534136833,"ip":"107.12.224.13","country":"US","lazyloading":false,"is_mobile":true,"is_tablet":true,"browser":"Android Browser","chat":{"enabled":true,"firebase":{"apiKey":"AIzaSyBdA3GTILPUH3e5yaWr0uSlhhnqf-92dA8","authDomain":"xv-chat.firebaseapp.com","databaseURL":"https:\/\/xv-chat.firebaseio.com","projectId":"xv-chat","storageBucket":"xv-chat.appspot.com","messagingSenderId":"241416482003"},"server_master":"chat-private-master.xvideos.com","cookie_name":"HEXAVID_LOGIN","prefs":[],"nb_friends":0},"forcedcountry":false,"vp":{"allowed":false},"ls":{"buttons":[{"name":"nb_vids_per_row"}]},"login_info":{"is_logged":false,"is_premium":false,"profile":false,"iptrusted":-1,"recaptchakey":"6LeEkhMTAAAAAFrfG3CxNAT9JiM1oLIkyU7UuYYQ","invrecaptchakey":"6LcM6ScUAAAAAHFxb4HmgMyNHrfi61bf_USRJ4uo"},"locale":"en","countries":[["AF","Afghanistan"],["AL","Albania"],["DZ","Algeria"],["AS","American Samoa"],["AD","Andorra"],["AO","Angola"],["AI","Anguilla"],["AQ","Antarctica"],["AG","Antigua and Barbuda"],["AR","Argentina"],["AM","Armenia"],["AW","Aruba"],["AU","Australia"],["AT","Austria"],["AZ","Azerbaijan"],["BS","Bahamas"],["BH","Bahrain"],["BD","Bangladesh"],["BB","Barbados"],["BY","Belarus"],["BE","Belgium"],["BZ","Belize"],["BJ","Benin"],["BM","Bermuda"],["BT","Bhutan"],["BO","Bolivia"],["BA","Bosnia and Herzegovina"],["BW","Botswana"],["BR","Brazil"],["BN","Brunei Darussalam"],["BG","Bulgaria"],["BF","Burkina Faso"],["BI","Burundi"],["KH","Cambodia"],["CM","Cameroon"],["CA","Canada"],["CV","Cape Verde"],["KY","Cayman Islands"],["CF","Central African Republic"],["TD","Chad"],["CL","Chile"],["CN","China"],["CX","Christmas Island"],["CC","Cocos (Keeling) Islands"],["CO","Colombia"],["KM","Comoros"],["CG","Congo"],["CD","Congo, The Democratic Republic of the"],["CK","Cook Islands"],["CR","Costa Rica"],["CI","Cote d'Ivoire"],["HR","Croatia"],["CU","Cuba"],["CY","Cyprus"],["CZ","Czech Republic"],["DK","Denmark"],["DJ","Djibouti"],["DM","Dominica"],["DO","Dominican Republic"],["EC","Ecuador"],["EG","Egypt"],["SV","El Salvador"],["GQ","Equatorial Guinea"],["ER","Eritrea"],["EE","Estonia"],["ET","Ethiopia"],["FK","Falkland Islands (Malvinas)"],["FO","Faroe Islands"],["FJ","Fiji"],["FI","Finland"],["FR","France"],["GF","French Guiana"],["PF","French Polynesia"],["GA","Gabon"],["GM","Gambia"],["GE","Georgia"],["DE","Germany"],["GH","Ghana"],["GI","Gibraltar"],["GR","Greece"],["GL","Greenland"],["GD","Grenada"],["GP","Guadeloupe"],["GU","Guam"],["GT","Guatemala"],["GG","Guernsey"],["GN","Guinea"],["GW","Guinea-Bissau"],["GY","Guyana"],["HT","Haiti"],["VA","Holy See (Vatican City State)"],["HN","Honduras"],["HK","Hong Kong"],["HU","Hungary"],["IS","Iceland"],["IN","India"],["ID","Indonesia"],["IR","Iran, Islamic Republic of"],["IQ","Iraq"],["IE","Ireland"],["IM","Isle of Man"],["IL","Israel"],["IT","Italy"],["JM","Jamaica"],["JP","Japan"],["JE","Jersey"],["JO","Jordan"],["KZ","Kazakhstan"],["KE","Kenya"],["KI","Kiribati"],["KR","Korea"],["KP","Korea, Democratic People's Republic of"],["KW","Kuwait"],["KG","Kyrgyzstan"],["LA","Lao People's Democratic Republic"],["LV","Latvia"],["LB","Lebanon"],["LS","Lesotho"],["LR","Liberia"],["LY","Libya"],["LI","Liechtenstein"],["LT","Lithuania"],["LU","Luxembourg"],["MO","Macao"],["MK","Macedonia"],["MG","Madagascar"],["MW","Malawi"],["MY","Malaysia"],["MV","Maldives"],["ML","Mali"],["MT","Malta"],["MH","Marshall Islands"],["MQ","Martinique"],["MR","Mauritania"],["MU","Mauritius"],["YT","Mayotte"],["MX","Mexico"],["FM","Micronesia, Federated States of"],["MD","Moldova, Republic of"],["MC","Monaco"],["MN","Mongolia"],["ME","Montenegro"],["MS","Montserrat"],["MA","Morocco"],["MZ","Mozambique"],["MM","Myanmar"],["NA","Namibia"],["NR","Nauru"],["NP","Nepal"],["NL","Netherlands"],["AN","Netherlands Antilles"],["NC","New Caledonia"],["NZ","New Zealand"],["NI","Nicaragua"],["NE","Niger"],["NG","Nigeria"],["NU","Niue"],["MP","Northern Mariana Islands"],["NO","Norway"],["OM","Oman"],["PK","Pakistan"],["PW","Palau"],["PS","Palestinian Territory"],["PA","Panama"],["PG","Papua New Guinea"],["PY","Paraguay"],["PE","Peru"],["PH","Philippines"],["PL","Poland"],["PT","Portugal"],["PR","Puerto Rico"],["QA","Qatar"],["RE","Reunion"],["RO","Romania"],["RU","Russia"],["RW","Rwanda"],["SH","Saint Helena"],["KN","Saint Kitts and Nevis"],["LC","Saint Lucia"],["PM","Saint Pierre and Miquelon"],["VC","Saint Vincent and the Grenadines"],["WS","Samoa"],["SM","San Marino"],["ST","Sao Tome and Principe"],["A2","Satellite"],["SA","Saudi Arabia"],["SN","Senegal"],["RS","Serbia"],["SC","Seychelles"],["SL","Sierra Leone"],["SG","Singapore"],["SK","Slovakia"],["SI","Slovenia"],["SB","Solomon Islands"],["SO","Somalia"],["ZA","South Africa"],["SS","South Sudan"],["ES","Spain"],["LK","Sri Lanka"],["SD","Sudan"],["SR","Suriname"],["SZ","Swaziland"],["SE","Sweden"],["CH","Switzerland"],["SY","Syrian Arab Republic"],["TW","Taiwan"],["TJ","Tajikistan"],["TZ","Tanzania, United Republic of"],["TH","Thailand"],["TL","Timor-Leste"],["TG","Togo"],["TK","Tokelau"],["TO","Tonga"],["TT","Trinidad and Tobago"],["TN","Tunisia"],["TR","Turkey"],["TM","Turkmenistan"],["TC","Turks and Caicos Islands"],["TV","Tuvalu"],["UG","Uganda"],["UA","Ukraine"],["AE","United Arab Emirates"],["GB","United Kingdom"],["UY","Uruguay"],["US","USA"],["UZ","Uzbekistan"],["VU","Vanuatu"],["VE","Venezuela"],["VN","Vietnam"],["VG","Virgin Islands, British"],["VI","Virgin Islands, U.S."],["WF","Wallis and Futuna"],["EH","Western Sahara"],["YE","Yemen"],["ZM","Zambia"],["ZW","Zimbabwe"]],"ads":{"site":"xvideos","categories":"mature,milf,ass,big_ass","tracker":"","banners":[{"type":"square","nb_ban":2,"div_id":"video-ad"},{"type":"footer","nb_ban":1,"div_id":"ad-footer"}]}},"data":{"action":"video","other_locales":{"cs":{"name":"Czech","translated":"\u010ce\u0161tina","country":"CZ","rtl":false},"de":{"name":"German","translated":"Deutsch","country":"DE","rtl":false},"es":{"name":"Spanish","translated":"Espa\u00f1ol","country":"ES","rtl":false},"fr":{"name":"French","translated":"Fran\u00e7ais","country":"FR","rtl":false},"it":{"name":"Italian","translated":"Italiano","country":"IT","rtl":false},"hu":{"name":"Hungarian","translated":"Magyar","country":"HU","rtl":false},"nl":{"name":"Dutch","translated":"Nederlandse","country":"NL","rtl":false},"no":{"name":"Norwegian","translated":"Norsk","country":"NO","rtl":false},"pl":{"name":"Polish","translated":"Polskie","country":"PL","rtl":false},"pt":{"name":"Portugese","translated":"Portugu\u00eas","country":"PT","rtl":false},"ro":{"name":"Romanian","translated":"Rom\u00e2n\u0103","country":"RO","rtl":false},"sv":{"name":"Swedish","translated":"Svenska","country":"SE","rtl":false},"vi-VN":{"name":"Vietnamese","translated":"Ti\u1ebfng Vi\u1ec7t","country":"VN","rtl":false},"tr":{"name":"Turkish","translated":"T\u00fcrk","country":"TR","rtl":false},"el":{"name":"Greek","translated":"\u0395\u03bb\u03bb\u03b7\u03bd\u03b9\u03ba\u03ae","country":"GR","rtl":false},"he":{"name":"Hebrew","translated":"\u05e2\u05d1\u05e8\u05d9\u05ea","country":"IL","rtl":true},"ar":{"name":"Arabic","translated":"\u0627\u0644\u0639\u0631\u0628\u064a\u0629","country":"EG","rtl":true},"hi":{"name":"Hindi","translated":"\u0939\u093f\u0928\u094d\u0926\u0940","country":"IN","rtl":false},"zh":{"name":"Chinese","translated":"\u4e2d\u6587","country":"CN","rtl":false},"ja":{"name":"Japenese","translated":"\u65e5\u672c\u8a9e","country":"JP","rtl":false}},"show_disclaimer":false,"sponsors":[],"related_keywords":["mature","milf","booty","gilf","wife","bubble","butt","none","others"],"id_video":36169375,"uploader_id":250699155,"uploader":"larry__capija","uploader_url":"\/profiles\/larry__capija","vote_urls":{"good":"/video-vote/36169375/GOOD/1010010100101101110000011111110129359/","bad":"/video-vote/36169375/BAD/0101011010010010111101010000010143919/"},"nb_comments":3,"commentscsrf":"0e2ed4425377a72eTR36ZXlpeJkK5VeYYd7BEqaZgj7yiaq7HUB7MNSVtZwDQRY-z2reDo327Qj7Gv_Lor-pLh2FAfGUZmdd_SWYzg=="}};</script> <script src="https://static-hw.xvideos.com/v-fc89b9f942d/v3/js/skins/min/default.header.static.js"></script> </head> <body class="video-page"> <div id="page" class="video-page"> <div id="header"> <header> <div class="stripe white-stripe"> <h1 class="hidden">XVIDEOS.COM</h1> <div class="header-icons" id="header-mobile-right"> <a href="#" id="mobile-login-btn" class="btn btn-default mobile-show-inline-block"><span class="icon user logo-bg mobile-show-inline-block">&nbsp;</span><span class="mobile-hide">ACCOUNT</span></a><a href="/account/create" class="btn btn-default menu-login-acct mobile-hide" data-mode="signup">Join for FREE</a> <a href="/account" class="btn btn-login menu-login-acct mobile-hide" data-mode="signin">Log in</a> <a id="language-switcher"><span class="flag flag-us" title="English"></span></a> <a href="/switch-theme" class="icon theme-dark" id="theme-switcher-btn" title="Switch to dark theme"></a> </div> <a href="#" class="animated-hamburger" id="header-menu-toggle" title="Toggle menu"> <span class="an-h-1"></span> <span class="an-h-2"></span> <span class="an-h-3"></span> <span class="an-h-4"></span> </a> <a href="#" class="icon-f icf-search mobile-show" id="header-mobile-search-toggle" title="Toggle search"></a> <a href="/" class="logo not-premium" id="site-logo-link"> <svg id="site-logo-svg" height="36" width="144"> <image xlink:href="https://static-hw.xvideos.com/v3/img/skins/default/xvideos.com.svg" src="https://static-hw.xvideos.com/v3/img/skins/default/xvideos.com.png" title="XVideos Home" height="36" width="144" class="no-blur" id="site-logo"/> </svg> </a> <form action="/" id="xv-search-form" class="mobile-hide"> <div class="cont"> <div class="input-group"> <input type="text" name="k" value="" class="search-input form-control" maxlength="2048" placeholder="Search 8,054,922 videos" /><span class="input-group-btn"><button type="submit" title="Search" class="search-submit btn btn-default"><span class="icon-f icf-search"></span><span class="mobile-show-inline-block">Search</span></button></span> </div> </div> </form> <h2 class="mobile-hide"> <span class="alt"><span class="text-danger">BIGGER</span> and <span class="text-danger">BETTER</span> than the others... <span class="text-danger">X</span><strong>VIDEOS.COM</strong></span></h2> </div> <h2 id="mobile-slogan" class="mobile-show"> <span class="alt"><span class="text-danger">BIGGER</span> and <span class="text-danger">BETTER</span> than the others... <span class="text-danger">X</span><strong>VIDEOS.COM</strong></span> </h2> </header> </div> <div id="nav" class=""> <nav> <div class="main-categories ordered-label-list"><ul><li class="mobile-show"><a class="btn btn-default label main" id="main-cat-sub-list-btn">Categories</a></li> <li class="mobile-hide"><a class="country-switch btn btn-default main" data-country="us">USA <span class="flag-small flag-us"></span> &#9660;</a></li> <li class="mobile-show" id="version-country-switch-li"><a id="version-country-switch-a" class="mobile-country-switch btn btn-default" data-country="us">Version : <span class="flag-small flag-us"></span> USA</a></li> <li><a class="btn btn-default label" href="/best">Best Videos</a></li> <li><a class="btn btn-default label" href="/pornstars-index">Pornstars</a></li> <li><a class="btn btn-default label" href="/channels-index">Channels</a></li> <li><a class="btn btn-default label" href="/verified/videos">100% Verified</a></li> <li><a class="btn btn-default label" href="/profileslist">Profiles</a></li> <li class="sub-list" id="main-cat-sub-list"><ul><li class="dyn"><a href="/lang" class="btn btn-default"><span class="icon world"></span> Porn in your language</a></li> <li class="dyn topterm topterm-5"><a class="btn btn-default" href="/?k=3d&top">3d</a></li> <li class="dyn topcat topcat-35"><a class="btn btn-default" href="/c/Amateur-65">Amateur</a></li> <li class="dyn topcat topcat-29"><a class="btn btn-default" href="/c/Anal-12">Anal</a></li> <li class="dyn topcat topcat-12"><a class="btn btn-default" href="/c/Arab-159">Arab</a></li> <li class="dyn topcat topcat-30"><a class="btn btn-default" href="/c/Asian+Woman-32">Asian</a></li> <li class="dyn topcat topcat-16"><a class="btn btn-default" href="/c/ASMR-229">ASMR</a></li> <li class="dyn topcat topcat-22"><a class="btn btn-default" href="/c/Ass-14">Ass</a></li> <li class="dyn topterm topterm-13"><a class="btn btn-default" href="/?k=aunt&top">Aunt</a></li> <li class="dyn topcat topcat-33"><a class="btn btn-default" href="/c/bbw-51">BBW</a></li> <li class="dyn topcat topcat-15"><a class="btn btn-default" href="/c/Bi+Sexual-62">Bi</a></li> <li class="dyn topcat topcat-34"><a class="btn btn-default" href="/c/Big+Ass-24">Big Ass</a></li> <li class="dyn topcat topcat-24"><a class="btn btn-default" href="/c/Big+Cock-34">Big Cock</a></li> <li class="dyn topcat topcat-32"><a class="btn btn-default" href="/c/Big+Tits-23">Big Tits</a></li> <li class="dyn topcat topcat-36"><a class="btn btn-default" href="/c/Black+Woman-30">Black</a></li> <li class="dyn topterm topterm-12"><a class="btn btn-default" href="/?k=blackmail&top">Blackmail</a></li> <li class="dyn topcat topcat-18"><a class="btn btn-default" href="/c/Blonde-20">Blonde</a></li> <li class="dyn topcat topcat-19"><a class="btn btn-default" href="/c/Blowjob-15">Blowjob</a></li> <li class="dyn topcat topcat-8"><a class="btn btn-default" href="/c/Brunette-25">Brunette</a></li> <li class="dyn topcat topcat-7"><a class="btn btn-default" href="/c/Cam+Porn-58">Cam Porn</a></li> <li class="dyn topterm topterm-3"><a class="btn btn-default" href="/?k=casting&top">Casting</a></li> <li class="dyn topterm topterm-16"><a class="btn btn-default" href="/?k=caught&top">Caught</a></li> <li class="dyn topterm topterm-10"><a class="btn btn-default" href="/?k=cheating&top">Cheating</a></li> <li class="dyn topterm topterm-9"><a class="btn btn-default" href="/?k=chubby&top">Chubby</a></li> <li class="dyn topterm topterm-20"><a class="btn btn-default" href="/?k=college&top">College</a></li> <li class="dyn topterm topterm-4"><a class="btn btn-default" href="/?k=compilation&top">Compilation</a></li> <li class="dyn topcat topcat-23"><a class="btn btn-default" href="/c/Creampie-40">Creampie</a></li> <li class="dyn topcat topcat-9"><a class="btn btn-default" href="/c/Cumshot-18">Cumshot</a></li> <li class="dyn topterm topterm-15"><a class="btn btn-default" href="/?k=drunk&top">Drunk</a></li> <li class="dyn topcat topcat-2"><a class="btn btn-default" href="/c/Fisting-165">Fisting</a></li> <li class="dyn topcat topcat-31"><a class="btn btn-default" href="/c/Fucked+Up+Family-81">Fucked Up Family</a></li> <li class="dyn topcat topcat-17"><a class="btn btn-default" href="/c/Gangbang-69">Gangbang</a></li> <li class="dyn topcat topcat-3"><a class="btn btn-default" href="/c/Gapes-167">Gapes</a></li> <li class="dyn "><a class="btn btn-default" href="/gay"><span class="icon rainbow"></span> Gay</a></li> <li class="dyn topterm topterm-17"><a class="btn btn-default" href="/?k=hardcore&top">Hardcore</a></li> <li class="dyn topcat topcat-14"><a class="btn btn-default" href="/c/Indian-89">Indian</a></li> <li class="dyn topcat topcat-21"><a class="btn btn-default" href="/c/Interracial-27">Interracial</a></li> <li class="dyn topcat topcat-26"><a class="btn btn-default" href="/c/Latina-16">Latina</a></li> <li class="dyn topcat topcat-28"><a class="btn btn-default" href="/c/Lesbian-26">Lesbian</a></li> <li class="dyn topcat topcat-6"><a class="btn btn-default" href="/c/Lingerie-83">Lingerie</a></li> <li class="dyn topterm topterm-14"><a class="btn btn-default" href="/?k=maid&top">Maid</a></li> <li class="dyn topcat topcat-20"><a class="btn btn-default" href="/c/Mature-38">Mature</a></li> <li class="dyn topterm topterm-19"><a class="btn btn-default" href="/?k=mexicana&top">Mexicana</a></li> <li class="dyn topcat topcat-27"><a class="btn btn-default" href="/c/Milf-19">Milf</a></li> <li class="dyn topcat topcat-4"><a class="btn btn-default" href="/c/Oiled-22">Oiled</a></li> <li class="dyn topterm topterm-7"><a class="btn btn-default" href="/?k=omegle&top">Omegle</a></li> <li class="dyn topterm topterm-18"><a class="btn btn-default" href="/?k=orgasm&top">Orgasm</a></li> <li class="dyn topterm topterm-1"><a class="btn btn-default" href="/?k=pov&top">Pov</a></li> <li class="dyn topcat topcat-11"><a class="btn btn-default" href="/c/Redhead-31">Redhead</a></li> <li class="dyn topcat topcat-0"><a class="btn btn-default" href="/shemale"><span class="icon shemale"></span> Shemale</a></li> <li class="dyn topterm topterm-6"><a class="btn btn-default" href="/?k=sleeping&top">Sleeping</a></li> <li class="dyn topcat topcat-10"><a class="btn btn-default" href="/c/Solo+%26+Masturbation-33">Solo</a></li> <li class="dyn topcat topcat-13"><a class="btn btn-default" href="/c/Squirting-56">Squirting</a></li> <li class="dyn topcat topcat-5"><a class="btn btn-default" href="/c/Stockings-28">Stockings</a></li> <li class="dyn topterm topterm-11"><a class="btn btn-default" href="/?k=teacher&top">Teacher</a></li> <li class="dyn topcat topcat-25"><a class="btn btn-default" href="/c/Teen-13">Teen</a></li> <li class="dyn topterm topterm-2"><a class="btn btn-default" href="/?k=thot&top">Thot</a></li> <li class="dyn topterm topterm-8"><a class="btn btn-default" href="/?k=wife&top">Wife</a></li></ul></li> <li><a class="btn btn-default" href="/tags">All tags</a></li> <li class="mobile-hide"><a class="view-more btn btn-default">+</a></li></ul></div> <a id="nav-language-switcher" class="btn main mobile-show">Language : <span class="flag-small flag-us"></span> English</a> <div id="nav_subs" class="mobile-show"></div> </nav> </div> <div id="mobile-login-menu" class="hidden"><a href="#" class="btn btn-default menu-login-acct" data-mode="signup">Join for FREE</a><a href="#" class="btn btn-default menu-login-acct" data-mode="signin">Log in</a><a href="/my-subs/videos" class="btn btn-default my-subs-nav-link">My subscriptions</a><a href="/videos-i-like" class="btn btn-default">Videos I like</a></div> <a href="#" id="x-messages-btn" class="hidden"> <span class="ic"> <span class="icon-f icf-info-circle" title="Messages from Xvideos.com"></span> <span class="icon-f icf-close" title="Close"></span> </span> <span class="badge">0</span> </a> <div id="main"> <!-- dispo - Fri, 03 Aug 18 06:53:02 +0000 Can exist (not in array). Loaded ! Video exists and loaded. Video exists and OK. --> <div id="ad-header-mobile-contener"></div> <h2 class="page-title">bubble butt mature <span class="duration">7 min</span> </h2> <div class="video-metadata video-tags-list ordered-label-list cropped"> <ul> <li> <a href="/profiles/larry__capija" class="btn btn-default label main uploader-tag hover-name"> <span class="name">Larry Capija</span> <span class="user-subscribe" data-user-id="250699155" data-user-profile="larry__capija"> <span class="count">26</span> </span> </a> </li> <li><a href="/tags/none" class="btn btn-default">none</a></li> <li><a href="/tags/others" class="btn btn-default">others</a></li> <li class="view-more-li"><a href="#" class="view-more btn btn-default" title="more tags">+</a></li> </ul> </div> <div id="content"> <div id="video-ad" class="mobile-hide"></div> <div id="video-player-bg"> <script>var video_related=[{"id":36169111,"u":"\/video36169111\/natalia_maydana_tetona","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/ca\/2a\/5b\/ca2a5b744d3be7b1ecc8d4e701c8df92\/ca2a5b744d3be7b1ecc8d4e701c8df92.3.jpg","tf":"Natalia Maydana tetona","t":"Natalia Maydana tetona","d":"15 sec","r":"81%","n":"2.2k","v":0,"h":0,"hp":0,"p":"larry__capija","pn":"Larry Capija","pu":"\/profiles\/larry__capija"},{"id":36169001,"u":"\/video36169001\/natalia_maydana_culona","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/c2\/35\/aa\/c235aa053cc5f2ce0d0f05d2abca493f\/c235aa053cc5f2ce0d0f05d2abca493f.7.jpg","tf":"Natalia Maydana culona","t":"Natalia Maydana culona","d":"57 sec","r":"80%","n":"2.2k","v":0,"h":0,"hp":0,"p":"larry__capija","pn":"Larry Capija","pu":"\/profiles\/larry__capija"},{"id":32916883,"u":"\/video32916883\/the_united_states_mother_i_d_like_to_fuck_you_won_t_believe","i":"https:\/\/img-hw.xvideos-cdn.com\/videos\/thumbs169\/45\/74\/b3\/4574b3cdd637bb64d62ca1bb71707941\/4574b3cdd637bb64d62ca1bb71707941.1.jpg","tf":"The United States Mother I&#039;d Like to Fuck You Won&#039;t Believe","t":"The United States Mother I&#039;d Like to Fuck You W...","d":"10 min","r":"100%","n":"667.3k","v":0,"h":1,"hp":0,"p":"pusacams","pn":"Pusacams","pu":"\/profiles\/pusacams"},{"id":32625149,"u":"\/video32625149\/delicious_mature_fucked","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/63\/fd\/f6\/63fdf6c34ba7711874697deea221a36e\/63fdf6c34ba7711874697deea221a36e.27.jpg","tf":"Delicious mature fucked","t":"Delicious mature fucked","d":"11 min","r":"100%","n":"189.9k","v":0,"h":1,"hp":0,"p":"bestwomenonly","pn":"Bestwomenonly","pu":"\/profiles\/bestwomenonly"},{"id":33190709,"u":"\/video33190709\/moms_birthday","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/e8\/44\/0c\/e8440c53d01472fd67d387e07e3d3ede\/e8440c53d01472fd67d387e07e3d3ede.8.jpg","tf":"Moms Birthday","t":"Moms Birthday","d":"15 min","r":"100%","n":"5.4M","v":1,"h":1,"hp":0,"p":"jessryan","pn":"JessRyan","pu":"\/pornstar-channels\/jessryan"},{"id":16798111,"u":"\/video16798111\/mature_mif_mj_pawg_and_her_huge_bubble_butt","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/2a\/36\/9d\/2a369d00b0764187469b991b30a48dfd\/2a369d00b0764187469b991b30a48dfd.20.jpg","tf":"mature mif mj pawg and her huge bubble butt","t":"mature mif mj pawg and her huge bubble butt","d":"3 min","r":"98%","n":"224.9k","v":0,"h":0,"hp":0,"p":"mjpawp","pn":"Mjpawp","pu":"\/profiles\/mjpawp"},{"id":8770081,"u":"\/video8770081\/amateur_mature","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/02\/89\/c1\/0289c16441e55cdb86384ea46b95c1db\/0289c16441e55cdb86384ea46b95c1db.30.jpg","tf":"Amateur Mature","t":"Amateur Mature","d":"16 min","r":"95%","n":"746.9k","v":0,"h":0,"hp":0,"p":"rosaaaa","pn":"Rosaaaa","pu":"\/profiles\/rosaaaa"},{"id":27949575,"u":"\/video27949575\/hot_mature_masturbate","i":"https:\/\/img-l3.xvideos-cdn.com\/videos\/thumbs169\/22\/2e\/7f\/222e7f662228b372d681f8cc9b64342d\/222e7f662228b372d681f8cc9b64342d.29.jpg","tf":"Hot mature masturbate","t":"Hot mature masturbate","d":"12 min","r":"100%","n":"335.1k","v":0,"h":0,"hp":0,"p":"kahinomohino","pn":"Kahinomohino","pu":"\/profiles\/kahinomohino"},{"id":21471885,"u":"\/video21471885\/beautiful_busty_mature_milf_with_moving_vagina","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/65\/d3\/d2\/65d3d284635cb07c6aa46b64ef253e5f\/65d3d284635cb07c6aa46b64ef253e5f.1.jpg","tf":"Beautiful Busty Mature MILF with Moving Vagina","t":"Beautiful Busty Mature MILF with Moving Vagina","d":"10 min","r":"99%","n":"404.1k","v":0,"h":1,"hp":0,"p":"cybersluts","pn":"Cybersluts","pu":"\/profiles\/cybersluts"},{"id":37016867,"u":"\/video37016867\/mature_stepmom_spermed","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/d9\/57\/09\/d95709b4f1b9091438a6f74e27c55761\/d95709b4f1b9091438a6f74e27c55761.7.jpg","tf":"Mature stepmom spermed","t":"Mature stepmom spermed","d":"6 min","r":"100%","n":"214.8k","v":0,"h":1,"hp":0,"p":"ednab23","pn":"Ednab23","pu":"\/profiles\/ednab23"},{"id":37197657,"u":"\/video37197657\/thick_mature_in_panty_doggystyle","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/db\/62\/ed\/db62eddd9252eec07d025e4f869cc3a2\/db62eddd9252eec07d025e4f869cc3a2.19.jpg","tf":"thick mature in panty doggystyle","t":"thick mature in panty doggystyle","d":"10 min","r":"100%","n":"582k","v":0,"h":0,"hp":0,"p":"omrongru","pn":"Omrongru","pu":"\/profiles\/omrongru"},{"id":31519825,"u":"\/video31519825\/mutter_fickt_mit_dem_sohn_der_besten_freundin_wenn_alleine","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/b1\/8c\/f5\/b18cf51a08667a4a0f46c09e35382789\/b18cf51a08667a4a0f46c09e35382789.6.jpg","tf":"Mutter fickt mit dem Sohn der besten Freundin wenn alleine","t":"Mutter fickt mit dem Sohn der besten Freundin w...","d":"9 min","r":"97%","n":"442.2k","v":0,"h":1,"hp":0,"p":"scout69-com","pn":"Scout69 Com","pu":"\/channels\/scout69-com"},{"id":35240603,"u":"\/video35240603\/mature_hot_whore_cumming","i":"https:\/\/img-l3.xvideos-cdn.com\/videos\/thumbs169\/e5\/30\/d3\/e530d336d0913f337c93bc1ea7161828\/e530d336d0913f337c93bc1ea7161828.17.jpg","tf":"Mature Hot Whore Cumming","t":"Mature Hot Whore Cumming","d":"14 min","r":"6%","n":"525.1k","v":0,"h":0,"hp":0,"p":"billiegorgeouswoman","pn":"Billiegorgeouswoman","pu":"\/profiles\/billiegorgeouswoman"},{"id":37045409,"u":"\/video37045409\/mature_bodybuilder_groans_with_pleasure","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/56\/6f\/09\/566f0990618b508fbbcded7807d75d30\/566f0990618b508fbbcded7807d75d30.13.jpg","tf":"Mature bodybuilder groans with pleasure","t":"Mature bodybuilder groans with pleasure","d":"4 min","r":"100%","n":"365.9k","v":0,"h":0,"hp":0,"p":"freakingfit","pn":"Freakingfit","pu":"\/profiles\/freakingfit"},{"id":37345997,"u":"\/video37345997\/mature_cute_mommy","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/93\/0d\/c8\/930dc808faf71e42e27e1e5bab466294\/930dc808faf71e42e27e1e5bab466294.27.jpg","tf":"Mature Cute Mommy","t":"Mature Cute Mommy","d":"10 min","r":"61%","n":"114.3k","v":0,"h":0,"hp":0,"p":"anna_cougar_mother","pn":"Anna Cougar Mother","pu":"\/profiles\/anna_cougar_mother"},{"id":36083885,"u":"\/video36083885\/seduce_mature","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/cc\/ce\/aa\/ccceaa42c01298e43d8d52fa15f99840\/ccceaa42c01298e43d8d52fa15f99840.4.jpg","tf":"Seduce mature","t":"Seduce mature","d":"3 min","r":"87%","n":"594.2k","v":0,"h":0,"hp":0,"p":"shrifucku","pn":"Shrifucku","pu":"\/profiles\/shrifucku"},{"id":34994683,"u":"\/video34994683\/cute_mature_mom","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/48\/8c\/0b\/488c0b27600a4fa93feabf1ee2376ebf\/488c0b27600a4fa93feabf1ee2376ebf.25.jpg","tf":"Cute Mature Mom","t":"Cute Mature Mom","d":"13 min","r":"98%","n":"102.7k","v":0,"h":0,"hp":0,"p":"billiegorgeouswoman","pn":"Billiegorgeouswoman","pu":"\/profiles\/billiegorgeouswoman"},{"id":36093851,"u":"\/video36093851\/pov_fuck_for_hot_mature","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/ea\/3a\/0f\/ea3a0f925aa84c0db75269a458e9aa39\/ea3a0f925aa84c0db75269a458e9aa39.4.jpg","tf":"Pov Fuck For Hot Mature","t":"Pov Fuck For Hot Mature","d":"17 min","r":"100%","n":"160.9k","v":0,"h":1,"hp":0,"p":"markcvff","pn":"Markcvff","pu":"\/profiles\/markcvff"},{"id":14753505,"u":"\/video14753505\/mature_ass_big_ass","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/b5\/4f\/7f\/b54f7fe1197596da220c2473f9a561f3\/b54f7fe1197596da220c2473f9a561f3.16.jpg","tf":"MATURE ASS BIG ASS","t":"MATURE ASS BIG ASS","d":"4 min","r":"100%","n":"459.5k","v":1,"h":0,"hp":0,"p":"rbredbull","pn":"Rbredbull","pu":"\/profiles\/rbredbull"},{"id":21802727,"u":"\/video21802727\/56yr_old_bubble_butt_mature_shows_tight_panties_part_2_-_cutecam.org","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/fb\/23\/eb\/fb23ebe5f7aa3ee99713f380af2a0433\/fb23ebe5f7aa3ee99713f380af2a0433.26.jpg","tf":"56yr old bubble butt mature shows tight panties part 2 - cutecam.org","t":"56yr old bubble butt mature shows tight panties...","d":"14 min","r":"82%","n":"51.3k","v":0,"h":0,"hp":0,"p":"casey755","pn":"Casey755","pu":"\/profiles\/casey755"},{"id":36018767,"u":"\/video36018767\/esposa_peituda_dando","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/5d\/77\/94\/5d7794b9383f01c4b26a149bafbb4f20\/5d7794b9383f01c4b26a149bafbb4f20.13.jpg","tf":"Esposa peituda dando","t":"Esposa peituda dando","d":"6 min","r":"99%","n":"2.3M","v":0,"h":1,"hp":0,"p":"red_1987","pn":"Red 1987","pu":"\/profiles\/red_1987"},{"id":37616731,"u":"\/video37616731\/anal_mature","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/da\/5c\/f8\/da5cf88d3d329bce48ca4e09f97838a0\/da5cf88d3d329bce48ca4e09f97838a0.6.jpg","tf":"Anal mature","t":"Anal mature","d":"2 min","r":"100%","n":"567.5k","v":0,"h":1,"hp":0,"p":"xgranny-blogspot","pn":"Xgranny-blogspot","pu":"\/profiles\/xgranny-blogspot"},{"id":15584985,"u":"\/video15584985\/mature_myra_60_","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/29\/c4\/e2\/29c4e2348838ec24de85e6f9a2bae5d2\/29c4e2348838ec24de85e6f9a2bae5d2.28.jpg","tf":"Mature Myra (60)","t":"Mature Myra (60)","d":"27 min","r":"100%","n":"6.5M","v":0,"h":1,"hp":0,"p":"maturenl","pn":"Mature Nl","pu":"\/channels\/maturenl"},{"id":34995009,"u":"\/video34995009\/bisex_cuckold_mature_action","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/45\/2b\/94\/452b946b44a4292f554158323cb94038\/452b946b44a4292f554158323cb94038.5.jpg","tf":"bisex cuckold mature action","t":"bisex cuckold mature action","d":"7 min","r":"98%","n":"180.1k","v":0,"h":0,"hp":0,"p":"macsex7","pn":"Macsex7","pu":"\/profiles\/macsex7"},{"id":25082301,"u":"\/video25082301\/realy_hot_mature","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/93\/2b\/0b\/932b0b7f3f71d803577b67dff7e1fe3a\/932b0b7f3f71d803577b67dff7e1fe3a.19.jpg","tf":"Realy Hot Mature","t":"Realy Hot Mature","d":"13 min","r":"91%","n":"592.3k","v":0,"h":1,"hp":0,"p":"audie91","pn":"Audie91","pu":"\/profiles\/audie91"},{"id":36277843,"u":"\/video36277843\/daddyslilsquirt_does_a_big_squirt","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/85\/0e\/84\/850e8464e3925969280dc66a1f8d135b\/850e8464e3925969280dc66a1f8d135b.12.jpg","tf":"Daddyslilsquirt does a big squirt","t":"Daddyslilsquirt does a big squirt","d":"40 sec","r":"100%","n":"291.7k","v":1,"h":1,"hp":0,"p":false},{"id":14526853,"u":"\/video14526853\/hot_mature_with_teen","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/c9\/4b\/c3\/c94bc332510d1793031321b0f8185be6\/c94bc332510d1793031321b0f8185be6.20.jpg","tf":"Hot mature with teen","t":"Hot mature with teen","d":"6 min","r":"100%","n":"318.1k","v":0,"h":0,"hp":0,"p":"shearin07","pn":"Shearin07","pu":"\/profiles\/shearin07"},{"id":36391747,"cu":"\/video36391747\/THUMBNUM\/big_butt_fuck_-_https_bit.ly_2joyp5z","u":"\/video36391747\/big_butt_fuck_-_https_bit.ly_2joyp5z","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/a4\/58\/da\/a458da44c2704d282faaaa873971e3e1\/a458da44c2704d282faaaa873971e3e1.15.jpg","tf":"BIG BUTT FUCK - https:\/\/bit.ly\/2JoYp5z","t":"BIG BUTT FUCK - https:\/\/bit.ly\/2JoYp5z","d":"6 min","r":"100%","n":"17.5k","v":0,"h":1,"hp":0,"p":"hugomosa","pn":"Hugomosa","pu":"\/profiles\/hugomosa"},{"id":2590923,"u":"\/video2590923\/ripe_older_lady_with_huge","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/07\/1a\/db\/071adb467df9565c6253039de2948de9\/071adb467df9565c6253039de2948de9.24.jpg","tf":"Ripe older lady with huge","t":"Ripe older lady with huge","d":"5 min","r":"100%","n":"1.1M","v":0,"h":0,"hp":0,"p":"maturenl","pn":"Mature Nl","pu":"\/channels\/maturenl"},{"id":28128345,"u":"\/video28128345\/sexy_mature_fucked_hard","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/ad\/17\/5a\/ad175a313b09539b86fd24f5d7a24602\/ad175a313b09539b86fd24f5d7a24602.22.jpg","tf":"Sexy Mature Fucked Hard","t":"Sexy Mature Fucked Hard","d":"6 min","r":"99%","n":"56.7k","v":0,"h":0,"hp":0,"p":"vmaxass","pn":"Vmaxass","pu":"\/profiles\/vmaxass"},{"id":23850952,"u":"\/video23850952\/mature_very_sexy_secretary","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/bc\/6a\/56\/bc6a563c400c94f6b05c1c18a338a02a\/bc6a563c400c94f6b05c1c18a338a02a.12.jpg","tf":"MATURE VERY SEXY SECRETARY","t":"MATURE VERY SEXY SECRETARY","d":"2 min","r":"100%","n":"706k","v":0,"h":1,"hp":0,"p":"wholittt1","pn":"Wholittt1","pu":"\/profiles\/wholittt1"},{"id":33916409,"u":"\/video33916409\/mature_german_lady","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/14\/fc\/76\/14fc762ef083a86e3c37bce8af973fd4\/14fc762ef083a86e3c37bce8af973fd4.17.jpg","tf":"Mature German Lady","t":"Mature German Lady","d":"6 min","r":"100%","n":"142.9k","v":0,"h":0,"hp":0,"p":"tonixx71","pn":"Tonixx71","pu":"\/profiles\/tonixx71"},{"id":11146761,"u":"\/video11146761\/very_mature_milf_2_1","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/c9\/6b\/87\/c96b87ee25d5c7ae15134ab8f5419dad\/c96b87ee25d5c7ae15134ab8f5419dad.3.jpg","tf":"very mature milf 2 1","t":"very mature milf 2 1","d":"6 min","r":"99%","n":"31.6k","v":0,"h":0,"hp":0,"p":"horny-teen-gal","pn":"Horny-teen-gal","pu":"\/profiles\/horny-teen-gal"},{"id":27698693,"u":"\/video27698693\/pawg_with_big_bubble_ass_gets_reamed_by_black_cock","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/ab\/d1\/27\/abd127dd67d9b4996ed29714bec50f99\/abd127dd67d9b4996ed29714bec50f99.13.jpg","tf":"PAWG with Big Bubble Ass Gets Reamed by Black Cock","t":"PAWG with Big Bubble Ass Gets Reamed by Black Cock","d":"52 sec","r":"100%","n":"314.8k","v":0,"h":1,"hp":0,"p":"cheathookups","pn":"Cheathookups","pu":"\/profiles\/cheathookups"},{"id":609098,"u":"\/video609098\/mature-2dd_1_","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/d6\/63\/e2\/d663e22cde19e12039966a42734a1b5a\/d663e22cde19e12039966a42734a1b5a.30.jpg","tf":"mature-2dd (1)","t":"mature-2dd (1)","d":"20 sec","r":"99%","n":"2.4M","v":0,"h":0,"hp":0,"p":false},{"id":2470320,"u":"\/video2470320\/mff_mature_threesome","i":"https:\/\/img-l3.xvideos-cdn.com\/videos\/thumbs169\/7f\/73\/50\/7f73509909765c60cfd1cce2b3199e24\/7f73509909765c60cfd1cce2b3199e24.29.jpg","tf":"Mff mature threesome","t":"Mff mature threesome","d":"5 min","r":"36%","n":"198.7k","v":0,"h":0,"hp":0,"p":false},{"id":31289245,"u":"\/video31289245\/comendo_a_esposa_escondido_no_banheiro","i":"https:\/\/img-l3.xvideos-cdn.com\/videos\/thumbs169\/03\/91\/b2\/0391b2dd961340d53b3120f3dfdd975d\/0391b2dd961340d53b3120f3dfdd975d.30.jpg","tf":"Comendo a esposa escondido no banheiro","t":"Comendo a esposa escondido no banheiro","d":"4 min","r":"99%","n":"815.6k","v":0,"h":0,"hp":0,"p":"red_1987","pn":"Red 1987","pu":"\/profiles\/red_1987"},{"id":37765009,"u":"\/video37765009\/mature_midget_first_threesome","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/ce\/ca\/9e\/ceca9eda91c0a1c1ee5b7afb6b408c99\/ceca9eda91c0a1c1ee5b7afb6b408c99.2.jpg","tf":"mature midget first threesome","t":"mature midget first threesome","d":"12 min","r":"100%","n":"107.2k","v":0,"h":1,"hp":1,"p":"flexibabe","pn":"Extreme Movie Pass","pu":"\/channels\/flexibabe"},{"id":27727819,"u":"\/video27727819\/taylor_thicke_vs_bbc_","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/0e\/78\/9a\/0e789ad69ba6a51e0b779b238ce95293\/0e789ad69ba6a51e0b779b238ce95293.21.jpg","tf":"TAYLOR THICKE VS BBC!!!!!!","t":"TAYLOR THICKE VS BBC!!!!!!","d":"2 min","r":"99%","n":"1.8M","v":1,"h":1,"hp":0,"p":"herthickness","pn":"Herthickness","pu":"\/amateur-channels\/herthickness"},{"id":10534141,"u":"\/video10534141\/lisa_gets_freaky","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/a3\/9c\/3d\/a39c3d4a227ed2b67b8d3a2644a17c2a\/a39c3d4a227ed2b67b8d3a2644a17c2a.3.jpg","tf":"Lisa gets freaky","t":"Lisa gets freaky","d":"21 min","r":"100%","n":"357.7k","v":0,"h":0,"hp":0,"p":"shatteredchin","pn":"Shatteredchin","pu":"\/profiles\/shatteredchin"},{"id":27526263,"u":"\/video27526263\/gordinha_gostosa_gravando_a_foda","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/31\/94\/65\/3194656e98589a16f498cfce0a0e49a1\/3194656e98589a16f498cfce0a0e49a1.25.jpg","tf":"Gordinha gostosa gravando a foda","t":"Gordinha gostosa gravando a foda","d":"2 min","r":"100%","n":"1.2M","v":0,"h":1,"hp":0,"p":"red_1987","pn":"Red 1987","pu":"\/profiles\/red_1987"},{"id":35370729,"u":"\/video35370729\/hello_british_stepmom","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/10\/c6\/f4\/10c6f4ee1c3b8418302073bb8817201c\/10c6f4ee1c3b8418302073bb8817201c.18.jpg","tf":"Hello british stepmom","t":"Hello british stepmom","d":"29 min","r":"99%","n":"476.7k","v":0,"h":1,"hp":0,"p":"euroadu1tp0rn","pn":"Euroadu1tp0rn","pu":"\/profiles\/euroadu1tp0rn"},{"id":13177479,"u":"\/video13177479\/milf_seduce_young_man","i":"https:\/\/images-llnw.xvideos-cdn.com\/videos\/thumbs169\/ae\/ad\/02\/aead020ab3cc13803aa20bfed6128871\/aead020ab3cc13803aa20bfed6128871.21.jpg","tf":"Milf seduce young man","t":"Milf seduce young man","d":"4 min","r":"100%","n":"1.4M","v":0,"h":0,"hp":0,"p":"azulsalvaje","pn":"Azulsalvaje","pu":"\/profiles\/azulsalvaje"},{"id":10938530,"u":"\/video10938530\/mi_hermano_emborracha_a_la_abuela_y_le_pone_mi_ropa._tremenda_metida_de_verga","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/a8\/42\/4d\/a8424d46e5ce888492a19ed83b38dca8\/a8424d46e5ce888492a19ed83b38dca8.12.jpg","tf":"Mi hermano emborracha a la abuela y le pone mi ropa. Tremenda metida de verga","t":"Mi hermano emborracha a la abuela y le pone mi ...","d":"10 min","r":"100%","n":"2.8M","v":0,"h":0,"hp":0,"p":"eddielonerloner","pn":"Eddielonerloner","pu":"\/profiles\/eddielonerloner"},{"id":28415389,"cu":"\/video28415389\/THUMBNUM\/cheating_bbw_tonya","u":"\/video28415389\/cheating_bbw_tonya","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/66\/31\/6e\/66316e6d48d0ce707985513e75da468d\/66316e6d48d0ce707985513e75da468d.15.jpg","tf":"Cheating bbw tonya","t":"Cheating bbw tonya","d":"11 min","r":"86%","n":"4.9k","v":0,"h":1,"hp":0,"p":"pulsemex","pn":"Pulsemex","pu":"\/profiles\/pulsemex"},{"id":36529377,"u":"\/video36529377\/med_student_amateur_milf_fucked_for_tuition_pov","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/fb\/2d\/de\/fb2dde339b9ad44f68a1bfe0b2e80776\/fb2dde339b9ad44f68a1bfe0b2e80776.6.jpg","tf":"Med Student Amateur Milf Fucked for Tuition POV","t":"Med Student Amateur Milf Fucked for Tuition POV","d":"12 min","r":"100%","n":"327.9k","v":0,"h":1,"hp":0,"p":"mompov","pn":"Mom Pov","pu":"\/channels\/mompov"},{"id":23652396,"u":"\/video23652396\/thick_busty_cougars_first_porn","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/50\/1f\/bf\/501fbfa98c12194b3db6c3ff8835defd\/501fbfa98c12194b3db6c3ff8835defd.11.jpg","tf":"Thick busty cougars first porn","t":"Thick busty cougars first porn","d":"14 min","r":"100%","n":"3.8M","v":0,"h":1,"hp":0,"p":"mompov","pn":"Mom Pov","pu":"\/channels\/mompov"},{"id":36545447,"u":"\/video36545447\/mom_shows_off_ass_in_blue_jeans_and_more","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/f2\/ea\/a2\/f2eaa2bc5e1d5826c008b14905c6b812\/f2eaa2bc5e1d5826c008b14905c6b812.15.jpg","tf":"Mom Shows Off Ass In Blue Jeans and MoRE","t":"Mom Shows Off Ass In Blue Jeans and MoRE","d":"11 min","r":"100%","n":"2.8M","v":1,"h":1,"hp":1,"p":"jessryan","pn":"JessRyan","pu":"\/pornstar-channels\/jessryan"},{"id":3611385,"u":"\/video3611385\/busty_cougar_fucked_in_the_shower","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/49\/fb\/d8\/49fbd8c8843f7d4ea944fe7e03a27ddf\/49fbd8c8843f7d4ea944fe7e03a27ddf.7.jpg","tf":"Busty cougar fucked in the shower","t":"Busty cougar fucked in the shower","d":"8 min","r":"100%","n":"1.7M","v":0,"h":0,"hp":0,"p":"mompov","pn":"Mom Pov","pu":"\/channels\/mompov"},{"id":37710035,"u":"\/video37710035\/shaved_mature_handjob_with_cumshot_-_http_bit.ly_2un4znf","i":"https:\/\/img-egc.xvideos-cdn.com\/videos\/thumbs169\/1e\/ca\/bc\/1ecabc1032ac9bcc3295f736153dd241\/1ecabc1032ac9bcc3295f736153dd241.2.jpg","tf":"Shaved mature handjob with cumshot - http:\/\/bit.ly\/2uN4znF","t":"Shaved mature handjob with cumshot - http:\/\/bit...","d":"29 min","r":"100%","n":"93.5k","v":0,"h":0,"hp":0,"p":"chepase780","pn":"Chepase780","pu":"\/profiles\/chepase780"}];window.wpn_categories = "mature,milf,ass,big_ass";</script> <div id="html5video" style="line-height: normal; min-height: 300px;"> <div id="html5video_base" style="display: none;"><div style="width: 100%; text-align: center;"><a href="https://vid-egc.xvideos-cdn.com/videos/mp4/3/b/7/xvideos.com_3b7645d885aad5dc1b7c5266fbb5f50e.mp4?h3WIDb2Pie-Q3Gu4I3O-_CtlNxqx_yHhc2rbaJ5zBSH5l-mlMjv9zUD_A6F0OY0Tgx05fd9HZOC9b23Rh1dZXktsFrnCQNOOqJq6uT4nsV760p0SDVueWXeHr_6hoCb-BdK5_1Wsweifdts5E0zfXPhHza9DMA4jGuKqs22sBAYlDuYN6oKVHRoFXQmREWcLYVW9xAJBExM"><img src="https://img-hw.xvideos-cdn.com/videos/thumbslll/3b/76/45/3b7645d885aad5dc1b7c5266fbb5f50e/3b7645d885aad5dc1b7c5266fbb5f50e.15.jpg" style="max-width:100%; height:auto;"></a></div><div style='width: 99%; text-align: center; font-size: 28px; border: 2px #333 solid; padding: 10px; display: block; background: #888;'><div style='font-weight: bold; padding: 3px; border: 1px #000 solid; background: #CCC;'><a href="https://vid-egc.xvideos-cdn.com/videos/3gp/3/b/7/xvideos.com_3b7645d885aad5dc1b7c5266fbb5f50e.mp4?egwwXICcvqx7XJ1_MBXwPPHSoK_4FEhEPVtgSTVxcUOl-Vnjj3u4C1el8UGBM-EfDHQdMXHWHYeizDGP26zoKr6ONFYOPsn_XxAqZRtjytiiV1gb_HOIYB0JpAikZwmVwfAZdTQeW_ZwTcdLGW2jjABZDhrYkp73NoRwRJ3X0-eILUNyMMgOKEwZi_MGv663i1gt0WUqDn4">View Low Qual</a></div><div style='font-weight: bold; padding: 3px; border: 1px #000 solid; margin-top: 10px; background: #CCC;'><a href="https://vid-egc.xvideos-cdn.com/videos/mp4/3/b/7/xvideos.com_3b7645d885aad5dc1b7c5266fbb5f50e.mp4?h3WIDb2Pie-Q3Gu4I3O-_CtlNxqx_yHhc2rbaJ5zBSH5l-mlMjv9zUD_A6F0OY0Tgx05fd9HZOC9b23Rh1dZXktsFrnCQNOOqJq6uT4nsV760p0SDVueWXeHr_6hoCb-BdK5_1Wsweifdts5E0zfXPhHza9DMA4jGuKqs22sBAYlDuYN6oKVHRoFXQmREWcLYVW9xAJBExM">View High Qual</a></div></div><br /><script> document.addEventListener("DOMContentLoaded", function () { function createRequestObject() { var xhr; try { xhr = new XMLHttpRequest(); } catch (e) { xhr = new ActiveXObject("Microsoft.XMLHTTP"); } return xhr; } if (typeof html5player !== 'undefined') { return; } var debug_call = createRequestObject(); debug_call.open('GET', '/html5player/staticplayerloaded/36169375/7', true); debug_call.onreadystatechange = function () { if (debug_call.readyState !== 4) { return; } if (debug_call.status !== 200) { return; } } debug_call.send(); }); </script> </div> </div> <script src="https://static-hw.xvideos.com/v3/js/i18n/xvplayer/english.js"></script> <script src="https://static-hw.xvideos.com/v-65effc35c24/v3/js/skins/min/player.html5.static.js" onerror="xv.console.log(this.src + ' load failed', 'Video page');"></script> <link rel="stylesheet" href="https://static-hw.xvideos.com/v-48f36f194fc/v3/css/player/html5.css"> <script> logged_user = false; var static_id_cdn = 2; var html5player = new HTML5Player('html5video', '36169375'); if (html5player) { html5player.setVideoTitle('bubble butt mature'); html5player.setSponsors(false); html5player.setVideoUrlLow('https://vid-egc.xvideos-cdn.com/videos/3gp/3/b/7/xvideos.com_3b7645d885aad5dc1b7c5266fbb5f50e.mp4?3mHXpMmALW5QdtE6XOHRo2HRamANwHjwA_XmoiEK0pAeGdFbDLsNxoJnue5_-UffLZtEVrgRqqv7sdMWg4YQamK7oGKTW0ODgLfPUCmo0mzBzw7AaNOTghfxiltPB6WSIzQKIJhzkfg34bPou_QoSUvLo2tT00gjKCPnxh7J-rH8S59-jnQ1FeJPwWpHiaOg0w2btrXWqxo'); html5player.setVideoUrlHigh('https://vid-egc.xvideos-cdn.com/videos/mp4/3/b/7/xvideos.com_3b7645d885aad5dc1b7c5266fbb5f50e.mp4?0w12HcQOSd3NavaCC-7GA_paCGFK26L7i05vB2g-LClVZg5RLklzTUW3Q6tb7UlG0pcSF-ij-BY0dIlKiyRSRIIa_xO6jHNz0onCQSIKqM-TZAjjioGm7IK4v9b1v8bn-wMT_CXgnLlZPL2g0EkF69PwhVoDjr5qqMm9YcCmsVwVaEkYPWvayU-gptf2v_F_6UecsPlnb0w'); html5player.setVideoHLS('https://hls-hw.xvideos-cdn.com/videos/hls/3b/76/45/3b7645d885aad5dc1b7c5266fbb5f50e/hls.m3u8?e=1534147633&l=0&h=8a01dd04a2451b562593998804933f36'); html5player.setThumbUrl('https://img-hw.xvideos-cdn.com/videos/thumbslll/3b/76/45/3b7645d885aad5dc1b7c5266fbb5f50e/3b7645d885aad5dc1b7c5266fbb5f50e.15.jpg'); html5player.setThumbUrl169('https://img-hw.xvideos-cdn.com/videos/thumbs169lll/3b/76/45/3b7645d885aad5dc1b7c5266fbb5f50e/3b7645d885aad5dc1b7c5266fbb5f50e.6.jpg'); html5player.setRelated(video_related); html5player.setThumbSlide('https://img-hw.xvideos-cdn.com/videos/thumbs169/3b/76/45/3b7645d885aad5dc1b7c5266fbb5f50e/mozaique.jpg'); html5player.setThumbSlideBig('https://img-hw.xvideos-cdn.com/videos/thumbs169/3b/76/45/3b7645d885aad5dc1b7c5266fbb5f50e/mozaiquefull.jpg'); html5player.setThumbSlideMinute('https://img-hw.xvideos-cdn.com/videos/thumbs169/3b/76/45/3b7645d885aad5dc1b7c5266fbb5f50e/mozaiquemin_'); html5player.setIdCDN('7'); html5player.setIdCdnHLS('2'); html5player.setFakePlayer(false); html5player.setDesktopiew(false); html5player.setSeekBarColor('#de2600'); html5player.setUploaderName('larry__capija'); html5player.setVideoURL('/video36169375/bubble_butt_mature'); html5player.setStaticDomain('static-hw.xvideos.com'); html5player.setHttps(); html5player.setCanUseHttps(); document.getElementById('html5video').style.minHeight = ''; html5player.initPlayer(); } </script> <script> if (document.getElementById('html5video_base')) { document.getElementById('html5video_base').style.display = ''; } if (!html5player) { document.getElementById('html5video').style.minHeight = ''; xv.console.log('Unable to load HTML5Player', 'Video page'); function createRequestObject() { var xhr; try { xhr = new XMLHttpRequest(); } catch (e) { xhr = new ActiveXObject("Microsoft.XMLHTTP"); } return xhr; } var js_error = createRequestObject(); js_error.open('GET', '/html5player/jserror/36169375/2', true); js_error.send(); } </script> </div> </div> <div id="video-tabs" class="xv-tabs"><div id="video-views-votes"><span class="nb-views"><span class="views-full"> <strong id="nb-views-number">165,602</strong> views </span><strong class="nb-views-number">166k</strong></span><span class="vote-actions"><a class="btn btn-default vote-action-good"><span class="icon thumb-up black black-hover">&nbsp;</span></a><a class="btn btn-default vote-action-bad"><span class="icon thumb-down grey black-hover">&nbsp;</span></a></span><span class="rating-box">99<span class="mobile-hide decimals">.01</span>% <span class="icon thumb-up grey">&nbsp;</span></span></div><ul class="tab-buttons"><li><a class="btn btn-default" id="tabComments_btn"><span class="icon comments-small"></span><span class="visible-lg-inline"> Comments</span><span class="navbadge nb-video-comments nb-video-comments-3 ">3</span></a></li><li><a class="btn btn-default"><span class="icon download"></span><span class="visible-lg-inline"> Download</span></a></li><li><a class="btn btn-default"><span class="icon favorites-add"></span><span class="visible-lg-inline"> Add to my favorites</span></a></li><li><a class="btn btn-default"><span class="icon report"></span><span class="visible-lg-inline"> Report</span></a></li><li><a class="btn btn-default"><span class="visible-lg-inline"><span class="icon-f icf-embed"></span> Embed</span><span class="seperator visible-lg-inline-block">/</span><span class="icon share-small"></span><span class="visible-lg-inline"> Share</span></a></li></ul><div class="tabs"><div id="tabComments" class="tab"><h4>Comments (<span class="nb-video-comments">3</span>):</h4><a class="btn btn-default btn-sm" id="video-post-comment">Post a comment</a><div id="comments-container"><div id="comments"></div></div></div><div id="tabDownload" class="tab"></div><div id="tabFavs" class="tab"><h4 class="bg-title grey-dark top no-border">Add this video to one of my favorites list:</h4><div id="favs-container"></div></div><div id="tabReport" class="tab"><h4 class="bg-title grey-dark top no-border">Report this video:</h4></div><div id="tabShareAndEmbed" class="tab"><h4 class="bg-title grey-dark top no-border">Embed this video to your site with this code:</h4><input type="text" onclick="this.focus(); this.select();" value="&lt;iframe src=&quot;https://www.xvideos.com/embedframe/36169375&quot; frameborder=0 width=510 height=400 scrolling=no allowfullscreen=allowfullscreen&gt;&lt;/iframe&gt;" class="form-control"><h4 class="bg-title grey-dark no-border">Share this video:</h4></div></div></div>
Xvid1
2018-08-13T05:10:15.000Z
order-code 20220623-19563352 20220623-18261367 20220606-15484894 20220606-15484 20220606 20220606-15 202206 33333333-33333333333 5453345345345353434646 3463334334535 202206a 2022067-+
^[0-9-]{0,8}([-][0-9-]{0,8})?$
20220623-19563352 20220623-18261367 20220606-15484894 20220606-15484 20220606 20220606-15 202206 33333333-33333333333 5453345345345353434646 3463334334535 202206a 2022067-+
Bluerose order-code
2022-07-15T18:57:40.000Z
Allows optional variation in spaces and dashes and brackets as well as international numbers
(^\d{1,3}((\s|-))?\(?\d\d\d\)?|^\(?\d\d\d\)?)((\s|-))?\d\d\d((\s|-))?\d\d\d\d$
// These Should Work 1 123 321 1234 1 (123-321-1234 11233211234 1(123)321-1234 123-321-1234 1-123321-1234 1(123321-1234 // These Should Not 1111 123-321-1234 1 123 32112-34 1(123) -321-1234 1(123321123-4 12345678901234
Phone Number check format
2018-07-17T15:23:57.000Z
^\s*(?<mac>\w{4}\.\w{4}\.\w{4})\s*(?<vlan>\d*)\s*(?<type>\w*)\s*(?<port>(\w|-|\/|:|\d*)*)\s*(?<vc>\w*\s*\d*)\s*(?<time>(\w|-|\/|:|\d*)*)$
ac9e.1797.b9f3 1007 Dynamic gpon-onu_1/2/7:1 vport 1 N/A
fdb-mac-table (zte)
2020-06-25T04:30:26.000Z
^[-_a-zA-Z0-9.']+(\s+[-_a-zA-Z0-9.'_-]+)*$
Ubahariya
Accept AlphaNumeric and .'_- and middle spaces
2016-08-30T19:59:50.000Z
^(([0-9A-Fa-f]{2}[:-]?){5}[0-9A-Fa-f]{2})-(([0-9A-Fa-f]{2}:?){4})$
aa:aa:aa:aa:aa:aa-55:56:57:58:
avreg
2016-08-22T11:15:17.000Z
-?\d+(\.\d+)?
2010 -1000 10.2
2
2015-10-30T17:04:17.000Z
([\d\.]+%) identity
# /data/spine/bin/external/fasta/bin/glsearch36 -b 2 -m 9i -q /tmp/temp.seq /data/spine/databases/UniProt/sprot.compact_headers.distinct.mouse GLSEARCH performs a global-query/local-library search version 36.3.6 Nov, 2013(preload9) Query: /tmp/temp.seq 1>>>seq - 299 aa Library: /data/spine/databases/UniProt/sprot.compact_headers.distinct.mouse 9277236 residues in 16315 sequences Statistics: Unscaled normal statistics: mu= -50.7059 var=2892.0306 Ztrim: 0 statistics sampled from 13365 (13367) to 13365 sequences Algorithm: Global/Local affine Needleman-Wunsch (2007) (6.0 April 2007) Parameters: BL50 matrix (15:-5), open/ext: -12/-2 Scan time: 11.560 The best scores are: n-w bits E(16315) %_id %_sim alen SP|P61375|LHX5_MOUSE ( 402) 1361 66.3 5.7e-148 0.685 0.868 302 SP|P50481|LHX3_MOUSE ( 400) 331 30.8 1e-08 0.319 0.524 307 >>>seq, 299 aa vs /data/spine/databases/UniProt/sprot.compact_headers.distinct.mouse library >>SP|P61375|LHX5_MOUSE (402 aa) n-w opt: 1361 Z-score: 312.5 bits: 66.3 E(16315): 5.7e-148 global/local score: 1361; 68.5% identity (86.8% similar) in 302 aa overlap (1-299:107-400) 10 20 30 seq YIDENKFVCKEDYLSNSSVAKENSLHSATT :::::::::.::::.::. ::.::.:... SP|P61 VRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLSSSSL-KEGSLNSVSS 80 90 100 110 120 130 40 50 60 70 80 90 seq GSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKRRGPRTTIKAKQLETL .: ::::: ::: ::: :...... :::: ..:::..:: :.::::::::::::::::: SP|P61 CTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETL 140 150 160 170 180 190 100 110 120 130 140 150 seq KAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: SP|P61 KAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSP 200 210 220 230 240 250 160 170 180 190 200 210 seq RRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVP :::::: ::. .:.. . :...::::::.::.:::::::: .:::: :::.:.: :. SP|P61 RRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGPPS-QAQSPADSSFLA 260 270 280 290 300 310 220 230 240 250 260 seq SSGPSGTPLGGLDHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVF-- .:::..::::.:. :: : : ... ::::...:: :.:::::.::: :: : .::: SP|P61 ASGPGSTPLGALEPPLAGPH-GADNPRFTDMISHP--DTPSPEPGLPGALHPMPGEVFSG 320 330 340 350 360 370 270 280 290 seq GPSPPFSSLSVNGGASYGNHLSHP-PEMNEAA :::::: ..: ..:.. :::: ::.:::: SP|P61 GPSPPFP---MSGTSGYSGPLSHPNPELNEAAVW 380 390 400 >>SP|P50481|LHX3_MOUSE (400 aa) n-w opt: 331 Z-score: 121.0 bits: 30.8 E(16315): 1e-08 global/local score: 331; 31.9% identity (52.4% similar) in 307 aa overlap (1-299:99-365) 10 20 seq YIDENKFVCK-EDYLSN-SSVAKENSLHSA : .. : . .:.. . : .. SP|P50 AERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQL 70 80 90 100 110 120 30 40 50 60 70 80 seq TTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKRRGPRTTIKAKQLE .::.. : ::. . : :.:. . :. ::: ::::: ::::: SP|P50 ATGDEFYLMEDSRLVCK---ADYETAKQREAEAT----------AKR--PRTTITAKQLE 130 140 150 160 170 90 100 110 120 130 140 seq TLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFR :::.:. ..:::.::.::::..::::.:::.::::::::.::.:.:. .: : .:: SP|P50 TLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK-DAGRQRWGQYFR 180 190 200 210 220 230 150 160 170 180 190 200 seq SPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPF . .: : : .: .: : .. . :: . :.. . SP|P50 NMKRSRG----------------SSKSDKDSIQEGQDSDAEVSFTDEPSMADMGPANGLY 240 250 260 270 210 220 230 240 250 260 seq VPSSGPS---GTPLGGLDHPLPGHHPSSEAQRFTDILAHPP-GDSPSPEP--SLPGPLHS . :. : :.::: : . ... .. : : ::: ::::: SP|P50 SSLGEPAPALGRPVGGLGSFTLDHGGLTGPEQYRELRPGSPYGIPPSPAAPQSLPGPQPL 280 290 300 310 320 330 270 280 290 seq MSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAA .:. :. : ..::. .. :. :: : : SP|P50 LSSLVY----PDTNLSLVPSGPPGG----PPPMRVLAGNGPSSDLSTESSSGYPDFPASP 340 350 360 370 380 SP|P50 ASWLDEVDHAQF 390 400 >>>/// 299 residues in 1 query sequences 9277236 residues in 16315 library sequences Tcomplib [36.3.6 Nov, 2013(preload9)] (8 proc in memory [0G]) start: Thu Sep 3 20:44:48 2015 done: Thu Sep 3 20:44:55 2015 Total Scan time: 11.560 Total Display time: 0.010 Function used was GLSEARCH [36.3.6 Nov, 2013(preload9)]
identity
2015-09-04T17:51:16.000Z
(?<level>\d+)\s*(?<wood>\d+)\s*(?<clay>\d+)\s*(?<iron>\d+)\s*(?<crop>\d+)\s*(?<cropusage>\d+)\s*(?<time>\d+:\d+:\d+)\s*(?<pop>\d+)\s*(?<production>\d+)
1 70 90 70 20 0 00:02:30 1 7 2 115 150 115 35 0 00:07:20 1 13 3 195 250 195 55 0 00:15:00 2 21 4 325 420 325 95 0 00:27:30 2 31 5 545 700 545 155 0 00:47:10 2 46 6 910 1170 910 260 1 01:18:50 3 70 7 1520 1950 1520 435 1 02:03:40 4 98 8 2535 3260 2535 725 1 03:30:40 4 140 9 4235 5445 4235 1210 1 05:40:30 5 203 10 7070 9095 7070 2020 1 09:08:00 6 280 11 11810 15185 11810 3375 1 14:40:10 7 392 12 19725 25360 19725 5635 1 23:31:40 9 525 13 32940 42350 32940 9410 1 37:41:50 11 693 14 55005 70720 55005 15715 1 60:22:20 13 889 15 91860 118105 91860 26245 1 96:39:10 15 1120 16 153405 197240 153405 43830 2 154:41:50 18 1400 17 256190 329385 256190 73195 2 247:34:20 22 1820 18 427835 550075 427835 122240 2 396:10:10 27 2240 19 714485 918625 714485 204140 2 633:550: 32 2800 20 1193195 1534105 1193195 340915 2 1014:20:30 38 3430
b
2016-06-10T23:21:59.000Z
Match IP Address in PHP
^([0-9]{1,3}\.){3}[0-9]{1,3}$
25.255.255.255
Match IP Address in PHP
2015-11-26T13:55:51.000Z
Parse les numéros d'article, avec le préfixe éventuel de niveau Ex : D101, A.202, R*203,R. * 102-36
((?:A|LO?)(?:\.\s*)?|(?:[DR](?:\s*\.\s*)?(?:\s*\*\s*)?))((?:\d+)(?:(?:\-\d+)*))
A101 A.202 D*1-2-3 D. * 4-5-7 D * 78
Numéro d'article (avec niveau et composantes multiples)
2017-11-27T03:59:38.000Z
- 15 digits for integer - real number: 18 digits for before-dot part (*what it's called?)
^(0|-?0\.\d+|-?[1-9]\d{0,14}|-?[1-9]\d{0,18}\.\d+)$
INTEGER 15digits 0 1 -1 12 -12 123456789012345 -123456789012345 INVALID 01 -01 1234567890123456 -1234567890123456 .123456 -.123456 0. -0. 1234567890123456789012 -1234567890123456789012 12345678901234567890.1 -12345678901234567890.1 FLOAT (...) 0.1234567890123456789 -0.1234567890123456789 1.1234567890123456789 -1.1234567890123456789 12.123456789012345678 -12.123456789012345678 1234567890123456789.1 -1234567890123456789.1
regex of number
2018-05-09T02:57:51.000Z
expression pour checker les dates
^\d{1,2}(\-| ){1}\w+(\-| ){1}\d{4}$
21-05112-2001
datecheck
2023-01-03T17:08:28.000Z
React SDK V3
useFsFlag[(](?:\s*(".*"),\s*(".*\s*[^"]*"|[^)]*))\s*[)]
const backgroundColorFlag = useFsFlag("backgroundColor", "green") const btnColorFlag = useFsFlag("btnColor", red) const backgroundSize = useFsFlag("backgroundColor", 16).getValue() const backgroundSize = useFsFlag("backgroundColor", 16.5).getValue() const showBtn = useFsFlag("showBtn", true).getValue() const showBtn = useFsFlag("showBtn",true) const showBtn = useFsFlag("showBtn", "Blue, red") const showBtn = useFsFlag("showBtn", "(Blue )[@)à.""h""ere)").getValue() const showBtn = useFsFlag( "showBtn", "(Blue )he{}re)" ) //comment
REACT SDK V3
2023-02-13T10:15:08.000Z
^(?:(?!Windows Phone).)*(iPhone|iPad|iPod)
Mozilla/5.0 like (Mobile; Windows Phone 8.1; Android 4.0; ARM; Trident/7.0 Touch; rv:11.0; IEMobile/11.0; NOKIA; Lumia 925) iPhone OS 7_0_3 Mac OS X AppleWebkit/537 (KHTML, like Gecko) Mobile Safari/537
user-agent tester
2015-11-03T22:14:33.000Z
Es mi intento por detectar urls
(((http:\/\/)|(https:\/\/)){1}(www\.){0,1}[a-z0-9]+[\.]{1}[a-z]+[\/#=a-z0-9\?\.\+\&\%\_\-]+)
http://php.net/manual/es/refs.basic.text.php
Mi detector de urls
2015-07-06T14:12:16.000Z
\D+
8 %
Perl
2015-08-27T18:20:37.000Z
^\[\s*(((-?([_a-z]|(?![\u0000-\u0239]).*|((\\[0-9a-f]{1,6}(\r\n|[ \t\r\n\f])?)|\\[^\r\n\f0-9a-f]))([_a-z0-9-]|(?![\u0000-\u0239]).*|((\\[0-9a-f]{1,6}(\r\n|[ \t\r\n\f])?)|\\[^\r\n\f0-9a-f]))*)|\\*)?|)?(-?([_a-z]|(?![\u0000-\u0239]).*|((\\[0-9a-f]{1,6}(\r\n|[ \t\r\n\f])?)|\\[^\r\n\f0-9a-f]))([_a-z0-9-]|(?![\u0000-\u0239]).*|((\\[0-9a-f]{1,6}(\r\n|[ \t\r\n\f])?)|\\[^\r\n\f0-9a-f]))*)\s*((\^=|\$=|\*=|=|~=|\|=)\s*((-?([_a-z]|(?![\u0000-\u0239]).*|((\\[0-9a-f]{1,6}(\r\n|[ \t\r\n\f])?)|\\[^\r\n\f0-9a-f]))([_a-z0-9-]|(?![\u0000-\u0239]).*|((\\[0-9a-f]{1,6}(\r\n|[ \t\r\n\f])?)|\\[^\r\n\f0-9a-f]))*)|((\"([^\n\r\f\"]|\\n|\r\n|\r|\f|(?![\u0000-\u0239]).*|((\\[0-9a-f]{1,6}(\r\n|[ \t\r\n\f])?)|\\[^\r\n\f0-9a-f]))*\")|(\'([^\n\r\f\']|\\n|\r\n|\r|\f|(?![\u0000-\u0239]).*|((\\[0-9a-f]{1,6}(\r\n|[ \t\r\n\f])?)|\\[^\r\n\f0-9a-f]))*\')))\s*)?\]$
[foo] [foo=bar] [foo='bar baz'] [foo="bar baz"] [foo="bar \"baz\""] [foo="'bar' baz"] [foo='\'bar\' baz'] [foo='bar "baz"'] [foo|=bar] [foo~=bar] [foo^=bar] [foo$=bar] [foo*=bar]
Selectors.io Attribute Selector Implementation
2016-03-18T22:22:14.000Z
matches alphanumeric characters and apostrophes ex. Superman's Cape
\w+|'|\
Nadia's iPhone / / \/\\/\///\\\(alert "attack!");
simple labels
2015-10-19T00:44:10.000Z
It change type='date' to type='text' and add the class .datepicker before the opening '('
(\()(.*)(type=\'date\')(.*)
.form-group label(for='title_event') #{__("entity.event.title_event")} (*) input.form-control.input(name='title_event', type='text', placeholder='#{__("entity.event.title_event")}', autofocus, required) .form-group label(for='typeevent_event') #{__("entity.event.typeevent_event")} input.form-control.input(name='typeevent_event', type='text', placeholder='#{__("entity.event.typeevent_event")}') .row .col-xs-4 .form-group label(for='startdate_event') #{__("entity.event.startdate_event")} (*) .input-group .input-group-addon i.fa.fa-calendar input.form-control.input(name='startdate_event', type='date', placeholder='#{__("entity.event.startdate_event")}', required) .col-xs-4 .form-group label(for='enddate_event') #{__("entity.event.enddate_event")} (*) .input-group .input-group-addon i.fa.fa-calendar input.form-control.input(name='enddate_event', type='date', placeholder='#{__("entity.event.enddate_event")}', value='#{moment("entity.event.enddate_event")}', required) // .form-group // label(for='starttime_event') #{__("entity.event.starttime_event")} // input.form-control.input(name='starttime_event', type='text', placeholder='#{__("entity.event.starttime_event")}') .row .col-xs-4 .form-group label(for='starttime_event') #{__("entity.event.starttime_event")} span .bootstrap-timepicker .form-group .input-group input.form-control.timepicker(name='starttime_event', type='text') .input-group-addon i.fa.fa-clock-o .row .col-xs-4 .form-group label(for='endtime_event') #{__("entity.event.endtime_event")} // input.form-control.input(name='endtime_event', type='text', placeholder='#{__("entity.event.endtime_event")}') span .bootstrap-timepicker .form-group .input-group input.form-control.timepicker(name='endtime_event', type='text') .input-group-addon i.fa.fa-clock-o .form-group input.form-control.input(name='allday_event', type='checkbox', placeholder='#{__("entity.event.allday_event")}') &nbsp; label(for='allday_event') #{__("entity.event.allday_event")} .form-group label(for='location_event') #{__("entity.event.location_event")} input.form-control.input(name='location_event', type='text', placeholder='#{__("entity.event.location_event")}') .form-group label(for='participationmode_event') #{__("entity.event.participationmode_event")} input.form-control.input(name='participationmode_event', type='text', placeholder='#{__("entity.event.participationmode_event")}') .form-group label(for='description_event') #{__("entity.event.description_event")} input.form-control.input(name='description_event', type='text', placeholder='#{__("entity.event.description_event")}') .form-group label(for='color_event') #{__("entity.event.color_event")} // input.form-control.input(name='color_event', type='text', placeholder='#{__("entity.event.color_event")}') input.form-control.my-colorpicker1(name='color_event', type='text', placeholder='#{__("entity.event.color_event")}') .form-group label(for='owner_event') #{__("entity.event.owner_event")} input.form-control.input(name='owner_event', type='text', placeholder='#{__("entity.event.owner_event")}') // *** Dynamic Data Field Create Form Group event | Do not remove *** //- .form-group //- label(for='name_plateau') #{__("entity.plateau.name_plateau")} (*) //- input.form-control.input(name='name_plateau', type='text', placeholder='#{__("entity.plateau.name_plateau")}',required)
Jade file, change input type and add class
2016-08-26T13:25:04.000Z
Searching for instances of strct_separate_cart with discount as a member
struct_separate_cart\.cart[a-zA-Z0-9\[\.\]\_]+\.shipping\.discount
struct_separate_cart.cart[LOCAL.this_vendor].shipping.discount
strct_separate_cart discount
2016-09-20T15:32:28.000Z
For phone numbers with country code(Optional)followed by 10 digit phone number.
[\+\(]{0,2}\d{1,4}[\.\-\s\(\)]*\d{1}[\.\-\s\(\)]*\d{1}[\.\-\s\(\)]*\d{1}[\.\-\s\(\)]*\d{1}[\.\-\s\(\)]*\d{1}[\.\-\s\(\)]*\d{1}[\.\-\s\(\)]*\d{1}[\.\-\s\(\)]*\d{1}[\.\-\s\(\)]*\d{1}[\.\-\s\(\)]*\d{1}
+009 888-882-8508 +001 888 88 28508 (+91)-888-88-28508
Phone Number
2016-06-09T09:39:00.000Z
\b((?![a|b]*aab)[a|b]*)\b
aba aab abaaba abaaa cbaa abbaab
Lb4 1d
2017-12-20T15:28:11.000Z
\b(?i)([a-z]{2}\d{10})|([a-z]{3}[0-9]{1}[0-9a-z]{9})|([a-z]{2}[0-9]{1}[0-9a-z]{9})|([a-z]{3}[0-9]{1}[0-9a-z]{8})|([a-z]{2}\-\d{9}\-\d)|([a-z]{2}\-[0-9]{1}[0-9a-z]{8}\-\d)|([a-z]{3}\-[0-9]{1}[0-9a-z]{7}\-\d)
ISIN: US5949181045 Title: Microsoft Corp. Description: Equity, ISIN US5949181045, WKN 870747, MSF US-594918104-5 ISIN: US38259P5089 Title: Google Inc. Description: Equity, ISIN US38259P5089, WKN A0B7FY, GGQ1 Country: US US-38259P508-9 ISIN: US0378331005 Title: Apple Inc. Description: Equity, ISIN US0378331005, WKN 865985, APC Country: US US-037833100-5 ISIN: BMG491BT1088 Title: INVESCO LTD DL -,10 Description: Equity, ISIN BMG491BT1088, WKN A0M6U7, 3IW Country: Bermuda BMG-491BT108-8 ISIN: IE00B4BNMY34 Title: ACCENTURE PLC A DL-000025 Description: Equity, ISIN IE00B4BNMY34, WKN A0YAQA, CSA Country: Ireland IE-00B4BNMY3-4 ISIN: DE000CM7VX13 Title: Aktienanleihe Plus auf Description: Investment Product, ISIN DE000CM7VX13, WKN Country: Germany DE-000CM7VX1-3 ISIN: US30303M1027 Title: Facebook, Inc. Description: Equity Shares, ISIN US30303M1027 Country: United States US-30303M102-7 ISIN: CH0031240127 Title: BMW Australia Description: Bond, ISIN CH0031240127, WKN A0NWXQ Country: Switzerland CH-003124012-7 ISIN: CA9861913023 Title: Yorbeau Res Inc. Description: Equity, ISIN CA9861913023, WKN 872300, UAN Country: Canada CH-003124012-7
ISIN Numbers
2020-06-23T18:06:08.000Z
(?:\| #033\[0m)(.*)(?:\.xcade\.net)(?:.*)(GET |POST )(\/.*)(?: HTTP)(?:.*)
#033[0;36;1mnginx.1 | #033[0mlinkedinmiddleware-integrations.xcade.net 172.27.0.13 - fac4d3l1nked1nus3r [24/Sep/2019:14:25:04 +0000] TLSv1.2/ECDHE-RSA-AES256-GCM-SHA384 "GET /application/asiainspection HTTP/1.1" 200 103 "-" "-"
TLS Regex
2019-09-26T21:30:30.000Z
Trying to output http://www.fs.usda.gov/malheur or thereabouts
3Dcache*:().*%252B
<li class="g"><h3 class="r"><a href="http://maps.google.com/maps?um=1&amp;ie=UTF-8&amp;fb=1&amp;gl=us&amp;cid=12546501552342514458&amp;q=Malheur+National+Forest&amp;sa=X&amp;ei=tsCpU7y-HM28oQSa9IIQ&amp;ved=0CBUQtQMwAA"><div>Map for <b>Malheur National Forest</b></div></a></h3><div class="mlmcm" style="margin:16px 0"><a href="http://maps.google.com/maps?um=1&amp;ie=UTF-8&amp;fb=1&amp;gl=us&amp;cid=12546501552342514458&amp;q=Malheur+National+Forest&amp;sa=X&amp;ei=tsCpU7y-HM28oQSa9IIQ&amp;ved=0CBYQtgMwAA"><img height="233" src="/maps/vt/data=VLHX1wd2Cgu8wR6jwyh-km8JBWAkEzU4,6YhdV0BKWTh3M22uoHrEdeI_eUVZLHdlKYEtPFQ8P__WuSea3AFMDTBKDIzC2UNN2GnK4eVSnL54ZIUZDihddu9CI74my1jHESqjX7czgrXEHjDCIHFYymlYhBU" style="border:0;padding:1px" width="550"/></a></div><h3 class="r"><a href="/url?q=http://www.fs.usda.gov/malheur&amp;sa=U&amp;ei=tsCpU7y-HM28oQSa9IIQ&amp;ved=0CBgQFjAA&amp;usg=AFQjCNEd9QcHqk_lxZTz9AcslMsyLwA9XQ"><b>Malheur National Forest</b> - Home - USDA Forest Service</a></h3><div class="s"><div class="kv" style="margin-bottom:2px"><cite>www.fs.usda.gov/<b>malheur</b></cite><div class="am-dwn-arw-container">‎<div aria-expanded="false" aria-haspopup="true" data-ved="0CBkQ7B0wAA" onclick="google.sham(this);" style="display:inline" tabindex="0"><span class="am-dwn-arw"></span></div><div class="am-dropdown-menu" role="menu" style="display:none" tabindex="-1"><ul><li class="am-dropdown-menu-item"><a class="am-dropdown-menu-item-text" href="/url?q=http://webcache.googleusercontent.com/search%3Fq%3Dcache:0bqZkM4XQqIJ:http://www.fs.usda.gov/malheur%252BMalheur%2BNational%2BForest%26hl%3Den%26%26ct%3Dclnk&amp;sa=U&amp;ei=tsCpU7y-HM28oQSa9IIQ&amp;ved=0CBsQIDAA&amp;usg=AFQjCNHcxq8MhoHz9__jp8pwHUrw2RPqCQ">Cached</a></li><li class="am-dropdown-menu-item"><a class="am-dropdown-menu-item-text" href="/search?ie=UTF-8&amp;q=related:www.fs.usda.gov/malheur+Malheur+National+Forest&amp;tbo=1&amp;sa=X&amp;ei=tsCpU7y-HM28oQSa9IIQ&amp;ved=0CBwQHzAA">Similar</a></li></ul></div></div></div><span class="st">The 1.7 million acre <b>Malheur National</b> For est is located in the Blue Mountains of <br> Eastern Oregon. The diverse and beautiful scenery of the <b>forest</b> includes high ...</br></span><br><div style="margin-top:13px"><table width="100%"><tr><td style="padding-right:4px;padding-top:1px" valign="top" width="24"><img src="/mapfiles/marker-noalpha.png"/></td><td valign="top" width="485"><span style="vertical-align:top">Canyon City, OR 97820<br style="display:block"><span class="nobr">(541) 575-3000</span></br></span></td><td style="padding-top:2px;padding-left:9px" valign="top"><div style="float:right"><div class="star" style="float:none"><div style="width:0px"> </div></div></div><div style="clear:both"><a class="fl nobr" href="/url?q=https://plus.google.com/105110280666932757061/about%3Fhl%3Den%26socfid%3Dweb:lu:unknown:localdetails%26socpid%3D1&amp;sa=U&amp;ei=tsCpU7y-HM28oQSa9IIQ&amp;ved=0CCAQ4gkwAA&amp;usg=AFQjCNEo8ifBqVIqKICfCb2t4c6TZYk5mA">2 reviews</a></div></td></tr></table></div></br></div><table cellpadding="0" cellspacing="0" class="slk" style="border-collapse:collapse;margin-top:1px"><tr class="mslg"><td style="padding-left:23px;vertical-align:top"><div class="sld"><h3 class="r"><a class="sla" href="/url?q=http://www.fs.usda.gov/contactus/malheur/about-forest/contactus&amp;sa=U&amp;ei=tsCpU7y-HM28oQSa9IIQ&amp;ved=0CCMQjBAwAQ&amp;usg=AFQjCNGjoBzfmSfSTCOzBNxBnOhKa28FUQ">Contact Us</a></h3><div class="s st" style="width:220px;overflow:hidden">More information is available on individual Ranger District Office ...</div></div></td><td style="padding-left:7px;vertical-align:top"><div class="sld"><h3 class="r"><a class="sla" href="/url?q=http://www.fs.usda.gov/recmain/malheur/recreation&amp;sa=U&amp;ei=tsCpU7y-HM28oQSa9IIQ&amp;ved=0CCUQjBAwAw&amp;usg=AFQjCNEmTooI03G5kMNTyIVqgU8Cu822dg">Recreation</a></h3><div class="s st" style="width:220px;overflow:hidden">The 1.7 million acre Malheur National Forest located in the ...</div></div></td></tr><tr class="mslg"><td style="padding-left:23px;vertical-align:top"><div class="sld"><h3 class="r"><a class="sla" href="/url?q=http://www.fs.usda.gov/main/malheur/maps-pubs&amp;sa=U&amp;ei=tsCpU7y-HM28oQSa9IIQ&amp;ved=0CCcQjBAwAg&amp;usg=AFQjCNFuRB8FTFH1goZ5XStBRakys6JoIQ">Maps &amp; Publications</a></h3><div class="s st" style="width:220px;overflow:hidden">Forest Service Topography Maps: These maps overlay Forest ...</div></div></td><td style="padding-left:7px;vertical-align:top"><div class="sld"><h3 class="r"><a class="sla" href="/url?q=http://www.fs.usda.gov/main/malheur/about-forest&amp;sa=U&amp;ei=tsCpU7y-HM28oQSa9IIQ&amp;ved=0CCkQjBAwBA&amp;usg=AFQjCNHSrG5pziXkX2tf50PdNo7qWMeT1A">About the Forest</a></h3><div class="s st" style="width:220px;overflow:hidden">The Malheur National Forest in the Blue Mountains of Eastern ...</div></div></td></tr><tr><td colspan="2" style="padding-left:28px;vertical-align:top"><div style="padding-top:5px"><a class="fl" href="/search?ie=UTF-8&amp;q=+site:usda.gov+Malheur+National+Forest&amp;sa=X&amp;ei=tsCpU7y-HM28oQSa9IIQ&amp;ved=0CCoQrAM">More results from usda.gov »</a></div></td></tr></table></li>
google result li item
2014-06-24T18:19:53.000Z
Grade Point Average (GPA)
^[0-3](\.[0-9]{1,2})?$|^4(\.[0]{1,2})?$
GPA
2017-09-18T23:02:27.000Z
(\{(?:[^}{]+|\{(?:[^}{]+|\{[^}{]*\})*\})*\})
h2.entry-title{font:18px/24px "Roboto",Helvetica,Arial,Verdana,sans-serif;margin-bottom:4px}.h3-size.entry-title{padding-right:10px;text-align:justify}.h3-size{font:normal 20px / 24px "Roboto",Helvetica,Arial,Verdana,sans-serif!important}.top-bar{padding:0}@media screen and (min-width:1051px){body.overlap .page-title .wf-wrap{padding-top:70px!important;padding-bottom:70px!important}} @media screen and (min-width:641px) and (max-width:1050px){body.overlap .page-title .wf-wrap{padding-top:42px!important;padding-bottom:42px!important}body.page-title .wf-td .breadcrumbs{margin-top:2px}} @media screen and (min-width:0) and (max-width:640px){body.overlap .page-title .wf-wrap{padding-top:0!important;padding-bottom:4px!important}.h3-size{font:normal 17px / 21px "Roboto",Helvetica,Arial,Verdana,sans-serif!important}body.breadcrumbs.breadcrumbs-bg{margin-top:0!important}.page-title .breadcrumbs,.page-title .breadcrumbs a{font-size:11px!important}} .wf-td .text-normal{font-size:12px}.breadcrumbs.bg-light{padding:3px 8px!important}.blog-content.wf-td p{margin-bottom:8px}.blog-content.wf-td .entry-meta{padding:0 0 4px}.blog.layout-list .post .alignleft{margin-bottom:5px}.blog.layout-list .post{padding-top:5px}.post .entry-title a:hover{filter:saturate(4)}.page-title .wf-container-title{padding-top:0!important;padding-bottom:0!important}.vc_tta-title-text{font:13px/16px "Roboto",Helvetica,Arial,Verdana,sans-serif;font-weight:500}#text-2 .widget-title{font:13px/18px "Roboto",Helvetica,Arial,Verdana,sans-serif}#text-2 .textwidget{line-height:14px}#footer .wf-container-footer{padding-top:15px}#page .project-share-overlay .share-button.entry-share{font:18px/20px "Roboto",Helvetica,Arial,Verdana,sans-serif;color:#4a66d6;filter:contrast(200%);filter:saturate(4)}.shortcode-action-box{padding:20px 25px 10px 30px!important;color:#4a66d6;filter:contrast(200%);filter:saturate(4)}.content .soc-ico a .icon{fill:#0537ff}#footer .wf-container-footer{opacity:.5}.widget_search form{margin:0 0 0 0!important}@media screen and (min-width:821px){.sidebar-content .widget-title{margin-bottom:5px!important}.cat-item{margin:0!important;padding:5px 0 0!important}.widget_emd4ebookandmagazinesdownloadwidget ul.mccw-col-first,.emd4ebookandmagazinesdownloadwidget .mccw-col,.sidebar-content .mccw-col{padding-right:14px!important}.mccw-col,.widget_emd4ebookandmagazinesdownloadwidget ul.mccw-col-first,.widget_emd4ebookandmagazinesdownloadwidget ul.mccw-col-last,.emd4ebookandmagazinesdownloadwidget .mccw-col,.sidebar-content .mccw-col{width:-moz-calc(50% - 14px)!important;width:-o-calc(50% - 14px)!important;width:-webkit-calc(50% - 14px)!important;width:calc(50% - 14px)!important}} @media screen and (min-width:360px) and (max-width:820px){.sidebar-content .widget-title{margin-bottom:20px!important}.cat-item{padding:7px 0 7px 0!important}.widget_emd4ebookandmagazinesdownloadwidget ul.mccw-col-first,.emd4ebookandmagazinesdownloadwidget .mccw-col,.sidebar-content .mccw-col{padding-right:14px!important}.mccw-col,.widget_emd4ebookandmagazinesdownloadwidget ul.mccw-col-first,.widget_emd4ebookandmagazinesdownloadwidget ul.mccw-col-last,.emd4ebookandmagazinesdownloadwidget .mccw-col,.sidebar-content .mccw-col{width:-moz-calc(50% - 14px)!important;width:-o-calc(50% - 14px)!important;width:-webkit-calc(50% - 14px)!important;width:calc(50% - 14px)!important}} @media screen and (max-width:359px){.sidebar-content .widget-title{margin-bottom:20px!important}.cat-item{padding:7px 0 7px 0!important}.widget_emd4ebookandmagazinesdownloadwidget ul.mccw-col-first{padding-right:0!important;width:100%;padding-bottom:10px}} .style-3 .yuzo-list:before,.style-3 .yuzo-list::before{content:'';background:none!important;position:absolute;left:0;top:7px;width:22px;height:22px;opacity:.2}.style-3 .yuzo-list a{line-height:16px!important}.yuzo-list{border-bottom:0 solid #f4f4f4!important}.style-3 .yuzo-list a:hover{filter:saturate(4);color:#4a66d6;text-decoration:none}.yuzo_related_post_widget{margin:0}.yuzo_widget_wrap .yuzo_views_post{padding:0 2px}.style-3 .yuzo-list a{padding-left:0!important}.yuzo_related_post_widget .yuzo-list .link-list .yuzo_views_post{display:inline-block!important}.yuzo-list .link-list .yuzo_views_post,.yuzo-list .link-list .yuzo_views_post,.yuzo_icon_views,.yuzo_icon_views{background:none!important}.project-share-overlay.allways-visible-icons,.entry-tags,.shortcode-action-box{box-shadow:0 0 8px -2px #333;border-radius:3px;background:#fff;padding:10px;margin-bottom:20px;background:-moz-linear-gradient(top,#fff 1%,#fff 27%,#e8e8e8 100%);background:-webkit-gradient(linear,left top,left bottom,color-stop(1%,#fff),color-stop(27%,#fff),color-stop(100%,#e8e8e8));background:-webkit-linear-gradient(top,#fff 1%,#fff 27%,#e8e8e8 100%);background:-o-linear-gradient(top,#fff 1%,#fff 27%,#e8e8e8 100%);background:-ms-linear-gradient(top,#fff 1%,#fff 27%,#e8e8e8 100%);background:linear-gradient(to bottom,#fff 1%,#fff 27%,#e8e8e8 100%);filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#ffffff',endColorstr='#e8e8e8',GradientType=0);height:auto!important;float:left;width:98%;margin-left:1%;box-sizing:border-box;-moz-box-sizing:border-box;-webkit-box-sizing:border-box;-o-box-sizing:border-box;-ms-box-sizing:border-box}.yuzo-list .image-list::before{content:"emd4 club";width:100%;color:#fff!important;z-index:1;bottom:2px;margin-left:2px;font-size:4px!important;text-align:left;box-sizing:border-box;-moz-box-sizing:border-box;position:absolute}.yuzo_wraps{box-shadow:0 0 8px -2px #333;border-radius:3px;background:#fff;padding:10px;background:-moz-linear-gradient(top,#fff 1%,#fff 27%,#e8e8e8 100%);background:-webkit-gradient(linear,left top,left bottom,color-stop(1%,#fff),color-stop(27%,#fff),color-stop(100%,#e8e8e8));background:-webkit-linear-gradient(top,#fff 1%,#fff 27%,#e8e8e8 100%);background:-o-linear-gradient(top,#fff 1%,#fff 27%,#e8e8e8 100%);background:-ms-linear-gradient(top,#fff 1%,#fff 27%,#e8e8e8 100%);background:linear-gradient(to bottom,#fff 1%,#fff 27%,#e8e8e8 100%);filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#ffffff',endColorstr='#e8e8e8',GradientType=0);height:auto!important;float:left;width:98%;margin-left:1%;box-sizing:border-box;-moz-box-sizing:border-box;-webkit-box-sizing:border-box;-o-box-sizing:border-box;-ms-box-sizing:border-box}a.yuzo__text--title,.yuzo__text--title,.yuzo-list a.yuzo__text--title{font-weight:normal;color:#4a66d6!important;font-size:13px;filter:saturate(4)}.yuzo__title ::before{content:url(data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABgAAAAYCAMAAADXqc3KAAAAA3NCSVQICAjb4U/gAAAACXBIWXMAAAphAAAKYQH8zEolAAAAGXRFWHRTb2Z0d2FyZQB3d3cuaW5rc2NhcGUub3Jnm+48GgAAAEtQTFRF////AAAAAAAAAAAAAAAAAAAAAAAEAAADAAADAAACAAACAgACAgACAgACAgACAQABAQADAQADAQADAQACAQACAQACAQACAQACAQACjwA2xwAAABh0Uk5TAAIEIDA/QFFkeX2Ago2dvcDBwtDZ4OT+yEuE8AAAAHNJREFUKFOtkVkOgCAMREfFFRdc4f4ntWjUSG2Mie+PvswQKPAZ84QXbmbj2W1CsxItC99GIrtDgvDC3bmEmNjPCuq5ysCEVYcQE39XJRCqNIR3nAlbs0+saG4x9lEoUhITCreEixpINEDeshWarozZBa+sC18XgoSOCdYAAAAASUVORK5CYII71a91eb3cbaabc2cd8b11cc616e0253d);width:32px;height:32px;display:inline-block;position:relative;top:6px;opacity:.6}.yuzo__title h3,.yuzo__title{display:inline-block}.yuzo_related_post .relatedthumb .yuzo-img-wrap{margin-bottom:0}.yuzo_related_post .yuzo_clearfixed{margin-left:30px}.yuzo_text{filter:saturate(4)!important;font-size:12px!important}.yuzo-list .image-list{box-shadow:0 0 4px 0 rgba(133,164,191,0.75);margin:4px 15px 4px 7px}.yuzo_related_post .relatedthumb .yuzo-img-wrap{width:34px!important;height:48px!important}.yuzo-img{width:32px!important;height:46px!important;border-style:solid!important;border-width:1px!important;border-radius:1px!important;border-color:#308adf!important}.yuzo-list .image-list::before{content:'test text';font-size:28px;text-align:left;width:50%;color:#F00;z-index:1;position:absolute}.yuzo-list .image-list::after{content:url();position:absolute;width:33px;height:21%;bottom:7px;left:9px;background-image:-ms-linear-gradient(top,rgba(255,255,255,0) 0,rgba(48,138,223,1) 41%);background-image:-moz-linear-gradient(top,rgba(255,255,255,0) 0,rgba(48,138,223,1) 41%);background-image:-o-linear-gradient(top,rgba(255,255,255,0) 0,rgba(48,138,223,1) 41%);background-image:-webkit-gradient(linear,left top,left bottom,color-stop(0,rgba(255,255,255,0)),color-stop(41,rgba(48,138,223,1)));background-image:-webkit-linear-gradient(top,rgba(255,255,255,0) 0,rgba(48,138,223,1) 41%);background-image:linear-gradient(to bottom,rgba(255,255,255,0) 0,rgba(48,138,223,1) 41%)}.yuzo_icon_views{float:right;margin-right:7px!important}.entry-meta .post-yuzo-views{float:right;margin-right:7px!important}.entry-meta .post-yuzo-views::after{content:""!important}.vc_single_image-img .img{width:100%;vertical-align:top}article.post:nth-child(n+1)>div:nth-child(1)>a:nth-child(2)>img:nth-child(1),.wp-caption .zoomInUp{margin:-2px}article.post:nth-child(n+1)>div:nth-child(1)>a:nth-child(2)::after,.alignnone:after,.wpb_single_image::after,.mfp-figure>figure:nth-child(2)::after,.fl-post-feed-image::after,div.fl-post-feed-post:nth-child(1)>div:nth-child(8)>a:nth-child(1)>img:nth-child(1)::after{content:"\a";position:absolute;width:100%;height:100%;bottom:0;left:0;background:-moz-linear-gradient(270deg,rgba(48,138,223,1) 0,rgba(48,138,223,1) 6%,rgba(255,255,255,0) 11%,rgba(255,255,255,0) 81%,rgba(48,138,223,1) 88%,rgba(48,138,223,1) 100%);background:-webkit-gradient(linear,left top,left bottom,color-stop(0%,rgba(48,138,223,1)),color-stop(6%,rgba(48,138,223,1)),color-stop(11%,rgba(255,255,255,0)),color-stop(81%,rgba(255,255,255,0)),color-stop(88%,rgba(48,138,223,1)),color-stop(100%,rgba(48,138,223,1)));background:-webkit-linear-gradient(270deg,rgba(48,138,223,1) 0,rgba(48,138,223,1) 6%,rgba(255,255,255,0) 11%,rgba(255,255,255,0) 81%,rgba(48,138,223,1) 88%,rgba(48,138,223,1) 100%);background:-o-linear-gradient(270deg,rgba(48,138,223,1) 0,rgba(48,138,223,1) 6%,rgba(255,255,255,0) 11%,rgba(255,255,255,0) 81%,rgba(48,138,223,1) 88%,rgba(48,138,223,1) 100%);background:-ms-linear-gradient(270deg,rgba(48,138,223,1) 0,rgba(48,138,223,1) 6%,rgba(255,255,255,0) 11%,rgba(255,255,255,0) 81%,rgba(48,138,223,1) 88%,rgba(48,138,223,1) 100%);background:linear-gradient(180deg,rgba(48,138,223,1) 0,rgba(48,138,223,1) 6%,rgba(255,255,255,0) 11%,rgba(255,255,255,0) 81%,rgba(48,138,223,1) 88%,rgba(48,138,223,1) 100%);filter:progid:DXImageTransform.Microsoft.gradient(startColorstr='#308adf',endColorstr='#308adf',GradientType=0);color:#FFF;font-size:10px;text-align:center}article.post:nth-child(n+1)>div:nth-child(1)>a:nth-child(2):before,.fl-post-feed-image::before,div.fl-post-feed-post:nth-child(1)>div:nth-child(1)>a:nth-child(1)>img:nth-child(1)::before,.wp-post-image::before{content:"emd4 club";width:100%;color:#fff!important;z-index:1;bottom:7px;font-size:9px!important;text-align:center;box-sizing:border-box;-moz-box-sizing:border-box;position:absolute}.small-fancy-datas .fancy-date a,.small-fancy-datas .fullwidth-img .fancy-date a{top:0;left:0}.alignnone:before,.mfp-figure>figure:nth-child(2):before{content:"emd4 club";width:100%;color:#fff!important;z-index:1;bottom:16px;font-size:16px!important;text-align:center;box-sizing:border-box;-moz-box-sizing:border-box;position:absolute}.wp-caption-text{margin-bottom:0}.no-share-buttons img.mfp-img{padding:0;border-style:solid!important;border-width:2px!important;border-radius:2px!important;border-color:#308adf!important}.mfp-content .mfp-close{margin:-40px 0 0 0}.blog.layout-list .post{padding-top:11px}.widget-title{clear:both!important}.post .rollover,.post .rollover-video,.post img,img[class*=align],img[class*=wp-image-],img[class*=attachment-]{max-width:400px!important;height:auto!important}.alignnone{float:none!important;margin:0 0!important}.blog.layout-list .post .alignleft,.blog.layout-list .post .alignnone{margin-bottom:11px!important}.layout-list .post{padding-top:11px!important;margin-top:1px!important}.articles-list .post:last-child{margin-bottom:-11px!important}.blog.layout-list .post{padding-top:11px!important}.footer .widget{margin-bottom:3px!important}#main-nav,.main-nav{display:none!important}#dl-menu.wf-mobile-visible,.mobile-navigation{display:none!important}.rollover i,.post-rollover i,.rollover-video i,.zoomInUp,.alignnone{background-color:rgba(252,15,15,0.4)!important;background:rgba(252,15,15,0.4)!important;background:-webkit-linear-gradient(30deg,rgba(252,15,15,0.4) 0,rgba(17,144,201,0.4) 100%)!important;background:linear-gradient(30deg,rgba(252,15,15,0.4) 0,rgba(17,144,201,0.4) 100%)!important}#bottom-bar{background:#232629 none repeat scroll center top}h2.vc_custom_heading{color:#4a66d6;filter:saturate(4)}h4.vc_custom_heading{color:black;filter:saturate(4)}.vc_row:not(.vc_gitem_row):not(.vc_grid) .vc_col-sm-3{padding-left:2px;padding-right:2px}.ult_pricing_table h3{font-weight:800!important}.filter-style-material.bold-icons .filter .sort-by-date{background-image:url("data:image/svg+xml,%3Csvg%20version='1.1'%20xmlns='http://www.w3.org/2000/svg'%20xmlns:xlink='http://www.w3.org/1999/xlink'%20x='0px'%20y='0px'%20width='16px'%20height='16px'%20viewBox='0%200%2016%2016'%20enable-background='new%200%200%2016%2016'%20xml:space='preserve'%3E%3Cpath%20fill='%23333333'%20d='M10.747,3.146l-0.048-1.713c0-0.426,0.327-0.624,0.754-0.624c0.426,0,0.792,0.198,0.792,0.624v1.72c0,0.427-0.335,0.656-0.761,0.656C11.058,3.81,10.747,3.573,10.747,3.146z%20M4.531,3.825c0.427,0,0.81-0.115,0.81-0.542V1.367c0-0.426-0.398-0.557-0.825-0.557c-0.426,0-0.721,0.131-0.721,0.557l0.002,1.865C3.797,3.658,4.105,3.825,4.531,3.825z%20M14.991,14.79H1.009V2.042h1.853v0.788c0,0.94,0.311,1.995,1.639,1.98c1.422-0.016,1.771-1.041,1.771-1.98V2.042h3.496v0.792c0,0.939,0.436,1.96,1.732,1.977c1.25,0.016,1.681-1.038,1.681-1.977V2.042h1.811V14.79z%20M5.892,9.716H3.708v2.188h2.185V9.716z%20M5.892,6.717H3.708v2.186h2.185V6.717z%20M9.109,9.716H6.921v2.188h2.188V9.716z%20M9.109,6.717H6.921v2.186h2.188V6.717z%20M12.294,9.716h-2.188v2.188h2.188V9.716z%20M12.294,6.717h-2.188v2.186h2.188V6.717z'/%3E%3C/svg%3E")!important}.filter-style-material.bold-icons .filter .sort-by-name{background-image:url("data:image/svg+xml,%3Csvg%20version='1.1'%20xmlns='http://www.w3.org/2000/svg'%20xmlns:xlink='http://www.w3.org/1999/xlink'%20x='0px'%20y='0px'%20width='16px'%20height='16px'%20viewBox='0%200%2016%2016'%20enable-background='new%200%200%2016%2016'%20fill='%23333333'%20xml:space='preserve'%3E%3Cpath%20d='M2.719,8.955h3L6.25,11H8.5l-3-8.984H3L0,11h2.203L2.719,8.955z%20M4.219,4L5.14,7.122L3.298,7.112L4.219,4z'/%3E%3Cpolygon%20points='14.973,9.219%2011.688,9.266%2014.973,5.531%2014.952,4.039%209.196,4.039%209.214,5.486%209.203,5.828%2012.359,5.833%209.062,9.547%209.062,11%2014.973,11%20'/%3E%3Crect%20y='14'%20width='15.703'%20height='2'/%3E%3Crect%20x='-2.734'%20y='6.535'%20width='0.031'%20height='0.074'/%3E%3C/svg%3E")!important}.filter-style-material.bold-icons .filter .sort-by-desc{background-image:url("data:image/svg+xml,%3Csvg%20version='1.1'%20xmlns='http://www.w3.org/2000/svg'%20xmlns:xlink='http://www.w3.org/1999/xlink'%20x='0px'%20y='0px'%20width='16px'%20height='16px'%20viewBox='0%200%2016%2016'%20enable-background='new%200%200%2016%2016'%20fill='%23333333'%20xml:space='preserve'%3E%3Crect%20x='8'%20y='3'%20width='8'%20height='2'/%3E%3Crect%20x='8'%20y='7'%20width='7'%20height='2'/%3E%3Crect%20x='8'%20y='11'%20width='6'%20height='2'/%3E%3Cpolygon%20points='4,1%202,1%202,11%200,11%203,14.875%206,11%204,11%20'/%3E%3C/svg%3E")!important}.filter-style-material.bold-icons .filter .sort-by-asc{background-image:url("data:image/svg+xml,%3Csvg%20version='1.1'%20xmlns='http://www.w3.org/2000/svg'%20xmlns:xlink='http://www.w3.org/1999/xlink'%20x='0px'%20y='0px'%20width='16px'%20height='16px'%20viewBox='0%200%2016%2016'%20enable-background='new%200%200%2016%2016'%20fill='%23333333'%20xml:space='preserve'%3E%3Crect%20x='8'%20y='3'%20width='8'%20height='2'/%3E%3Crect%20x='8'%20y='7'%20width='7'%20height='2'/%3E%3Crect%20x='8'%20y='11'%20width='6'%20height='2'/%3E%3Cpolygon%20points='4,14.875%202,14.875%202,4.875%200,4.875%203,1%206,4.875%204,4.875%20'/%3E%3C/svg%3E")!important}.filter-extras a::after,.filter-switch-toggle::after{position:absolute;top:50%;left:50%;margin:-20px 0 0 -20px;width:40px;height:40px;border-radius:50%;content:"";opacity:0;pointer-events:none;background:#F00 none repeat scroll 0 0}.accent-gradient #page .post .blog-content .entry-title a:hover{background:inherit!important;-webkit-background-clip:inherit;-webkit-text-fill-color:inherit!important}.Zebra_Tooltip .Zebra_Tooltip_Message{font-size:11px;margin-top:20px}.vc_cta3-container::after,.vc_cta3-container::before{display:table;content:' '}.vc_cta3-container{margin-bottom:35px;margin-left:auto;margin-right:auto}.vc_general.vc_cta3 h2,.vc_general.vc_cta3 h4{margin-top:0;margin-left:0;margin-right:0}.vc_general.vc_cta3.vc_cta3-color-classic.vc_cta3-style-outline{border-color:#f0f0f0!important;background-color:transparent}.vc_general.vc_cta3.vc_cta3-shape-square{border-radius:0}.vc_general.vc_cta3.vc_cta3-style-outline{border-width:3px}.vc_general.vc_cta3{border:1px solid transparent;font-size:1em;padding:28px;word-wrap:break-word}.vc_general.vc_cta3.vc_cta3-actions-bottom .vc_cta3-content{margin-bottom:1em}.vc_general.vc_cta3.vc_cta3-align-justify .vc_cta3-content{text-align:justify}.vc_general.vc_cta3 .vc_cta3-content{vertical-align:top}.vc_general.vc_cta3.vc_cta3-color-classic.vc_cta3-style-outline .vc_cta3-content-header{color:#f0f0f0}.vc_general.vc_cta3 .vc_cta3-content>:last-child,.vc_general.vc_cta3 .vc_cta3-icons>:last-child{margin-bottom:0}.vc_general.vc_cta3 .vc_cta3-actions{vertical-align:middle!important}.vc_general.vc_cta3 .vc_cta3-actions .vc_btn3-container{margin:0!important}.vc_general.vc_btn3-container.vc_btn3-inline{display:inline-block!important;vertical-align:top!important}.vc_general.vc_btn3-container{display:block!important;margin-bottom:21.74px!important;max-width:100%!important}.vc_btn3-container.vc_btn3-inline{display:inline-block!important;vertical-align:top!important}.vc_btn3-container{display:block!important;margin-bottom:22px!important;max-width:100%!important}.vc_general.vc_btn3.vc_btn3-size-md.vc_btn3-style-outline,.vc_general.vc_btn3.vc_btn3-size-md.vc_btn3-style-outline-custom{padding:13px 19px!important}.vc_general.vc_btn3.vc_btn3-style-outline,.vc_general.vc_btn3.vc_btn3-style-outline-custom{padding:13px 19px!important}.vc_general.vc_btn3.vc_btn3-size-md{font-size:14px!important;padding:14px 20px!important}.vc_general.vc_btn3.vc_btn3-shape-rounded{border-radius:5px!important}.vc_general.vc_btn3.vc_btn3-style-outline,.vc_general.vc_btn3.vc_btn3-style-outline-custom,.vc_general.vc_btn3.vc_btn3-style-outline-custom:focus,.vc_general.vc_btn3.vc_btn3-style-outline-custom:hover,.vc_general.vc_btn3.vc_btn3-style-outline:focus,.vc_general.vc_btn3.vc_btn3-style-outline:hover{border-width:2px}.vc_general.vc_btn3.vc_btn3-icon-left{text-align:left}.vc_general.vc_btn3.vc_btn3-icon-left,.vc_btn3.vc_btn3-icon-right{position:relative}.vc_general.vc_btn3{display:inline-block;margin-bottom:0;text-align:center;vertical-align:middle;cursor:pointer;background-image:none;background-color:transparent;color:#5472d2;border:1px solid transparent;box-sizing:border-box;word-wrap:break-word;-webkit-user-select:none;-moz-user-select:none;-ms-user-select:none;user-select:none;position:relative;top:0;-webkit-transition:all .2s ease-in-out;transition:all .2s ease-in-out;line-height:normal;font-size:14px;padding:14px 20px}.vc_general.vc_btn3,.wpb_button:hover,a.wpb_button_a,a.wpb_button_a:hover{text-decoration:none}.wf-container-main .error{color:#ff0036;filter:saturate(4);width:500px;margin-top:20px;float:left;padding:2px 5px;font-weight:700}.wf-container-main .setupform{margin-left:20px}.wf-container-main .registercolumn{width:330px;margin-top:10px;padding-bottom:0}.wf-container-main .registercolumn #user_name,.wf-container-main .registercolumn #user_email,.wf-container-main .registercolumn #pass1{float:right;margin-bottom:25px;margin-top:-5px}.wf-container-main .registercolumn #pass2{float:right;margin-bottom:25px;margin-top:-5px}.wf-container-main .registercolumn .hint{float:right;margin-bottom:25px;margin-top:-25px;text-align:right}.wf-container-main .registercolumn,.registercolumnclear{clear:both}.wf-container-main .submit{float:right}.sidebar .tml-user-login-wrap>label:nth-child(1),.sidebar .tml-user-pass-wrap>label:nth-child(1){display:none}.sidebar .tml-user-login-wrap{margin-bottom:0}.sidebar .tml-user-pass-wrap{margin-bottom:20px}.sidebar #user_login1{margin-top:0}.vc_column_container{padding-left:0!important;padding-right:0!important}@media(min-width:768px){.vc_col-sm-1,.vc_col-sm-10,.vc_col-sm-11,.vc_col-sm-12,.vc_col-sm-2,.vc_col-sm-3,.vc_col-sm-4,.vc_col-sm-5,.vc_col-sm-6,.vc_col-sm-7,.vc_col-sm-8,.vc_col-sm-9{float:left}.vc_col-sm-12{width:100%!important}.vc_col-sm-11{width:91.66666667%}.vc_col-sm-10{width:83.33333333%}.vc_col-sm-9{width:75%}.vc_col-sm-8{width:66.66666667%}.vc_col-sm-7{width:58.33333333%}.vc_col-sm-6{width:50%}.vc_col-sm-5{width:41.66666667%}.vc_col-sm-4{width:33.33333333%}.vc_col-sm-3{width:25%}.vc_col-sm-2{width:16.66666667%}.vc_col-sm-1{width:8.33333333%}.vc_col-sm-pull-12{right:100%}.vc_col-sm-pull-11{right:91.66666667%}.vc_col-sm-pull-10{right:83.33333333%}.vc_col-sm-pull-9{right:75%}.vc_col-sm-pull-8{right:66.66666667%}.vc_col-sm-pull-7{right:58.33333333%}.vc_col-sm-pull-6{right:50%}.vc_col-sm-pull-5{right:41.66666667%}.vc_col-sm-pull-4{right:33.33333333%}.vc_col-sm-pull-3{right:25%}.vc_col-sm-pull-2{right:16.66666667%}.vc_col-sm-pull-1{right:8.33333333%}.vc_col-sm-pull-0{right:auto}.vc_col-sm-push-12{left:100%}.vc_col-sm-push-11{left:91.66666667%}.vc_col-sm-push-10{left:83.33333333%}.vc_col-sm-push-9{left:75%}.vc_col-sm-push-8{left:66.66666667%}.vc_col-sm-push-7{left:58.33333333%}.vc_col-sm-push-6{left:50%}.vc_col-sm-push-5{left:41.66666667%}.vc_col-sm-push-4{left:33.33333333%}.vc_col-sm-push-3{left:25%}.vc_col-sm-push-2{left:16.66666667%}.vc_col-sm-push-1{left:8.33333333%}.vc_col-sm-push-0{left:auto}.vc_col-sm-offset-12{margin-left:100%}.vc_col-sm-offset-11{margin-left:91.66666667%}.vc_col-sm-offset-10{margin-left:83.33333333%}.vc_col-sm-offset-9{margin-left:75%}.vc_col-sm-offset-8{margin-left:66.66666667%}.vc_col-sm-offset-7{margin-left:58.33333333%}.vc_col-sm-offset-6{margin-left:50%}.vc_col-sm-offset-5{margin-left:41.66666667%}.vc_col-sm-offset-4{margin-left:33.33333333%}.vc_col-sm-offset-3{margin-left:25%}.vc_col-sm-offset-2{margin-left:16.66666667%}.vc_col-sm-offset-1{margin-left:8.33333333%}.vc_col-sm-offset-0{margin-left:0}} @media(min-width:992px){.vc_col-md-1,.vc_col-md-10,.vc_col-md-11,.vc_col-md-12,.vc_col-md-2,.vc_col-md-3,.vc_col-md-4,.vc_col-md-5,.vc_col-md-6,.vc_col-md-7,.vc_col-md-8,.vc_col-md-9{float:left}.vc_col-md-12{width:100%}.vc_col-md-11{width:91.66666667%}.vc_col-md-10{width:83.33333333%}.vc_col-md-9{width:75%}.vc_col-md-8{width:66.66666667%}.vc_col-md-7{width:58.33333333%}.vc_col-md-6{width:50%}.vc_col-md-5{width:41.66666667%}.vc_col-md-4{width:33.33333333%}.vc_col-md-3{width:25%}.vc_col-md-2{width:16.66666667%}.vc_col-md-1{width:8.33333333%}.vc_col-md-pull-12{right:100%}.vc_col-md-pull-11{right:91.66666667%}.vc_col-md-pull-10{right:83.33333333%}.vc_col-md-pull-9{right:75%}.vc_col-md-pull-8{right:66.66666667%}.vc_col-md-pull-7{right:58.33333333%}.vc_col-md-pull-6{right:50%}.vc_col-md-pull-5{right:41.66666667%}.vc_col-md-pull-4{right:33.33333333%}.vc_col-md-pull-3{right:25%}.vc_col-md-pull-2{right:16.66666667%}.vc_col-md-pull-1{right:8.33333333%}.vc_col-md-pull-0{right:auto}.vc_col-md-push-12{left:100%}.vc_col-md-push-11{left:91.66666667%}.vc_col-md-push-10{left:83.33333333%}.vc_col-md-push-9{left:75%}.vc_col-md-push-8{left:66.66666667%}.vc_col-md-push-7{left:58.33333333%}.vc_col-md-push-6{left:50%}.vc_col-md-push-5{left:41.66666667%}.vc_col-md-push-4{left:33.33333333%}.vc_col-md-push-3{left:25%}.vc_col-md-push-2{left:16.66666667%}.vc_col-md-push-1{left:8.33333333%}.vc_col-md-push-0{left:auto}.vc_col-md-offset-12{margin-left:100%}.vc_col-md-offset-11{margin-left:91.66666667%}.vc_col-md-offset-10{margin-left:83.33333333%}.vc_col-md-offset-9{margin-left:75%}.vc_col-md-offset-8{margin-left:66.66666667%}.vc_col-md-offset-7{margin-left:58.33333333%}.vc_col-md-offset-6{margin-left:50%}.vc_col-md-offset-5{margin-left:41.66666667%}.vc_col-md-offset-4{margin-left:33.33333333%}.vc_col-md-offset-3{margin-left:25%}.vc_col-md-offset-2{margin-left:16.66666667%}.vc_col-md-offset-1{margin-left:8.33333333%}.vc_col-md-offset-0{margin-left:0}} @media(min-width:1200px){.vc_hidden-lg{display:none!important}.vc_col-lg-1,.vc_col-lg-10,.vc_col-lg-11,.vc_col-lg-12,.vc_col-lg-2,.vc_col-lg-3,.vc_col-lg-4,.vc_col-lg-5,.vc_col-lg-6,.vc_col-lg-7,.vc_col-lg-8,.vc_col-lg-9{float:left}.vc_col-lg-12{width:100%}.vc_col-lg-11{width:91.66666667%}.vc_col-lg-10{width:83.33333333%}.vc_col-lg-9{width:75%}.vc_col-lg-8{width:66.66666667%}.vc_col-lg-7{width:58.33333333%}.vc_col-lg-6{width:50%}.vc_col-lg-5{width:41.66666667%}.vc_col-lg-4{width:33.33333333%}.vc_col-lg-3{width:25%}.vc_col-lg-2{width:16.66666667%}.vc_col-lg-1{width:8.33333333%}.vc_col-lg-pull-12{right:100%}.vc_col-lg-pull-11{right:91.66666667%}.vc_col-lg-pull-10{right:83.33333333%}.vc_col-lg-pull-9{right:75%}.vc_col-lg-pull-8{right:66.66666667%}.vc_col-lg-pull-7{right:58.33333333%}.vc_col-lg-pull-6{right:50%}.vc_col-lg-pull-5{right:41.66666667%}.vc_col-lg-pull-4{right:33.33333333%}.vc_col-lg-pull-3{right:25%}.vc_col-lg-pull-2{right:16.66666667%}.vc_col-lg-pull-1{right:8.33333333%}.vc_col-lg-pull-0{right:auto}.vc_col-lg-push-12{left:100%}.vc_col-lg-push-11{left:91.66666667%}.vc_col-lg-push-10{left:83.33333333%}.vc_col-lg-push-9{left:75%}.vc_col-lg-push-8{left:66.66666667%}.vc_col-lg-push-7{left:58.33333333%}.vc_col-lg-push-6{left:50%}.vc_col-lg-push-5{left:41.66666667%}.vc_col-lg-push-4{left:33.33333333%}.vc_col-lg-push-3{left:25%}.vc_col-lg-push-2{left:16.66666667%}.vc_col-lg-push-1{left:8.33333333%}.vc_col-lg-push-0{left:auto}.vc_col-lg-offset-12{margin-left:100%}.vc_col-lg-offset-11{margin-left:91.66666667%}.vc_col-lg-offset-10{margin-left:83.33333333%}.vc_col-lg-offset-9{margin-left:75%}.vc_col-lg-offset-8{margin-left:66.66666667%}.vc_col-lg-offset-7{margin-left:58.33333333%}.vc_col-lg-offset-6{margin-left:50%}.vc_col-lg-offset-5{margin-left:41.66666667%}.vc_col-lg-offset-4{margin-left:33.33333333%}.vc_col-lg-offset-3{margin-left:25%}.vc_col-lg-offset-2{margin-left:16.66666667%}.vc_col-lg-offset-1{margin-left:8.33333333%}.vc_col-lg-offset-0{margin-left:0}.vc_el-clearfix-lg{clear:both}} .vc_col-lg-1,.vc_col-lg-10,.vc_col-lg-11,.vc_col-lg-12,.vc_col-lg-2,.vc_col-lg-3,.vc_col-lg-4,.vc_col-lg-5,.vc_col-lg-6,.vc_col-lg-7,.vc_col-lg-8,.vc_col-lg-9,.vc_col-md-1,.vc_col-md-10,.vc_col-md-11,.vc_col-md-12,.vc_col-md-2,.vc_col-md-3,.vc_col-md-4,.vc_col-md-5,.vc_col-md-6,.vc_col-md-7,.vc_col-md-8,.vc_col-md-9,.vc_col-sm-1,.vc_col-sm-10,.vc_col-sm-11,.vc_col-sm-12,.vc_col-sm-2,.vc_col-sm-3,.vc_col-sm-4,.vc_col-sm-5,.vc_col-sm-6,.vc_col-sm-7,.vc_col-sm-8,.vc_col-sm-9,.vc_col-xs-1,.vc_col-xs-10,.vc_col-xs-11,.vc_col-xs-12,.vc_col-xs-2,.vc_col-xs-3,.vc_col-xs-4,.vc_col-xs-5,.vc_col-xs-6,.vc_col-xs-7,.vc_col-xs-8,.vc_col-xs-9{position:relative;min-height:1px;padding-left:15px;padding-right:15px;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box}.vc_col-xs-12,.vc_column_container{width:100%}.vc_column_container>.vc_column-inner{box-sizing:border-box;padding-left:15px;padding-right:15px;width:100%}.vc_column-inner::after,.vc_column-inner::before{content:" ";display:table}.wpb_button,.wpb_content_element,ul.wpb_thumbnails-fluid>li{margin-bottom:35px}#content .wpb_alert p:last-child,#content .wpb_text_column :last-child,#content .wpb_text_column p:last-child,.vc_message_box>p:last-child,.wpb_alert p:last-child,.wpb_text_column :last-child,.wpb_text_column p:last-child{margin-bottom:0}.layout-list .blog-media .alignleft{margin-right:20px!important}@media screen and (min-width:360px){body .layout-list .blog-media,body #content div.blog-media.wf-td{max-width:110px!important;min-width:110px!important;float:left!important}body div.blog-content.wf-td{float:right!important;width:-moz-calc(100% - 110px)!important;width:-o-calc(100% - 110px)!important;width:-webkit-calc(100% - 110px)!important;width:calc(100% - 110px)!important}} @media screen and (max-width:359px){body div.blog-media.wf-td,body .layout-list .blog-media{max-width:110px!important;min-width:88px!important}body div.blog-content.wf-td{float:!important}} #bottom-bar .mini-nav ul{line-height:22px!important}#bottom-bar .hasCustomSelect option:nth-child(n){color:#308adf!important;-webkit-text-fill-color:#308adf;height:1.5em!important;font-weight:800!important;display:flex!important;padding-top:.4em;font-size:18px}#bottom-bar .mini-nav ul>li.act>a .menu-item-text,#bottom-bar .mini-nav>ul>li>a:hover .menu-item-text,#bottom-bar .customSelect.customSelectHover{text-decoration:none!important}#bottom-bar .wf-float-left:last-of-type{margin-bottom:10px}#theme-my-login1>ul>li:nth-child(n){margin-bottom:10px}
Outher {} brackets
2016-09-21T13:05:56.000Z
^(0[1-9]|1\d|2[0-8]|29(?=-\d\d-(?!1[01345789]00|2[1235679]00)\d\d(?:[02468][048]|[13579][26]))|30(?!-02)|31(?=-0[13578]|-1[02]))-(0[1-9]|1[0-2])-([12]\d{3}) ([01]\d|2[0-3]):([0-5]\d):([0-5]\d)$
ww
111
2014-05-05T06:42:28.000Z
Parse SQLALCHEMY_DATABASE_URI
(?P<dialect>[^+:]+) (?: \+ (?P<driver>[^:]+) )? :// (?P<username>[^:@]+) (?: : (?P<password>[^@]+) )? @ (?P<host>[^:/]+) (?: : (?P<port>\S+) )? / (?P<database>.*)
dialect+driver://username:password@host:port/database
SQLALCHEMY_DATABASE_URI parser
2015-11-13T20:04:02.000Z
Any mail address
[a-z0-9.-_]+@[a-z.]+
a@gmail.com
Any mail address
2015-06-05T11:28:19.000Z
#(([0-9A-F]{6})|([0-9a-f]{6}))
#(([0-9A-F]{6})|([0-9a-f]{6}))
Hexadecimal color values are supported in all browsers. A hexadecimal color is specified with: #RRGGBB. RR (red), GG (green) and BB (blue) are hexadecimal integers between 00 and FF specifying the intensity of the color. For example, #0000FF is displayed as blue, because the blue component is set to its highest value (FF) and the others are set to 00. You can use upper case or lower case letters to specify hexadecimal values : #6A95ED or #6a95ed. 12 12 123 123 23 2 +12 12 -1 1 -2 00 00 +2 +9 -7 +3445
Code couleur en hexadécimal
2019-10-14T15:29:48.000Z
https://regex101.com/r/vbYmox/1/https:/docs.rs/regex/latest/regex/
expiration-string "(.+?)"|subject "CN=(.+?),
sys file ssl-cert Entrust_CA_L1C.crt { certificate-key-size 2048 checksum SHA1:3286:16a996325ea33c7876248c6e056c6a856fafb04b create-time 2013-10-21:10:52:26 created-by root expiration-date 1636685477 expiration-string "Nov 12 02:51:17 2021 GMT" is-bundle true issuer "CN=Entrust.net Certification Authority (2048),OU=(c) 1999 Entrust.net Limited,OU=www.entrust.net/CPS_2048 incorp. by ref. (limits liab.),O=Entrust.net" key-type rsa-public last-update-time 2013-10-21:10:52:26 mode 33188 revision 1 serial-number 1276021817 size 3286 subject "CN=Entrust Certification Authority - L1C,OU=(c) 2009 Entrust, Inc.,OU=www.entrust.net/rpa is incorporated by reference,O=Entrust, Inc.,C=US" updated-by root version 3 } sys file ssl-cert Entrust_CA_L1K.crt { certificate-key-size 2048 checksum SHA1:3505:bae28085f332158fa1f357e07cbe6d87a9c3280b create-time 2014-10-26:05:27:27 created-by root expiration-date 1727055113 expiration-string "Sep 23 01:31:53 2024 GMT" is-bundle true issuer "CN=Entrust Root Certification Authority,OU=(c) 2006 Entrust, Inc.,OU=www.entrust.net/CPS is incorporated by reference,O=Entrust, Inc.,C=US" key-type rsa-public last-update-time 2014-10-26:05:27:27 mode 33188 revision 1 serial-number 1372799044 size 3505 subject "CN=Entrust Root Certification Authority - G2,OU=(c) 2009 Entrust, Inc. - for authorized use only,OU=See www.entrust.net/legal-terms,O=Entrust, Inc.,C=US" updated-by root version 3 } sys file ssl-cert GO-DADDY-G2v2.crt { certificate-key-size 2048 checksum SHA1:3347:41d2c60c4fea01d511572f09b70e66f7fc527f7d create-time 2014-06-06:09:23:24 created-by root expiration-date 1937890800 expiration-string "May 30 07:00:00 2031 GMT" is-bundle true issuer "OU=Go Daddy Class 2 Certification Authority,O=The Go Daddy Group, Inc.,C=US" key-type rsa-public last-update-time 2014-06-06:09:23:24 mode 33188 revision 1 serial-number 1828629 size 3347 subject "CN=Go Daddy Root Certificate Authority - G2,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" updated-by root version 3 } sys file ssl-cert GeoTrustSSL_CA-G3.crt { certificate-key-size 2048 checksum SHA1:2823:959818e3dfdb7319a004e558f67840309d8ef0fd create-time 2014-05-09:04:36:11 created-by root expiration-date 1653082610 expiration-string "May 20 21:36:50 2022 GMT" is-bundle true issuer "CN=GeoTrust Global CA,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2014-05-09:04:36:11 mode 33188 revision 1 serial-number 146031 size 2823 subject "CN=GeoTrust SSL CA - G3,O=GeoTrust Inc.,C=US" subject-alternative-name <Unsupported> updated-by root version 3 } sys file ssl-cert GeoTrust_DV_SSL_CA-G4.crt { certificate-key-size 2048 checksum SHA1:2757:9e656f783a97a33e7092a4df7eafa8f69dd32f47 create-time 2015-03-06:02:07:19 created-by root expiration-date 1653085498 expiration-string "May 20 22:24:58 2022 GMT" is-bundle true issuer "CN=GeoTrust Global CA,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2015-03-06:02:07:19 mode 33188 revision 1 serial-number 146040 size 2757 subject "CN=GeoTrust DV SSL CA - G4,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" updated-by root version 3 } sys file ssl-cert GeoTrust_DV_SSL_CA.crt { certificate-key-size 2048 checksum SHA1:1440:ee6cfe4bc85d2f22225e0458d99de7a83283a639 create-time 2013-10-21:10:54:06 created-by root expiration-date 1582666351 expiration-string "Feb 25 21:32:31 2020 GMT" issuer "CN=GeoTrust Global CA,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-10-21:10:54:06 mode 33188 revision 1 serial-number 145106 size 1440 subject "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" updated-by root version 3 } sys file ssl-cert GeoTrust_SSL_CA.crt { certificate-key-size 2048 checksum SHA1:2611:3f653c6df93f321d1b94c74a414b9cc6d3ca4e68 create-time 2013-10-21:10:30:24 created-by root expiration-date 1582065566 expiration-string "Feb 18 22:39:26 2020 GMT" is-bundle true issuer "CN=GeoTrust Global CA,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-10-21:10:30:24 mode 33188 revision 1 serial-number 145104 size 2611 subject "CN=GeoTrust SSL CA,O=GeoTrust, Inc.,C=US" updated-by root version 3 } sys file ssl-cert GeoTrust_SSL_CA_G2_0.crt { certificate-key-size 2048 checksum SHA1:3981:193a032dd267054065b8215cac5ca990ab88ad24 create-time 2014-02-13:18:55:19 created-by root expiration-date 1653079240 expiration-string "May 20 20:40:40 2022 GMT" is-bundle true issuer "CN=GeoTrust Global CA,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2014-02-13:18:55:19 mode 33188 revision 1 serial-number 146019 size 3981 subject "CN=GeoTrust SSL CA - G2,O=GeoTrust Inc.,C=US" subject-alternative-name <Unsupported> updated-by root version 3 } sys file ssl-cert GeoTrust_SSL_CA_G3_256.crt { certificate-key-size 2048 checksum SHA1:2770:fe36c4efd7b4b65c1099a0cdf35bff07218b4afd create-time 2015-05-06:15:04:13 created-by root expiration-date 1653082610 expiration-string "May 20 21:36:50 2022 GMT" is-bundle true issuer "CN=GeoTrust Global CA,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2015-05-06:15:04:13 mode 33188 revision 1 serial-number 146031 size 2770 subject "CN=GeoTrust SSL CA - G3,O=GeoTrust Inc.,C=US" subject-alternative-name <Unsupported> updated-by root version 3 } sys file ssl-cert GoDaddy_Secure_CA_G2.crt { certificate-key-size 2048 checksum SHA1:1728:c62fe90d242ca64f1ffd82bfcaac1aef41bdd21d create-time 2014-05-29:10:40:03 created-by root expiration-date 1935558000 expiration-string "May 3 07:00:00 2031 GMT" issuer "CN=Go Daddy Root Certificate Authority - G2,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2014-05-29:10:40:03 mode 33188 revision 1 serial-number 7 size 1728 subject "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" updated-by root version 3 } sys file ssl-cert Go_DADDY-G2.crt { certificate-key-size 2048 checksum SHA1:3347:b2fd89fc494e5672829d016b26a88b9a58042f84 create-time 2014-06-06:09:22:08 created-by root expiration-date 1935558000 expiration-string "May 3 07:00:00 2031 GMT" is-bundle true issuer "CN=Go Daddy Root Certificate Authority - G2,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2014-06-06:09:22:08 mode 33188 revision 1 serial-number 7 size 3347 subject "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" updated-by root version 3 } sys file ssl-cert Go_Daddy_Sec_Cert_Auth_G2_CA_bundle.crt { certificate-key-size 2048 checksum SHA1:4795:1a56934ea40083dbbf676434d2d9bcaacbe73928 create-time 2015-02-01:22:16:27 created-by root expiration-date 1935558000 expiration-string "May 3 07:00:00 2031 GMT" is-bundle true issuer "CN=Go Daddy Root Certificate Authority - G2,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2015-02-01:22:16:27 mode 33188 revision 1 serial-number 7 size 4795 subject "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" updated-by root version 3 } sys file ssl-cert Go_Daddy_Secure_CA_bundle.crt { certificate-key-size 2048 checksum SHA1:4604:7101a7c8e46b89312aeef5c30663b2569f70f4d3 create-time 2013-10-21:08:43:00 created-by root expiration-date 1794794077 expiration-string "Nov 16 01:54:37 2026 GMT" is-bundle true issuer "OU=Go Daddy Class 2 Certification Authority,O=The Go Daddy Group, Inc.,C=US" key-type rsa-public last-update-time 2013-10-21:08:43:00 mode 33188 revision 1 serial-number 769 size 4604 subject "serialNumber=07969287,CN=Go Daddy Secure Certification Authority,OU=http://certificates.godaddy.com/repository,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" updated-by root version 3 } sys file ssl-cert Go_Daddy_Secure_Certificate_Authority_G2.crt { certificate-key-size 2048 checksum SHA1:3347:b2fd89fc494e5672829d016b26a88b9a58042f84 create-time 2014-06-06:11:29:54 created-by root expiration-date 1935558000 expiration-string "May 3 07:00:00 2031 GMT" is-bundle true issuer "CN=Go Daddy Root Certificate Authority - G2,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2014-06-06:11:29:54 mode 33188 revision 1 serial-number 7 size 3347 subject "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" updated-by root version 3 } sys file ssl-cert Network_Solutions_CA.crt { certificate-key-size 2048 checksum SHA1:4721:60bf717c03b1f20a010eec2e23d42c974d618f8f create-time 2014-01-07:09:36:19 created-by root expiration-date 1590835718 expiration-string "May 30 10:48:38 2020 GMT" is-bundle true issuer "CN=UTN-USERFirst-Hardware,OU=http://www.usertrust.com,O=The USERTRUST Network,L=Salt Lake City,ST=UT,C=US" key-type rsa-public last-update-time 2014-01-07:09:36:19 mode 33188 revision 1 serial-number 10:e7:76:e8:a6:5a:6e:37:7e:05:03:06:d4:3c:25:ea size 4721 subject "CN=Network Solutions Certificate Authority,O=Network Solutions L.L.C.,C=US" updated-by root version 3 } sys file ssl-cert RapidSSL_CA.crt { certificate-key-size 2048 checksum SHA1:2660:44115587287b28d88bdab4eea879f025e2b58e1c create-time 2013-10-21:10:38:15 created-by root expiration-date 1582065905 expiration-string "Feb 18 22:45:05 2020 GMT" is-bundle true issuer "CN=GeoTrust Global CA,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-10-21:10:38:15 mode 33188 revision 1 serial-number 145105 size 2660 subject "CN=RapidSSL CA,O=GeoTrust, Inc.,C=US" updated-by root version 3 } sys file ssl-cert Register.com_CA_SSL_Services_OV.crt { certificate-key-size 2048 checksum SHA1:4738:2ef59f56d18d5a27a2b46817675c6f092bdc0315 create-time 2013-10-21:10:50:54 created-by root expiration-date 1590835718 expiration-string "May 30 10:48:38 2020 GMT" is-bundle true issuer "CN=AddTrust External CA Root,OU=AddTrust External TTP Network,O=AddTrust AB,C=SE" key-type rsa-public last-update-time 2013-10-21:10:50:54 mode 33188 revision 1 serial-number 1 size 4738 subject "CN=AddTrust External CA Root,OU=AddTrust External TTP Network,O=AddTrust AB,C=SE" updated-by root version 3 } sys file ssl-cert StartCom_Class_1_DV_Server_CA.crt { certificate-key-size 2048 checksum SHA1:2138:345bcb60d1924e601348f61b69601ca91aa90eef create-time 2016-05-03:11:10:18 created-by chri6215 expiration-date 1923613205 expiration-string "Dec 16 01:00:05 2030 GMT" issuer "CN=StartCom Certification Authority,OU=Secure Digital Certificate Signing,O=StartCom Ltd.,C=IL" key-type rsa-public last-update-time 2016-05-03:11:10:18 mode 33188 revision 1 serial-number 6a:5d:c3:e5:3b:4e:4f:d0:7b:69:1e:a5:fc:ec:64:6b size 2138 subject "CN=StartCom Class 1 DV Server CA,OU=StartCom Certification Authority,O=StartCom Ltd.,C=IL" updated-by chri6215 version 3 } sys file ssl-cert THAWTE_DV_SSL_CA_G2.crt { certificate-key-size 2048 checksum SHA1:3692:5200bc95d7152fe5c68232177b6468aece19c62e create-time 2015-11-23:15:03:59 created-by robe7436 expiration-date 1717977599 expiration-string "Jun 9 23:59:59 2024 GMT" is-bundle true issuer "CN=thawte Primary Root CA,OU=(c) 2006 thawte, Inc. - For authorized use only,OU=Certification Services Division,O=thawte, Inc.,C=US" key-type rsa-public last-update-time 2015-11-23:15:03:59 mode 33188 revision 1 serial-number 2c:69:e1:2f:6a:67:0b:d9:9d:d2:0f:91:9e:f0:9e:51 size 3692 subject "CN=thawte DV SSL CA - G2,OU=Domain Validated SSL,O=thawte, Inc.,C=US" subject-alternative-name <Unsupported> updated-by robe7436 version 3 } sys file ssl-cert THAWTE_SSL_CA-G2.crt { certificate-key-size 2048 checksum SHA1:3648:12c7bf5b37e54423bf303a52b884175ee75bc42d create-time 2016-05-03:11:39:27 created-by mike4609 expiration-date 1698710399 expiration-string "Oct 30 23:59:59 2023 GMT" is-bundle true issuer "CN=thawte Primary Root CA,OU=(c) 2006 thawte, Inc. - For authorized use only,OU=Certification Services Division,O=thawte, Inc.,C=US" key-type rsa-public last-update-time 2016-05-03:11:39:27 mode 33188 revision 1 serial-number 16:87:d6:88:6d:e2:30:06:85:23:3d:bf:11:bf:65:97 size 3648 subject "CN=thawte SSL CA - G2,O=thawte, Inc.,C=US" subject-alternative-name <Unsupported> updated-by mike4609 version 3 } sys file ssl-cert baycolony-sebastianscom-12.crt { certificate-key-size 2048 checksum SHA1:1984:fb795b1065d3fcb228d5ad14b8a0a092182dcc0e create-time 2013-10-21:09:53:10 created-by root expiration-date 1337789034 expiration-string "May 23 16:03:54 2012 GMT" issuer "serialNumber=07969287,CN=Go Daddy Secure Certification Authority,OU=http://certificates.godaddy.com/repository,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2013-10-21:09:53:10 mode 33188 revision 1 serial-number 03:fb:cd:e0:86:c5:e7 size 1984 subject "CN=www.baycolony.sebastians.com,OU=Domain Control Validated,O=www.baycolony.sebastians.com" subject-alternative-name "DNS:baycolony.sebastians.com, DNS:www.baycolony.sebastians.com" updated-by root version 3 } sys file ssl-cert baycolony.sebastians.com-RENEWAL-2014.crt { certificate-key-size 2048 checksum SHA1:1895:6350eccd04c8941945ae8fc3a3d78d9a6a2b9165 create-time 2014-05-29:10:35:10 created-by root expiration-date 1464459585 expiration-string "May 28 18:19:45 2016 GMT" issuer "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2014-05-29:10:35:10 mode 33188 revision 1 serial-number 4a:fa:0d:a6:ec:8c:3a size 1895 subject "CN=www.baycolony.sebastians.com,OU=Domain Control Validated" subject-alternative-name "DNS:baycolony.sebastians.com, DNS:www.baycolony.sebastians.com" updated-by root version 3 } sys file ssl-cert baycolonysebastians-com-12.crt { certificate-key-size 2048 checksum SHA1:1992:efdb3478c5746e874ae88ae9f53b439916849d7d create-time 2013-10-21:10:00:15 created-by root expiration-date 1400861034 expiration-string "May 23 16:03:54 2014 GMT" issuer "serialNumber=07969287,CN=Go Daddy Secure Certification Authority,OU=http://certificates.godaddy.com/repository,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2013-10-21:10:00:15 mode 33188 revision 1 serial-number 04:53:b4:3f:fe:11:c2 size 1992 subject "CN=www.baycolony.sebastians.com,OU=Domain Control Validated,O=www.baycolony.sebastians.com" subject-alternative-name "DNS:baycolony.sebastians.com, DNS:www.baycolony.sebastians.com" updated-by root version 3 } sys file ssl-cert ca-bundle.crt { certificate-key-size 1024 checksum SHA1:778900:4353ff5f8afcdde5427b540166ea4535f44819cd create-time 2015-05-09:02:15:14 created-by root expiration-date 1534204740 expiration-string "Aug 13 23:59:00 2018 GMT" is-bundle true issuer "CN=GTE CyberTrust Global Root,OU=GTE CyberTrust Solutions, Inc.,O=GTE Corporation,C=US" key-type rsa-public last-update-time 2015-05-09:02:15:14 mode 33261 revision 1 serial-number 421 size 778900 subject "CN=GTE CyberTrust Global Root,OU=GTE CyberTrust Solutions, Inc.,O=GTE Corporation,C=US" system-path /config/ssl/ssl.crt/ca-bundle.crt updated-by root version 1 } sys file ssl-cert ca-bundle.crt.preremoval { certificate-key-size 1024 checksum SHA1:778900:4353ff5f8afcdde5427b540166ea4535f44819cd create-time 2015-04-10:04:29:06 created-by root expiration-date 1534204740 expiration-string "Aug 13 23:59:00 2018 GMT" is-bundle true issuer "CN=GTE CyberTrust Global Root,OU=GTE CyberTrust Solutions, Inc.,O=GTE Corporation,C=US" key-type rsa-public last-update-time 2015-04-10:04:29:06 mode 33261 revision 1 serial-number 421 size 778900 subject "CN=GTE CyberTrust Global Root,OU=GTE CyberTrust Solutions, Inc.,O=GTE Corporation,C=US" updated-by root version 1 } sys file ssl-cert catering.castwdw.com-13.crt { certificate-key-size 2048 checksum SHA1:1942:affe8f76a0ab07571b7a782d5b4e69425470a83d create-time 2013-11-08:22:13:07 created-by root expiration-date 1478712368 expiration-string "Nov 9 17:26:08 2016 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-11-08:22:13:07 mode 33152 revision 1 serial-number 518050 size 1942 subject "CN=catering.castwdw.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)13,OU=GT97204275,serialNumber=IwWKyoek7b2SAvgazJmhtcoxt2VhDu9y" subject-alternative-name DNS:catering.castwdw.com updated-by root version 3 } sys file ssl-cert catering.castwdw.com.crt { certificate-key-size 2048 checksum SHA1:1911:b377339c9e659d38d436153c5e09bc0260a3053b create-time 2013-11-07:10:33:27 created-by root expiration-date 1478409374 expiration-string "Nov 6 05:16:14 2016 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-11-07:10:33:27 mode 33188 revision 1 serial-number 516363 size 1911 subject "CN=catering.castwdw.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)13,OU=GT97204275,serialNumber=wIj-zFgiGaAgqvRg-LHKLs4tz44RSna1" subject-alternative-name DNS:catering.castwdw.com updated-by root version 3 } sys file ssl-cert default.crt { certificate-key-size 2048 checksum SHA1:1334:bc5fd7b5f65c6b062fb3f28e36b2c213d6b4bab2 create-time 2013-10-01:08:48:05 created-by root email root@localhost.localdomain expiration-date 1695995285 expiration-string "Sep 29 13:48:05 2023 GMT" issuer emailAddress=root@localhost.localdomain,CN=localhost.localdomain,OU=IT,O=MyCompany,L=Seattle,ST=WA,C=US key-type rsa-public last-update-time 2013-10-01:08:48:05 mode 33188 revision 1 size 1334 subject emailAddress=root@localhost.localdomain,CN=localhost.localdomain,OU=IT,O=MyCompany,L=Seattle,ST=WA,C=US system-path /config/ssl/ssl.crt/default.crt updated-by root version 3 } sys file ssl-cert dine.castdlr.com-13.crt { certificate-key-size 2048 checksum SHA1:1930:86b4e69a00b433d8baff17f45d7811071c967dbb create-time 2013-11-08:22:20:34 created-by root expiration-date 1478703750 expiration-string "Nov 9 15:02:30 2016 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-11-08:22:20:34 mode 33152 revision 1 serial-number 518045 size 1930 subject "CN=dine.castdlr.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)13,OU=GT21938438,serialNumber=VFaE14Z66nFrTotbQ8GOJ9S4iyBo8jXh" subject-alternative-name DNS:dine.castdlr.com updated-by root version 3 } sys file ssl-cert dine.castwdw.com-13.crt { certificate-key-size 2048 checksum SHA1:1930:1aef24e08a6c79a3e380422e8fe3ae9ce3bb59c7 create-time 2013-11-08:22:13:07 created-by root expiration-date 1478701602 expiration-string "Nov 9 14:26:42 2016 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-11-08:22:13:07 mode 33152 revision 1 serial-number 518049 size 1930 subject "CN=dine.castwdw.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)13,OU=GT85179783,serialNumber=YacGnKbaeugzWJxn9WalWPLIXNlXXPiZ" subject-alternative-name DNS:dine.castwdw.com updated-by root version 3 } sys file ssl-cert dinnerbydish-12.crt { certificate-key-size 2048 checksum SHA1:1952:484f05916ebee7ca60b706d74cc2ab25261d4a51 create-time 2013-10-21:10:02:09 created-by root expiration-date 1437091199 expiration-string "Jul 16 23:59:59 2015 GMT" issuer "CN=Register.com CA SSL Services (OV),O=Register.com,C=US" key-type rsa-public last-update-time 2013-10-21:10:02:09 mode 33188 revision 1 serial-number f7:b3:ec:21:32:2e:48:89:d4:62:37:4b:b7:29:36:08 size 1952 subject "CN=dinnerbydish.com,OU=Register.com InstantSSL,OU=Provided by Register.com,O=Dish,street=22 Andover St,L=Andover,ST=MA,postalCode=01810,C=US" subject-alternative-name "DNS:www.dinnerbydish.com, DNS:dinnerbydish.com" updated-by root version 3 } sys file ssl-cert dinnerbydish.com18.crt { certificate-key-size 2048 checksum SHA1:2184:ea0209a88f33f99a2c5fcd925176ceb178a00e79 create-time 2015-07-22:15:02:10 created-by robe6962 expiration-date 1532217599 expiration-string "Jul 21 23:59:59 2018 GMT" issuer "CN=USERTrust RSA Organization Validation Secure Server CA,O=The USERTRUST Network,L=Jersey City,ST=New Jersey,C=US" key-type rsa-public last-update-time 2015-07-22:15:02:10 mode 33188 revision 1 serial-number 7b:14:75:a2:5b:5d:2d:11:30:be:1a:83:41:22:a1:f8 size 2184 subject "CN=dinnerbydish.com,OU=InstantSSL Pro,OU=Hosted by Register.com,OU=DiSH,O=DiSH,street=22C Andover Street,street=22C Andover Street,L=Andover,ST=MA,postalCode=01810,C=US" subject-alternative-name "DNS:www.dinnerbydish.com, DNS:dinnerbydish.com" updated-by robe6962 version 3 } sys file ssl-cert dinnerbydish.comCA18.crt { certificate-key-size 2048 checksum SHA1:2212:b3fd75e2bc41e59a2f05794a98869d193aa5a482 create-time 2015-07-22:15:07:20 created-by robe6962 expiration-date 1882051199 expiration-string "Aug 21 23:59:59 2029 GMT" issuer "CN=USERTrust RSA Certification Authority,O=The USERTRUST Network,L=Jersey City,ST=New Jersey,C=US" key-type rsa-public last-update-time 2015-07-22:15:45:46 mode 33188 revision 2 serial-number 75:e8:5b:68:a7:58:94:6a:18:d3:58:d4:e4:75:04:ac size 2212 subject "CN=USERTrust RSA Organization Validation Secure Server CA,O=The USERTRUST Network,L=Jersey City,ST=New Jersey,C=US" updated-by robe6962 version 3 } sys file ssl-cert dinnerbydishcom-12.crt { certificate-key-size 2048 checksum SHA1:1939:a18c892cc71e55ebd25606321fd9a5f117cd762c create-time 2013-10-21:08:44:41 created-by root expiration-date 1342810761 expiration-string "Jul 20 18:59:21 2012 GMT" issuer "serialNumber=07969287,CN=Go Daddy Secure Certification Authority,OU=http://certificates.godaddy.com/repository,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2013-10-21:08:44:41 mode 33188 revision 1 serial-number 04:53:0e:e5:72:33:2a size 1939 subject "CN=dinnerbydish.com,OU=Domain Control Validated,O=dinnerbydish.com" subject-alternative-name "DNS:www.dinnerbydish.com, DNS:dinnerbydish.com" updated-by root version 3 } sys file ssl-cert draperlabs.sebastians.com-2106.crt { certificate-key-size 2048 checksum SHA1:1895:e08316e7a96761eb517bf15ddaf66d2189098a00 create-time 2014-06-06:09:14:14 created-by root expiration-date 1468703599 expiration-string "Jul 16 21:13:19 2016 GMT" issuer "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2014-06-06:09:14:14 mode 33188 revision 1 serial-number 2b:3b:75:0e:17:e6:59 size 1895 subject "CN=draperlabs.sebastians.com,OU=Domain Control Validated" subject-alternative-name "DNS:www.draperlabs.sebastians.com, DNS:draperlabs.sebastians.com" updated-by root version 3 } sys file ssl-cert draprlabssebastianscom-12.crt { certificate-key-size 2048 checksum SHA1:1980:e6b1ac6d2ba778c5df2f6616a9eeb87544a6c198 create-time 2013-10-21:09:43:52 created-by root expiration-date 1342903857 expiration-string "Jul 21 20:50:57 2012 GMT" issuer "serialNumber=07969287,CN=Go Daddy Secure Certification Authority,OU=http://certificates.godaddy.com/repository,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2013-10-21:09:43:52 mode 33188 revision 1 serial-number 04:63:04:86:d7:f6:ce size 1980 subject "CN=draperlabs.sebastians.com,OU=Domain Control Validated,O=draperlabs.sebastians.com" subject-alternative-name "DNS:www.draperlabs.sebastians.com, DNS:draperlabs.sebastians.com" updated-by root version 3 } sys file ssl-cert draprlabssebastiansnew-12.crt { certificate-key-size 2048 checksum SHA1:1988:48aec2c38c75e00e9a4d72aeb8e8b75e68d50db7 create-time 2013-10-21:10:02:56 created-by root expiration-date 1405545199 expiration-string "Jul 16 21:13:19 2014 GMT" issuer "serialNumber=07969287,CN=Go Daddy Secure Certification Authority,OU=http://certificates.godaddy.com/repository,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2013-10-21:10:02:56 mode 33188 revision 1 serial-number 07:f8:b4:b9:77:1e:74 size 1988 subject "CN=draperlabs.sebastians.com,OU=Domain Control Validated,O=draperlabs.sebastians.com" subject-alternative-name "DNS:www.draperlabs.sebastians.com, DNS:draperlabs.sebastians.com" updated-by root version 3 } sys file ssl-cert expresscatering.usc.edu-2015.crt { certificate-key-size 2048 checksum SHA1:1899:0daf4148c94549517d098f9ea3122576667be6dc create-time 2014-10-26:05:15:04 created-by root expiration-date 1445474276 expiration-string "Oct 22 00:37:56 2015 GMT" issuer "CN=Entrust Certification Authority - L1K,OU=(c) 2012 Entrust, Inc. - for authorized use only,OU=See www.entrust.net/legal-terms,O=Entrust, Inc.,C=US" key-type rsa-public last-update-time 2014-10-26:05:15:04 mode 33188 revision 1 serial-number 1355953097 size 1899 subject "CN=expresscatering.usc.edu,O=University of Southern California,L=Los Angeles,ST=California,C=US" subject-alternative-name DNS:expresscatering.usc.edu updated-by root version 3 } sys file ssl-cert expresscatering.usc.edu-2016.crt { certificate-key-size 2048 checksum SHA1:1972:63d9bd21b5d8c158df47551e455f6454a558f5b0 create-time 2015-09-25:11:18:36 created-by robe7436 expiration-date 1474735110 expiration-string "Sep 24 16:38:30 2016 GMT" issuer "CN=Entrust Certification Authority - L1K,OU=(c) 2012 Entrust, Inc. - for authorized use only,OU=See www.entrust.net/legal-terms,O=Entrust, Inc.,C=US" key-type rsa-public last-update-time 2015-09-25:11:18:36 mode 33188 revision 1 serial-number 1356166898 size 1972 subject "CN=expresscatering.usc.edu,O=University of Southern California,L=Los Angeles,ST=California,C=US" subject-alternative-name "DNS:www.expresscatering.usc.edu, DNS:expresscatering.usc.edu" updated-by robe7436 version 3 } sys file ssl-cert expresscateringedu2014-13.crt { certificate-key-size 2048 checksum SHA1:1879:c71a38a2abd0dfc6f136cd2ff765010cc278aa19 create-time 2013-10-21:10:12:21 created-by root expiration-date 1414475362 expiration-string "Oct 28 05:49:22 2014 GMT" issuer "CN=Entrust Certification Authority - L1C,OU=(c) 2009 Entrust, Inc.,OU=www.entrust.net/rpa is incorporated by reference,O=Entrust, Inc.,C=US" key-type rsa-public last-update-time 2013-10-21:10:12:21 mode 33188 revision 1 serial-number 1277214265 size 1879 subject "CN=expresscatering.usc.edu,O=University of Southern California,L=Los Angeles,ST=California,C=US" subject-alternative-name DNS:expresscatering.usc.edu updated-by root version 3 } sys file ssl-cert expresscateringedu-12.crt { certificate-key-size 2048 checksum SHA1:1923:9aadf039bdce6070e8ab12cf0b9c6233017c04a4 create-time 2013-10-21:10:04:10 created-by root expiration-date 1382829993 expiration-string "Oct 26 23:26:33 2013 GMT" issuer "CN=Entrust Certification Authority - L1C,OU=(c) 2009 Entrust, Inc.,OU=www.entrust.net/rpa is incorporated by reference,O=Entrust, Inc.,C=US" key-type rsa-public last-update-time 2013-10-21:10:04:10 mode 33188 revision 1 serial-number 1277045114 size 1923 subject "CN=expresscatering.usc.edu,OU=Hospitality Services,O=University of Southern California,L=Los Angeles,ST=California,C=US" subject-alternative-name DNS:expresscatering.usc.edu updated-by root version 3 } sys file ssl-cert f5-irule.crt { certificate-key-size 2048 checksum SHA1:1359:1306e84e1e6a2da53816cefe1f684b80d6be1e3e create-time 2015-02-09:01:59:12 created-by root email support@f5.com expiration-date 1944422489 expiration-string "Aug 13 21:21:29 2031 GMT" issuer "emailAddress=support@f5.com,CN=support.f5.com,OU=Product Development,O=F5 Networks,L=Seattle,ST=Washington,C=US" key-type rsa-public last-update-time 2015-02-09:01:59:12 mode 33188 revision 1 serial-number c3:4c:63:f7:7f:d3:ae:e5 size 1359 subject "emailAddress=support@f5.com,CN=support.f5.com,OU=Product Development,O=F5 Networks,L=Seattle,ST=Washington,C=US" system-path /config/ssl/ssl.crt/f5-irule.crt updated-by root version 1 } sys file ssl-cert harveystirrupscom-12.crt { certificate-key-size 2048 checksum SHA1:1740:8201c48ef82a134f10fa599940eda1c7d2d3b768 create-time 2013-10-21:09:48:52 created-by root expiration-date 1377576718 expiration-string "Aug 27 04:11:58 2013 GMT" issuer "CN=RapidSSL CA,O=GeoTrust, Inc.,C=US" key-type rsa-public last-update-time 2013-10-21:09:48:52 mode 33188 revision 1 serial-number 168375 size 1740 subject "CN=harveystirrups.com,OU=Domain Control Validated - RapidSSL(R),OU=See www.rapidssl.com/resources/cps (c)11,OU=GT80827861,O=harveystirrups.com,C=US,serialNumber=aN7cvANk7fGQGDVIOHi2mObEfMgjsFBp" subject-alternative-name DNS:harveystirrups.com updated-by root version 3 } sys file ssl-cert harveystirrupscom-13.crt { certificate-key-size 2048 checksum SHA1:1944:eebaafba908b94005f88f3330311887c59b5a0f9 create-time 2013-10-21:10:17:01 created-by root expiration-date 1473535870 expiration-string "Sep 10 19:31:10 2016 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-10-21:10:17:01 mode 33188 revision 1 serial-number 490024 size 1944 subject "CN=www.harveystirrups.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)13,OU=GT53912950,serialNumber=xyC4bEafvDx56GAhEMe9awSeOexljDkw" subject-alternative-name "DNS:harveystirrups.com, DNS:www.harveystirrups.com" updated-by root version 3 } sys file ssl-cert home.castdr.com-13.crt { certificate-key-size 2048 checksum SHA1:1930:ea69cc447d6ba12d4c779469d0c5c5fb7cb9330e create-time 2013-11-08:22:20:34 created-by root expiration-date 1478667171 expiration-string "Nov 9 04:52:51 2016 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-11-08:22:20:34 mode 33152 revision 1 serial-number 518048 size 1930 subject "CN=home.castdr.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)13,OU=GT75852032,serialNumber=aohvttEGucxwPwVOxIjd0iF/Dc-H8LPD" subject-alternative-name DNS:home.castdr.com updated-by root version 3 } sys file ssl-cert home.castdr.com.crt { certificate-key-size 2048 checksum SHA1:1899:e24ce132a8d320ee9a2dd1ae1d79a817b517a697 create-time 2013-11-07:10:32:54 created-by root expiration-date 1478425405 expiration-string "Nov 6 09:43:25 2016 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-11-07:10:32:54 mode 33188 revision 1 serial-number 516366 size 1899 subject "CN=home.castdr.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)13,OU=GT75852032,serialNumber=IckfBeawP4DhjDiwZpGiom6anuJS7x22" subject-alternative-name DNS:home.castdr.com updated-by root version 3 } sys file ssl-cert mindful.castdr.com.crt { certificate-key-size 2048 checksum SHA1:1907:30d21c0f63301fa305b08f96cb425d5ff9aec1fa create-time 2014-02-07:13:56:15 created-by root expiration-date 1486281157 expiration-string "Feb 5 07:52:37 2017 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2014-02-07:13:56:15 mode 33188 revision 1 serial-number 554812 size 1907 subject "CN=mindful.castdr.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)14,OU=GT97042119,serialNumber=twIvU2UTeyOErPRageq9xhPlElLoVNi1" subject-alternative-name DNS:mindful.castdr.com updated-by root version 3 } sys file ssl-cert networkdrive.sebastians.com-2015.crt { certificate-key-size 2048 checksum SHA1:1907:b51c8a27d3679c5e881d0e0b3fe4ace29e7c191d create-time 2015-01-06:02:07:50 created-by root expiration-date 1484603651 expiration-string "Jan 16 21:54:11 2017 GMT" issuer "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2015-01-06:02:07:50 mode 33188 revision 1 serial-number aa:c3:fb:d2:2b:8d:47:95 size 1907 subject "CN=networkdrive.sebastians.com,OU=Domain Control Validated" subject-alternative-name "DNS:www.networkdrive.sebastians.com, DNS:networkdrive.sebastians.com" updated-by root version 3 } sys file ssl-cert networkdrivesebastians13-13.crt { certificate-key-size 2048 checksum SHA1:2000:81b68078280f9673105a178dbdd4448ce08307b7 create-time 2013-10-21:10:04:52 created-by root expiration-date 1421445251 expiration-string "Jan 16 21:54:11 2015 GMT" issuer "serialNumber=07969287,CN=Go Daddy Secure Certification Authority,OU=http://certificates.godaddy.com/repository,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2013-10-21:10:04:52 mode 33188 revision 1 serial-number 04:30:17:07:25:36:49 size 2000 subject "CN=networkdrive.sebastians.com,OU=Domain Control Validated,O=networkdrive.sebastians.com" subject-alternative-name "DNS:www.networkdrive.sebastians.com, DNS:networkdrive.sebastians.com" updated-by root version 3 } sys file ssl-cert orderexpertcom1-12.crt { certificate-key-size 2048 checksum SHA1:1639:ad2debbc31b2005d2cde75f50699a8f0177bdfd3 create-time 2013-10-21:09:36:38 created-by root expiration-date 1358074597 expiration-string "Jan 13 10:56:37 2013 GMT" issuer "CN=GeoTrust SSL CA,O=GeoTrust, Inc.,C=US" key-type rsa-public last-update-time 2013-10-21:09:36:38 mode 33188 revision 1 serial-number 74542 size 1639 subject "CN=*.orderexpert.com,O=Hospitality101 Inc.,L=Rochester,ST=New York,C=US,serialNumber=lAsl/BqF3A9xjKg9i1ZV-YlAayLVR57Y" subject-alternative-name "DNS:orderexpert.com, DNS:*.orderexpert.com" updated-by root version 3 } sys file ssl-cert sodexoresource.com-2017.crt { certificate-key-size 2048 checksum SHA1:2044:ca12eaee9a2cb6395580fa1a30a6cee808bd1d88 create-time 2016-03-29:12:28:14 created-by nick7794 expiration-date 1490831999 expiration-string "Mar 29 23:59:59 2017 GMT" issuer "CN=thawte DV SSL CA - G2,OU=Domain Validated SSL,O=thawte, Inc.,C=US" key-type rsa-public last-update-time 2016-03-29:12:28:14 mode 33188 revision 1 serial-number 4a:c2:d0:fb:66:6c:28:aa:71:52:6a:a2:f8:85:9d:fc size 2044 subject CN=sodexoresource.com subject-alternative-name "DNS:www.sodexoresource.com, DNS:sodexoresource.com" updated-by nick7794 version 3 } sys file ssl-cert sodexoresourcecom-13.crt { certificate-key-size 2048 checksum SHA1:1944:7d45b681a30b69cde1f5cb7a2c06839b8628ab64 create-time 2013-10-21:10:06:01 created-by root expiration-date 1459188732 expiration-string "Mar 28 18:12:12 2016 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-10-21:10:06:01 mode 33188 revision 1 serial-number 416555 size 1944 subject "CN=www.sodexoresource.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)13,OU=GT49276497,serialNumber=6ZFtGbun-pJ/hg5LeVrXXCwqVY0KDCoR" subject-alternative-name "DNS:sodexoresource.com, DNS:www.sodexoresource.com" updated-by root version 3 } sys file ssl-cert thehouse.misofi.net-2016.crt { certificate-key-size 2048 checksum SHA1:2142:8c549480531e46124d20c38e4246dd34e0fdda46 create-time 2016-05-03:11:09:19 created-by chri6215 expiration-date 1493825146 expiration-string "May 3 15:25:46 2017 GMT" issuer "CN=StartCom Class 1 DV Server CA,OU=StartCom Certification Authority,O=StartCom Ltd.,C=IL" key-type rsa-public last-update-time 2016-05-03:11:09:19 mode 33188 revision 1 serial-number 59:02:1c:25:97:22:3d:ea:8d:8a:6d:d6:a1:d2:59:e2 size 2142 subject CN=thehouse.misofi.net subject-alternative-name DNS:thehouse.misofi.net updated-by chri6215 version 3 } sys file ssl-cert traditionscateringcharlotte.com-2016.crt { certificate-key-size 2048 checksum SHA1:1952:4ae6c3f7e79561294a47697e10f2a064ce39013b create-time 2015-08-29:03:42:26 created-by robe7436 expiration-date 1472389902 expiration-string "Aug 28 13:11:42 2016 GMT" issuer "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2015-08-29:03:42:26 mode 33188 revision 1 serial-number 92:0f:f6:4d:43:8e:08:c1 size 1952 subject "CN=traditionscateringcharlotte.com,OU=Domain Control Validated" subject-alternative-name "DNS:www.traditionscateringcharlotte.com, DNS:traditionscateringcharlotte.com" updated-by robe7436 version 3 } sys file ssl-cert wild.catertrax.com-10.crt { certificate-key-size 1024 checksum SHA1:1224:b513826ccde68e5f883e927fe3200e5a0640eac4 create-time 2013-10-21:08:44:08 created-by root expiration-date 1328450566 expiration-string "Feb 5 14:02:46 2012 GMT" issuer "OU=Equifax Secure Certificate Authority,O=Equifax,C=US" key-type rsa-public last-update-time 2013-10-21:08:44:08 mode 33188 revision 1 serial-number 958872 size 1224 subject "CN=*.catertrax.com,OU=Domain Control Validated - RapidSSL(R),OU=See www.rapidssl.com/resources/cps (c)10,OU=GT99801444,O=*.catertrax.com,C=US,serialNumber=psTrCUsO6sL1Ew-vhBNIaOVdErZSwgHg" updated-by root version 3 } sys file ssl-cert wild.catertrax.com-14.crt { certificate-key-size 2048 checksum SHA1:1744:28ec42aa89eb835682a47f9f6b88d07a278313bb create-time 2014-02-13:18:35:38 created-by root expiration-date 1520899199 expiration-string "Mar 12 23:59:59 2018 GMT" issuer "CN=GeoTrust SSL CA - G2,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2014-02-13:18:35:38 mode 33188 revision 1 serial-number 1e:4e:86:f4:7f:76:d7:33:2d:8c:f5:34:0e:72:60:ec size 1744 subject "CN=*.catertrax.com,O=Hospitality 101, Inc,L=Rochester,ST=New York,C=US" subject-alternative-name "DNS:catertrax.com, DNS:*.catertrax.com" updated-by root version 3 } sys file ssl-cert wild.catertrax.com-15.crt { certificate-key-size 2048 checksum SHA1:1796:2149780756b39b7da9342f556c0eed91b4a88bf4 create-time 2015-05-12:12:10:43 created-by john8252 expiration-date 1520899199 expiration-string "Mar 12 23:59:59 2018 GMT" issuer "CN=GeoTrust SSL CA - G3,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2015-05-12:12:10:43 mode 33188 revision 1 serial-number 2b:46:cc:90:03:d6:03:cd:ae:bb:ab:7d:55:e2:e4:54 size 1796 subject "CN=*.catertrax.com,O=Hospitality 101, Inc,L=Rochester,ST=New York,C=US" subject-alternative-name "DNS:catertrax.com, DNS:*.catertrax.com" updated-by john8252 version 3 } sys file ssl-cert wild.lakecountrycatering.com-2014.crt { certificate-key-size 2048 checksum SHA1:1740:e25c4ca5fbb70a702f49a887c439783b925a3028 create-time 2014-05-09:04:36:44 created-by root expiration-date 1494201599 expiration-string "May 7 23:59:59 2017 GMT" issuer "CN=GeoTrust SSL CA - G3,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2014-05-09:04:36:44 mode 33188 revision 1 serial-number 7f:2d:8c:72:6a:fc:9d:32:45:40:aa:cf:ed:77:42:74 size 1740 subject "CN=*.lakecountrycatering.com,O=Hospitality 101, Inc,L=Rochester,ST=New York,C=US" subject-alternative-name "DNS:lakecountrycatering.com, DNS:*.lakecountrycatering.com" updated-by root version 3 } sys file ssl-cert wild.misofi.net-16.crt { certificate-key-size 2048 checksum SHA1:1757:3bfa42efa67d4fc3261ae5c4927213dc51b26d4b create-time 2015-04-30:22:13:03 created-by root expiration-date 1461887999 expiration-string "Apr 28 23:59:59 2016 GMT" issuer "CN=GeoTrust SSL CA - G3,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2015-04-30:22:13:03 mode 33188 revision 1 serial-number 03:f5:31:58:1a:33:da:60:34:7f:94:bb:5f:0d:68:5a size 1757 subject "CN=*.misofi.net,O=Hospitality 101, Inc,L=Rochester,ST=New York,C=US" subject-alternative-name "DNS:misofi.net, DNS:*.misofi.net" updated-by root version 3 } sys file ssl-cert wild.misofi.net-256.crt { certificate-key-size 2048 checksum SHA1:1757:3bfa42efa67d4fc3261ae5c4927213dc51b26d4b create-time 2015-05-06:15:02:37 created-by root expiration-date 1461887999 expiration-string "Apr 28 23:59:59 2016 GMT" issuer "CN=GeoTrust SSL CA - G3,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2015-05-06:15:02:37 mode 33188 revision 1 serial-number 03:f5:31:58:1a:33:da:60:34:7f:94:bb:5f:0d:68:5a size 1757 subject "CN=*.misofi.net,O=Hospitality 101, Inc,L=Rochester,ST=New York,C=US" subject-alternative-name "DNS:misofi.net, DNS:*.misofi.net" updated-by root version 3 } sys file ssl-cert wildcard.misofi.net-2018.crt { certificate-key-size 2048 checksum SHA1:2246:ba7b5c54dd2dce3da1116108fdbbfabfe053fdf7 create-time 2016-05-03:11:36:23 created-by mike4609 expiration-date 1525391999 expiration-string "May 3 23:59:59 2018 GMT" issuer "CN=thawte SSL CA - G2,O=thawte, Inc.,C=US" key-type rsa-public last-update-time 2016-05-03:11:36:23 mode 33188 revision 1 serial-number 77:0a:e7:76:da:15:a7:36:b5:4f:c6:f3:ee:46:04:f6 size 2246 subject "CN=*.misofi.net,O=Hospitality 101, Inc.,L=Rochester,ST=New York,C=US" subject-alternative-name "DNS:misofi.net, DNS:*.misofi.net" updated-by mike4609 version 3 } sys file ssl-cert wildcatertraxcom-12.crt { certificate-key-size 2048 checksum SHA1:1667:9233ebadba2e1561b5bda02605e57d1ec2c75a6e create-time 2013-10-21:09:43:12 created-by root expiration-date 1393217384 expiration-string "Feb 24 04:49:44 2014 GMT" issuer "CN=GeoTrust SSL CA,O=GeoTrust, Inc.,C=US" key-type rsa-public last-update-time 2013-10-21:09:43:12 mode 33188 revision 1 serial-number 76105 size 1667 subject "CN=*.catertrax.com,OU=.catertrax.com,O=Hospitality 101, Inc.,L=Rochester,ST=New York,C=US,serialNumber=97SMtEiYlChl16-/P4kywMo9wystGtgy" subject-alternative-name "DNS:catertrax.com, DNS:*.catertrax.com" updated-by root version 3 } sys file ssl-cert www.crosspoint.sebastians.com.crt { certificate-key-size 2048 checksum SHA1:1903:994842052f4dbb5c31be54b3ba3d85976c4f2bee create-time 2015-02-01:22:27:02 created-by root expiration-date 1517190821 expiration-string "Jan 29 01:53:41 2018 GMT" issuer "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2015-02-01:22:27:02 mode 33188 revision 1 serial-number 2b:a9:8a:d2:75:cf:62:c4 size 1903 subject "CN=www.crosspoint.sebastians.com,OU=Domain Control Validated" subject-alternative-name "DNS:crosspoint.sebastians.com, DNS:www.crosspoint.sebastians.com" updated-by root version 3 } sys file ssl-cert www.dine.castdlr.com-2016.crt { certificate-key-size 2048 checksum SHA1:1911:5229fb40f1b9789b2da8a33122f3ef8cf6679d93 create-time 2013-11-07:13:46:49 created-by root expiration-date 1478330545 expiration-string "Nov 5 07:22:25 2016 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-11-07:13:46:49 mode 33188 revision 1 serial-number 515593 size 1911 subject "CN=www.dine.castdlr.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)13,OU=GT12917752,serialNumber=470tnRVlbT1gXrwc0ifa55ruCzViViDM" subject-alternative-name DNS:www.dine.castdlr.com updated-by root version 3 } sys file ssl-cert www.dine.castwdw.com-13.crt { certificate-key-size 2048 checksum SHA1:1911:edb507c9c81d601a91c2879a58f2138e4c91da09 create-time 2013-11-07:19:58:49 created-by root expiration-date 1478348452 expiration-string "Nov 5 12:20:52 2016 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2013-11-07:19:58:49 mode 33188 revision 1 serial-number 515594 size 1911 subject "CN=www.dine.castwdw.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)13,OU=GT95651989,serialNumber=nwCraCWQwhpQnnJIuUc6N6esv9BW7ESj" subject-alternative-name DNS:www.dine.castwdw.com updated-by root version 3 } sys file ssl-cert www.heavenlycatering.com-2016.crt { certificate-key-size 2048 checksum SHA1:1688:4467148fad7d93aa8c54cb432487541ccf7f6745 create-time 2015-11-23:15:02:20 created-by robe7436 expiration-date 1479859199 expiration-string "Nov 22 23:59:59 2016 GMT" issuer "CN=thawte DV SSL CA - G2,OU=Domain Validated SSL,O=thawte, Inc.,C=US" key-type rsa-public last-update-time 2015-11-23:15:02:20 mode 33188 revision 1 serial-number 13:ef:53:1d:19:6c:e3:fd:c2:6b:e4:7d:3d:ef:aa:0a size 1688 subject CN=heavenlycatering.com subject-alternative-name "DNS:www.heavenlycatering.com, DNS:heavenlycatering.com" updated-by robe7436 version 3 } sys file ssl-cert www.mpsfoodservice.org-2017-current.crt { certificate-key-size 2048 checksum SHA1:1944:753e7749ecdd6b651bd10e34cda026022460e075 create-time 2014-01-16:10:35:45 created-by root expiration-date 1484630463 expiration-string "Jan 17 05:21:03 2017 GMT" issuer "CN=GeoTrust DV SSL CA,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2014-01-16:10:35:45 mode 33188 revision 1 serial-number 546564 size 1944 subject "CN=www.mpsfoodservice.org,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)14,OU=GT78601142,serialNumber=CVG5ViPSdUcoQI-X8XlrQyjX2PYQLwKm" subject-alternative-name "DNS:mpsfoodservice.org, DNS:www.mpsfoodservice.org" updated-by root version 3 } sys file ssl-cert www.mpsfoodservice.org-2018.crt { certificate-key-size 2048 checksum SHA1:2033:86dc10c0f3333f1e20b1b889b4f0776276192316 create-time 2014-01-07:09:34:06 created-by root expiration-date 1516319999 expiration-string "Jan 18 23:59:59 2018 GMT" issuer "CN=Network Solutions Certificate Authority,O=Network Solutions L.L.C.,C=US" key-type rsa-public last-update-time 2014-01-07:09:34:06 mode 33188 revision 1 serial-number d3:ff:42:10:4c:64:17:1d:ab:55:cf:d8:78:f8:b2:5d size 2033 subject "CN=www.mpsfoodservice.org,OU=Secure Link SSL,O=EDUCATIONAL SERVICE UNIT 3,street=6949 S. 110th,L=LAVISTA,ST=NE,postalCode=68128,C=US" subject-alternative-name DNS:www.mpsfoodservice.org updated-by root version 3 } sys file ssl-cert www.rundscatering.com.crt { certificate-key-size 2048 checksum SHA1:1793:93e3f29746e0c3ec9bbc2ff510c094ede2bb9cec create-time 2015-03-06:01:50:27 created-by root expiration-date 1520292248 expiration-string "Mar 5 23:24:08 2018 GMT" issuer "CN=GeoTrust DV SSL CA - G4,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2015-03-06:01:50:27 mode 33188 revision 1 serial-number 54224 size 1793 subject "CN=www.rundscatering.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)15,OU=GT59943157" subject-alternative-name "DNS:rundscatering.com, DNS:www.rundscatering.com" updated-by root version 3 } sys file ssl-cert www.traditionscateringcharlotte.com-2014.crt { certificate-key-size 2048 checksum SHA1:1923:ccb4f7f0d6f5dd51255aa5ced98f6accc1688f6f create-time 2014-08-14:15:32:57 created-by root expiration-date 1439403282 expiration-string "Aug 12 18:14:42 2015 GMT" issuer "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2014-08-14:15:32:57 mode 33188 revision 1 serial-number 03:f9:fa:05:d0:ee:bf size 1923 subject "CN=www.traditionscateringcharlotte.com,OU=Domain Control Validated" subject-alternative-name "DNS:traditionscateringcharlotte.com, DNS:www.traditionscateringcharlotte.com" updated-by root version 3 } (END) version 3 } sys file ssl-cert www.mpsfoodservice.org-2018.crt { certificate-key-size 2048 checksum SHA1:2033:86dc10c0f3333f1e20b1b889b4f0776276192316 create-time 2014-01-07:09:34:06 created-by root expiration-date 1516319999 expiration-string "Jan 18 23:59:59 2018 GMT" issuer "CN=Network Solutions Certificate Authority,O=Network Solutions L.L.C.,C=US" key-type rsa-public last-update-time 2014-01-07:09:34:06 mode 33188 revision 1 serial-number d3:ff:42:10:4c:64:17:1d:ab:55:cf:d8:78:f8:b2:5d size 2033 subject "CN=www.mpsfoodservice.org,OU=Secure Link SSL,O=EDUCATIONAL SERVICE UNIT 3,street=6949 S. 110th,L=LAVISTA,ST=NE,postalCode=68128,C=US" subject-alternative-name DNS:www.mpsfoodservice.org updated-by root version 3 } sys file ssl-cert www.rundscatering.com.crt { certificate-key-size 2048 checksum SHA1:1793:93e3f29746e0c3ec9bbc2ff510c094ede2bb9cec create-time 2015-03-06:01:50:27 created-by root expiration-date 1520292248 expiration-string "Mar 5 23:24:08 2018 GMT" issuer "CN=GeoTrust DV SSL CA - G4,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2015-03-06:01:50:27 mode 33188 revision 1 serial-number 54224 size 1793 subject "CN=www.rundscatering.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)15,OU=GT59943157" subject-alternative-name "DNS:rundscatering.com, DNS:www.rundscatering.com" updated-by root version 3 } sys file ssl-cert www.traditionscateringcharlotte.com-2014.crt { certificate-key-size 2048 checksum SHA1:1923:ccb4f7f0d6f5dd51255aa5ced98f6accc1688f6f create-time 2014-08-14:15:32:57 created-by root expiration-date 1439403282 expiration-string "Aug 12 18:14:42 2015 GMT" issuer "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, In version 3 } sys file ssl-cert www.mpsfoodservice.org-2018.crt { certificate-key-size 2048 checksum SHA1:2033:86dc10c0f3333f1e20b1b889b4f0776276192316 create-time 2014-01-07:09:34:06 created-by root expiration-date 1516319999 expiration-string "Jan 18 23:59:59 2018 GMT" issuer "CN=Network Solutions Certificate Authority,O=Network Solutions L.L.C.,C=US" key-type rsa-public last-update-time 2014-01-07:09:34:06 mode 33188 revision 1 serial-number d3:ff:42:10:4c:64:17:1d:ab:55:cf:d8:78:f8:b2:5d size 2033 subject "CN=www.mpsfoodservice.org,OU=Secure Link SSL,O=EDUCATIONAL SERVICE UNIT 3,street=6949 S. 110th,L=LAVISTA,ST=NE,postalCode=68128,C=US" subject-alternative-name DNS:www.mpsfoodservice.org updated-by root version 3 } sys file ssl-cert www.rundscatering.com.crt { certificate-key-size 2048 checksum SHA1:1793:93e3f29746e0c3ec9bbc2ff510c094ede2bb9cec create-time 2015-03-06:01:50:27 created-bitory/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2014-08-14:15:32:57 mode 33188 revision 1 serial-number 03:f9:fa:05:d0:ee:bf size 1923 subject "CN=www.traditionscateringcharlotte.com,OU=Domain Control Validated" subject-alternative-name "DNS:traditionscateringcharlotte.com, DNS:www.traditionscateringcharlotte.com" updated-by root version 3 } (END) version 3 } sys file ssl-cert www.mpsfoodservice.org-2018.crt { certificate-key-size 2048 checksum SHA1:2033:86dc10c0f3333f1e20b1b889b4f0776276192316 create-time 2014-01-07:09:34:06 created-by root expiration-date 1516319999 expiration-string "Jan 18 23:59:59 2018 GMT" issuer "CN=Network Solutions Certificate Authority,O=Network Solutions L.L.C.,C=US" key-type rsa-public last-update-time 2014-01-07:09:34:06 mode 33188 revision 1 serial-number d3:ff:42:10:4c:64:17:1d:ab:55:cf:d8:78:f8:b2:5d size 2033 subject "CN=www.mpsfoodservice.org,OU=Secure Link SSL,O=EDUCATIONAL SERVICE UNIT 3,street=6949 S. 110th,L=LAVISTA,ST=NE,postalCode=68128,C=US" subject-alternative-name DNS:www.mpsfoodservice.org updated-by root version 3 } sys file ssl-cert www.rundscatering.com.crt { certificate-key-size 2048 checksum SHA1:1793:93e3f29746e0c3ec9bbc2ff510c094ede2bb9cec create-time 2015-03-06:01:50:27 created-by root expiration-date 1520292248 expiration-string "Mar 5 23:24:08 2018 GMT" issuer "CN=GeoTrust DV SSL CA - G4,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2015-03-06:01:50:27 mode 33188 revision 1 serial-number 54224 size 1793 subject "CN=www.rundscatering.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)15,OU=GT59943157" subject-alternative-name "DNS:rundscatering.com, DNS:www.rundscatering.com" updated-by root version 3 } sys file ssl-cert www.traditionscateringcharlotte.com-2014.crt { certificate-key-size 2048 checksum SHA1:1923:ccb4f7f0d6f5dd51255aa5ced98f6accc1688f6f create-time 2014-08-14:15:32:57 created-by root expiration-date 1439403282 expiration-string "Aug 12 18:14:42 2015 GMT" issuer "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2014-08-14:15:32:57 mode 33188 revision 1 serial-number 03:f9:fa:05:d0:ee:bf size 1923 subject "CN=www.traditionscateringcharlotte.com,OU=Domain Control Validated" subject-alternative-name "DNS:traditionscateringcharlotte.com, DNS:www.traditionscateringcharlotte.com" updated-by root version 3 } (END) version 3 } sys file ssl-cert www.mpsfoodservice.org-2018.crt { certificate-key-size 2048 checksum SHA1:2033:86dc10c0f3333f1e20b1b889b4f0776276192316 create-time 2014-01-07:09:34:06 created-by root expiration-date 1516319999 expiration-string "Jan 18 23:59:59 2018 GMT" issuer "CN=Network Solutions Certificate Authority,O=Network Solutions L.L.C.,C=US" key-type rsa-public last-update-time 2014-01-07:09:34:06 mode 33188 revision 1 serial-number d3:ff:42:10:4c:64:17:1d:ab:55:cf:d8:78:f8:b2:5d size 2033 subject "CN=www.mpsfoodservice.org,OU=Secure Link SSL,O=EDUCATIONAL SERVICE UNIT 3,street=6949 S. 110th,L=LAVISTA,ST=NE,postalCode=68128,C=US" subject-alternative-name DNS:www.mpsfoodservice.org updated-by root version 3 } sys file ssl-cert www.rundscatering.com.crt { certificate-key-size 2048 checksum SHA1:1793:93e3f29746e0c3ec9bbc2ff510c094ede2bb9cec create-time 2015-03-06:01:50:27 created-by root expiration-date 1520292248 expiration-string "Mar 5 23:24:08 2018 GMT" issuer "CN=GeoTrust DV SSL CA - G4,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2015-03-06:01:50:27 mode 33188 revision 1 serial-number 54224 size 1793 subject "CN=www.rundscatering.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)15,OU=GT59943157" subject-alternative-name "DNS:rundscatering.com, DNS:www.rundscatering.com" updated-by root version 3 } sys file ssl-cert www.traditionscateringcharlotte.com-2014.crt { certificate-key-size 2048 checksum SHA1:1923:ccb4f7f0d6f5dd51255aa5ced98f6accc1688f6f create-time 2014-08-14:15:32:57 created-by root expiration-date 1439403282 expiration-string "Aug 12 18:14:42 2015 GMT" issuer "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2014-08-14:15:32:57 mode 33188 revision 1 serial-number 03:f9:fa:05:d0:ee:bf size 1923 subject "CN=www.traditionscateringcharlotte.com,OU=Domain Control Validated" subject-alternative-name "DNS:traditionscateringcharlotte.com, DNS:www.traditionscateringcharlotte.com" updated-by root version 3 } (END) version 3 } sys file ssl-cert www.mpsfoodservice.org-2018.crt { certificate-key-size 2048 checksum SHA1:2033:86dc10c0f3333f1e20b1b889b4f0776276192316 create-time 2014-01-07:09:34:06 created-by root expiration-date 1516319999 expiration-string "Jan 18 23:59:59 2018 GMT" issuer "CN=Network Solutions Certificate Authority,O=Network Solutions L.L.C.,C=US" key-type rsa-public last-update-time 2014-01-07:09:34:06 mode 33188 revision 1 serial-number d3:ff:42:10:4c:64:17:1d:ab:55:cf:d8:78:f8:b2:5d size 2033 subject "CN=www.mpsfoodservice.org,OU=Secure Link SSL,O=EDUCATIONAL SERVICE UNIT 3,street=6949 S. 110th,L=LAVISTA,ST=NE,postalCode=68128,C=US" subject-alternative-name DNS:www.mpsfoodservice.org updated-by root version 3 } sys file ssl-cert www.rundscatering.com.crt { certificate-key-size 2048 checksum SHA1:1793:93e3f29746e0c3ec9bbc2ff510c094ede2bb9cec create-time 2015-03-06:01:50:27 created-bitory/,O=GoDaddy.com, Inc.,L=Scottsdale,ST=Arizona,C=US" key-type rsa-public last-update-time 2014-08-14:15:32:57 mode 33188 revision 1 serial-number 03:f9:fa:05:d0:ee:bf size 1923 subject "CN=www.traditionscateringcharlotte.com,OU=Domain Control Validated" subject-alternative-name "DNS:traditionscateringcharlotte.com, DNS:www.traditionscateringcharlotte.com" updated-by root version 3 } (END) version 3 } sys file ssl-cert www.mpsfoodservice.org-2018.crt { certificate-key-size 2048 checksum SHA1:2033:86dc10c0f3333f1e20b1b889b4f0776276192316 create-time 2014-01-07:09:34:06 created-by root expiration-date 1516319999 expiration-string "Jan 18 23:59:59 2018 GMT" issuer "CN=Network Solutions Certificate Authority,O=Network Solutions L.L.C.,C=US" key-type rsa-public last-update-time 2014-01-07:09:34:06 mode 33188 revision 1 serial-number d3:ff:42:10:4c:64:17:1d:ab:55:cf:d8:78:f8::01:50:27 created-by root expiration-date 1520292248 expiration-string "Mar 5 23:24:08 2018 GMT" issuer "CN=GeoTrust DV SSL CA - G4,OU=Domain Validated SSL,O=GeoTrust Inc.,C=US" key-type rsa-public last-update-time 2015-03-06:01:50:27 mode 33188 revision 1 serial-number 54224 size 1793 subject "CN=www.rundscatering.com,OU=Domain Control Validated - QuickSSL(R) Premium,OU=See www.geotrust.com/resources/cps (c)15,OU=GT59943157" subject-alternative-name "DNS:rundscatering.com, DNS:www.rundscatering.com" updated-by root version 3 } sys file ssl-cert www.traditionscateringcharlotte.com-2014.crt { certificate-key-size 2048 checksum SHA1:1923:ccb4f7f0d6f5dd51255aa5ced98f6accc1688f6f create-time 2014-08-14:15:32:57 created-by root expiration-date 1439403282 expiration-string "Aug 12 18:14:42 2015 GMT" issuer "CN=Go Daddy Secure Certificate Authority - G2,OU=http://certs.godaddy.com/repository/,O=GoDaddy.com, InTraceback (most recent call last):
Cn
2020-12-02T04:05:17.000Z
Even though using a delimiter within a string, without escaping it, is an illegal character, sometimes this still happens and we need to extract a HTML value.
(?<=href=")(.+)(?="(( [a-z]+=)|>))
<a href="/2-In-1-Notebook/Lati-7400-2in1-Ci5-8GB-W10P-3Y-Basic/p/10270085" title="Dell, Lati 7400 2in1/Ci5/8GB/W10P/3Y Basic"> <a href="/2-In-1-Notebook/"U729X-12-5""-FHD-I7-8665U-16GB-SSD-512G/p/10257105"> <a href="/2-In-1-Notebook/"U729X-12-5""-FH D-I7-8665U-16GB-SSD-512G/p/10257105">
Extract Dirty `href` Values in HTML
2021-01-14T11:52:59.000Z
Will only capture patterns matching 4 levels, found at the beginning of a line if /gm tag is used
(^\d{1,2}+\.\d{1,2}\.\d{1,2}\.\d{1,2}$)
qsdf4ghjk dfdf dfd 4fdfd3 d 4444 but not 4444 4444 333 44444.4444 2222 1 2. 3 555 6.6.7 44.5. 4.5.6. 4.5.6.7 44.44.6.4 12.12.12.12 dddd this is a test of 3.4 and 3.4.5 and 3.4.5.6 and 33.44.55.66 hopefully something is learnded. qsdf4ghjk, 2.4.5.6.7 is here but at the beginning lets's put 2.3.5.7 but not 2.4.6.7. No space 2.4.6.7 . 3.5.6.7. 3.3.3 44 3.3.3.3 4.5.6.7.8 and more
Capture subsubsub sections of constitution/bylays
2015-12-25T22:03:45.000Z
Выражения на вебы
[a-zA-Z_]+[a-zA-Z0-9_]*
abc i10n 10abc abcабвгд abc.3
MyRegexOnVeb
2015-10-21T10:27:37.000Z
Charset is: 0 1 2 3 4 5 6 7 8 9 - _ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z a b c d e f g h i j k l m n o p q r s t u v w x y z Rules for string: 1. String can start only with a letter. 2. String can end with a letter or a number. 3. String can NOT start or end with a '-' or '_'. 4. String can be up to 8 characters.
^[A-Za-z][A-Za-z0-9-_]{0,6}[A-Za-z0-9]{0,1}$
aaaa- Aaaaaaaa aAaaaaa1 aaa1aaa1 aaa-aaa1 aaa_aaa1 aa-_1aaa aaaaaaa aaa aaaa aaaaaaa aaaaaaa- aaaaaaa_ 1aaaaaaa -aaaaaaa _aaaaaaa aaaaaaaaa
match 8 character device name with restrictions
2016-02-16T12:38:56.000Z
access[.]log[.]{0,1}[0-9]{0,3}[.]{0,1}[a-z]{0,2}
access.log.100.gz
Apache access.log
2018-09-29T16:01:48.000Z
log aktifitas tif
tif log
log tif
2016-09-07T08:20:10.000Z
Each line in TEXT represents potential input data. The regex is useless so far as my original using assertions neglected the case where required matches occur between double quotes.
\b(\d+)\b
"18775551234" "person" <5551234>, "text, might match an email" <foo@bar.com> "SomeText" "18775551234", "SomeText", "foo@bar.com" <foo@bar.com> "foo@bar.com"
MIME To field possible inputs
2014-04-29T21:59:58.000Z
- search in replace in C# and C++ code
\(*\d\)\)
// this->m_rButtonNewModule->Anchor = static_cast<System::Windows::Forms::AnchorStyles>((System::Windows::Forms::AnchorStyles::Top | System::Windows::Forms::AnchorStyles::Right)); this->m_rButtonNewModule->Location = System::Drawing::Point(463, (103)); this->m_rButtonNewModule->Name = L"m_rButtonNewModule"; this->m_rButtonNewModule->Size = System::Drawing::Size(88, 23); this->m_rButtonNewModule->TabIndex = 4;
Visual Studio coding
2019-07-31T12:53:03.000Z
f
[^a-zA-Z]
hello
f
2015-10-21T06:40:39.000Z
You can match the string starts with // (forward slash)
^\/\/[a-zA-z0-9]
Match URL Starts with //
2015-03-25T06:54:42.000Z
^.*?\bwww.deindesign.de\/de\/designer\b.*?\workspace\b.*?$
https://www.deindesign.de/de/designer/designcases/silikoncase/apple-iphone-6/CT1326#/paymentprocess/101149226/162674402 https://www.deindesign.de/de/designer/designcases/silikoncase/apple-iphone-6/CT1326#/house/101149226/162674402 https://www.deindesign.de/de/designer/designcases/silikoncase/apple-iphone-6/CT1326#/peter/101149226/162674402 https://www.deindesign.de/de/designer/designcases/silikoncase/apple-iphone-6/CT1326#/paymentprocess/101149226/162688402 https://www.deindesign.de/de/designer/designcases/silikoncase/apple-iphone-6/CT1326#/workspace/91732168/ https://www.deindesign.de/de/designer/designcases/silikoncase/apple-iphone-6/CT1326#/workspace/91732163/ https://www.deindesign.de/de/designer/designcases/silikoncase/apple-iphone-6/CT1326#/workspace/91732162/
Workspaces
2016-03-14T14:24:47.000Z
\$\{\$\{([\w-_\[\]]*?)\}\}|\$\{([\w-_\[\]]*?)\}|\$\{(((.*?)\})+)
${${IP}${hi}${hello}${ab${cd}ef}${CUPM_IP}} ${LAST-NA[M]E} ${[BRACKETS]} ${CP_IM} ${b} ${1} ${} ${LAST-NAM[E]} ${12} ${34}${56} ${[BRACKETS]} hello test b ${hg ${$} ${hello word} ${12-34_ab%} ${hg ${$}} ${${hi}}
Combined Regex
2015-08-21T22:13:23.000Z
Insert GROUP BY statement for parameter (if there is no "GROUP BY" yet)
(.+?)((?:\s\w+\.){0,}\[{0,}`Тип заканчивания`\]{0,})(.+)
SELECT `Тип заканчивания`, `Дата ввода` FROM [DeleteMe8$A1:B21]
js sql Group by parameter (first groupby)
2018-11-22T04:13:09.000Z
(?i)^.*\.(.*\.[a-z]{0,3})|(?i)([a-z]{0,3}\..*\.[a-z]{0,3}|.*\.[a-z]{0,3})$$
ch.iqos.com discoveriqos.com faramentol.ro foodhouse.md futurosinhumo.com ganaconpmi.com getinfo.kr heatnotburn.se iqommunity.ro iqosclub.cz iqosclub.sk iqosclubcanarias.com iqosempfehlen.at iqositalia.it iqosphere.jp iqossvc.kr iqosveda.cz iqosveda.sk newcreations.kr prohibicionmentolado2020.es proibicao-mentol2020.pt qreator.ro referiqosmy.com shareiqos.ch timeforchanges.ch tryiqos.kr unsmoke.de iqostravel.com iqostage.jp iqos-register.jp mystartapp.org iqosclub.ch dimensions.kz www.tryiqos.ru www.timeforchanges.ch www.testiqos.ch readmodel.m.sogou.com www.shareiqos.ch
Catch Hostname
2020-10-16T09:09:42.000Z
\d: (?!<)[^\n]+(?:\n .*)*
1: lo: <LOOPBACK,UP,LOWER_UP> mtu 65536 qdisc noqueue qlen 1 link/loopback 00:00:00:00:00:00 brd 00:00:00:00:00:00 inet 127.0.0.1/8 scope host lo valid_lft forever preferred_lft forever inet6 ::1/128 scope host valid_lft forever preferred_lft forever 2: lan1: <BROADCAST,MULTICAST,UP,LOWER_UP8000> mtu 1500 qdisc mq qlen 1000 link/ether 00:60:e0:6a:48:26 brd ff:ff:ff:ff:ff:ff inet 10.32.39.55/24 brd 10.32.39.255 scope global lan1 valid_lft forever preferred_lft forever 3: lan2: <BROADCAST,MULTICAST,UP,LOWER_UP8000> mtu 1500 qdisc mq qlen 1000 link/ether 00:60:e0:6a:48:27 brd ff:ff:ff:ff:ff:ff inet 192.168.90.1/20 brd 192.168.95.255 scope global lan2 valid_lft forever preferred_lft forever 4: sit0@NONE: <NOARP> mtu 1480 qdisc noop qlen 1 link/sit 0.0.0.0 brd 0.0.0.0 6: wwp0s29u1u3i12: <BROADCAST,MULTICAST,NOARP,UP,LOWER_UP> mtu 1500 qdisc pfifo_fast qlen 1000 link/ether 00:00:11:12:13:14 brd ff:ff:ff:ff:ff:ff inet 172.16.224.124/16 brd 172.16.255.255 scope global wwp0s29u1u3i12 valid_lft forever preferred_lft forever
Split output of $(ip addr) into individual interfaces
2018-06-05T20:37:08.000Z
(\`\`\`\{r \')([A-Za-z0-9-\s]+)
```{r '2b - Possible causes for discrepancy'}
RMarkdown - Add Bold titles to code chunks
2017-10-26T20:35:37.000Z
matches href, title, innerhtml
<a.+?\s*href\s*=\s*["\']?([^"\'\s>]+)["\']\s*title=["\'](\w+)["\']\s*[>](\w*)[<]?
<a href="/test" title="da">test</a> <a href="/test2" title="adwa">test2</a>
Href parse
2016-02-21T21:05:24.000Z
match a specific method name match a quoted double value for method parameter 1 match a quoted, specific string value for method parameter 2
^isCellValueEqualTo\(('[0-9]+\.[0-9]+'), ('CashValue')\);$
isCellValueEqualTo('100.00', 'CashValue');
matching+backreferencing method parameters
2016-05-30T08:51:33.000Z
(?i)(?=^[^-]+[^-]+)^[a-z0-9][a-z0-9- ]+?[a-z0-9]$
23--3q
Zipcode Mundial
2015-06-03T16:16:52.000Z
Matches 2 groups - pathname and file basename, and will exclude anything on the end of the line that is not properly escaped.
(\/.*?\/)([^\/](?:[^\/]|\\\/)+?)(?:(?<!\\)\s|$)
Match Linux File basename and pathname
2015-03-12T11:09:35.000Z
Esa expresion regular busca los href y les reemplazar el atributo por un asset()
href="(.+?)(\.css).*?"
<link rel="stylesheet" type="text/css" href="css/site_global.css?366877458"/> <link rel="stylesheet" type="text/css" href="css/master_trimestre.css?4021764086"/> <link rel="stylesheet" type="text/css" href="css/eltrimestre.css?3970103658" id="pagesheet"/>
Pasando carga de estilos css a twig
2014-11-05T12:39:46.000Z
([\\]+')
echo \'shubham' 'shubham'' echo "pwd\"; ls" echo "ls\'; ls" echo 'ls\"; ls"' echo '[]' grep '[]' echo $'hello \\'' ; ls echo 'hello \\'' ;ls' echo 'ls\"; ls"\' echo \'Shubham\' '\"shubham' echo 'shubham' 'shubham'' echo "pwd\"; ls" echo "ls'; ls" echo 'ls\"; ls"' echo '[]' grep '[]' echo $'hello '' ; ls echo 'hello '' ;ls' echo 'ls\"; ls"' echo 'Shubham' '\"shubham'
Find single/multiple escape quote string
2020-06-04T17:50:23.000Z
Parses the problem input for Advent of Code Day 6 into useful capture groups. http://adventofcode.com/day/6
^((?:turn (?:on|off))|toggle) (\d+),(\d+) through (\d+),(\d+)$
turn off 0,0 through 999,999
Advent of Code Day 6
2016-01-01T21:52:18.000Z
(\(([a-zA-Z0-9]+)\.([a-zA-Z0-9]+)\))
2312 (defaultLoan.LoanNumber) asdfasdf (n.3)
n.x
2015-11-11T00:14:23.000Z
product_groups:\((.*)+\)
product_groups:("refka" "refka-ilkbahar-yaz")
product_groups
2016-04-12T11:26:28.000Z
Try4
"video_title":"Chubby soccer mom sucking my cock during her sons game","defaultQuality":[480,240,720,1080],"vcServerUrl":"/svvt/add?stype=svv&svalue=144220772&snonce=3k67cq1v75q08d5h&skey=d54d83fdbca0384744bb27bf56d0c39f74e6b2e5e4490f7d05a4773cd9cafc9d&stime=1533904546","mediaDefinitions":[{"defaultQuality":false,"format":"","quality":"720","videoUrl":"https:\/\/cm.phncdn.com\/videos\/201712\/06\/144220772\/720P_1500K_144220772.mp4?a5dcae8e1adc0bdaed975f0d67fb5e0527c20903c5bb57a6cad7e6cb50bc41fbb1152c24e90ee00089707faf83a48b0631cd7479dffc2060a6d86c67ff7a531018f946c76d7a90223ed0660403e56d48f38587e8865385eee2ba6800345b3564d8e27cbebdbf1c324d3092a7a31c91a9f705b96ae23e990ed71f6929"},{"defaultQuality":true,"format":"","quality":"480","videoUrl":"https:\/\/cm.phncdn.com\/videos\/201712\/06\/144220772\/480P_600K_144220772.mp4?a5dcae8e1adc0bdaed975f0d61fb5e05756dc4acc488d2f9e61ef33953093512602c6cb1feb47ccb32fd98cd23c755b8cdbf7a9890d664e602723582b30988133baddbeb83ade964edb9de64d8e1637aaa565ddbe42bb3ee112441b08ff97869c450ddf0887175b8162a539a64c6da6c65beaf7340cc19259733"},{"defaultQuality":false,"format":"","quality":"240","videoUrl":"https:\/\/cm.phncdn.com\/videos\/201712\/06\/144220772\/240P_400K_144220772.mp4?a5dcae8e1adc0bdaed975f0d61fb5e05756dc4acc488d2f9e61ef33953093512602c6cb1feb47ccb32fd98cd23c755b8cdbf7a9890d664e05ed88854c611d6e4cf8640f121d46bf195f87aad88d2bc49b870c397aaaf3740ddd4338b880b870d748a26177f0387df5c90111ecbb530b2d75e19578fb83ff8f1dc
Try5
2018-08-10T12:38:08.000Z
(country=).*?(;|$)
/uk/flights/results/country=BG;from-city=Kiev;from=IEV,KBP;to=BOJ,PDV,SOF,VAR;dates=2018-07-15,2018-07-29/
Распаарсить строку
2018-07-08T11:51:32.000Z
Log: Bluecoat Event Type: Upstream Ref to Json: "Sources/Bluecoat/ipv4-2
".*\s(\d{1,3}\.\d{1,3}\.\d{1,3}\.\d{1,3})\s\d+?\s\d+?\s
# Bluecoat UPSTREAM Logs 2016-08-31 00:02:54 18 172.25.21.173 - - - OBSERVED "Non-Viewable/Infrastructure" - 200 TCP_HIT GET application/ocsp-response http sr.symcd.com 80 /MFYwVKADAgEAME0wSzBJMAkGBSsOAwIaBQAEFHQkFGcGn%2FXgmD9ePhproGUqVBV1BBQBWavn3ToLWaZkY9bPIAdX1ZHnagIQUufCRVii4D52%2B1NnK%2BL%2Fmg%3D%3D - - "ocspd/1.0.3" 10.222.157.10 1957 316 - 2016-08-31 00:02:54 18 172.25.19.32 - - policy_denied DENIED "Chat (IM)/SMS;Content Servers" http://im.qq.com/mobileqq 403 TCP_DENIED GET - http 203.205.144.22 80 /gchatpic_new/99787480/2125162524-3194779440-DD292643C193D85264F13026ED37A996/198 ?vuin=15929133&term=3&pictype=1003&cldver=6.5.0.443&rf=aio&msgTime=1472601651 - "QQ/6.5.0.443 CFNetwork/758.3.15 Darwin/15.4.0" 10.222.157.10 1185 421 - 2016-08-31 00:02:54 199 172.25.26.70 - - - OBSERVED "Technology/Internet" - 200 TCP_NC_MISS POST application/json;charset=utf-8 http d.applovin.com 80 /device ?device_token=MaznYs97JTiqaqEwnZGZ5u0SoeBtsuRonBn0BJmm3q8hGZZkZ8TWjSHReUJMpRCoo6knaop8PaTY2Hg-vnNcBg34k9zTsGFYDOM6zvxdBDIykMF76uM-xuc_Km4oV6e5uf6-S_X6wDyE1kpriXzu5FBhmSNn4-E-PXKNuJvyqQM= - "Dalvik/1.6.0 (Linux; U; Android 4.4.2; HTC One_E8 Build/KOT49H)" 10.222.157.10 791 1227 -
Bluecoat Upstream ipv4-2
2016-08-31T01:57:55.000Z
get lowercase letters
(?:^|\s)[a-z]
sdagdsagdsag gsdagdsag dsgdsagdsgsdg .. gsdag1021lrnmf.sd gsdagdsag dgasdgsdg g sdgsdag sadg s 124145 25 3 3 3 bfdhgdfh hfd df hhf fhffd hdhfdh fhdhfd h fdsfhdsfhdfh ffd2 3223 222232G pl, n..g dfa g ahg dafopuiqop.
get lowercase letters
2016-03-14T12:52:45.000Z
[^[\w.]+@(\w)+\.[\w.]+$]
lorenzo@com.c
email regex
2016-05-20T17:31:16.000Z
^\s*[^#]
#aaa
BASH comments with space preceeding
2016-08-13T22:10:30.000Z
(<Reference Include=")(DevExpress\.\D+\.v14\.1)(, Version=14\.1\.10\.0, Culture=neutral, PublicKeyToken=\S+, processorArchitecture=MSIL">)[\r\n\s]*(<SpecificVersion>False<\/SpecificVersion>)[\r\n\s]*(<\/Reference>)
<Reference Include="DevExpress.Data.v14.1, Version=14.1.10.0, Culture=neutral, PublicKeyToken=b88d1754d700e49a, processorArchitecture=MSIL"> <SpecificVersion>False</SpecificVersion> </Reference>
add hint path to csproj references
2015-06-26T05:39:15.000Z
Trying to get in between ><
\>(.*?)\<
<div>PowerEdge R830&nbsp;</div><div>PowerEdge R830 Server<span class="Apple-tab-span" style="white-space:pre"> </span>PER830<span class="Apple-tab-span" style="white-space:pre"> </span>[210-AIBO] [329-BCZO]<span class="Apple-tab-span" style="white-space:pre"> </span>1</div><div>Hardware Support Services&nbsp;</div><div>3 Years ProSupport Plus Next Business Day Onsite Service<span class="Apple-tab-span" style="white-space:pre"> </span>PPN3<span class="Apple-tab-span" style="white-space:pre"> </span>[810-0421] [810-0503] [810-0517] [951-2015]<span class="Apple-tab-span" style="white-space:pre"> </span>29</div><div>Shipping Information&nbsp;</div><div>US No Canada Ship Charge<span cl
Regex HTML
2016-09-23T17:16:30.000Z
extract file name from URL
^.*\/(.*)\.(.*)\?.*$
http://domen.com/folder/file.ext?a=b
extract file name from URL
2015-11-03T17:53:26.000Z
OmegaT exercises
\d+
7,673,656.87 427,870.27 7,401.38 102,393.11 2,340,692.03 2,093,675.04
OmegaT exercises
2021-05-09T18:23:35.000Z
\bcontainer\W+(?:\w+\W+){1,6}?switcher\b
<ul class="secondary"> <li><a href="/all/">all code snippets</a>/</li> <li><a href="/popular/">popular code snippets</a>/</li> <li><a href="/yours/">your code snippets</a></li> </ul> </li> <li class="developer"> <a href="/developer/">extras</a> </li> <li class="blog"><a href="/blog/">blog</a></li> <li class="about"><a href="/about/">about snipplr</a></li> </ul> </div> </div> </div> <div id="subnav"> <div class="container"> <div id="switcher"> <span>Change style:</span> <ul> <li><a class="styleswitch" href="#" onclick="setActiveStyleSheet('big'); return false;">Big</a> / </li> <li><a class="styleswitch" href="#" onclick="setActiveStyleSheet('small'); return false;">Small</a></li>
proximity search
2018-12-06T01:16:14.000Z
Same temperature measurement extraction example but this time using grouping such that we can choose only the positive measurements before September 10
^([a-zA-Z]+) ?([1-9]+)[, ]*[0-9]{,2}:[0-9]{,2}[^,]+, ?T=([-0-9]+)degr?
# Measurements started Sep 9, 9:05, T=22deg SEP 9, 10:15, T=25deg # Taking a coffee break Sep 9, 11:15, T=-10deg # Weekend Sept 12, 09:00AM, T=32deg Oct12 13:00, T=32degr
DS_W2_L1_grouping
2021-02-16T09:36:01.000Z
(id|key|secret|password)( = |": ")(?P<value>.[^"^\n]+)
[DEFAULT] debug = true smtp_server = localhost error_email_from = paste@localhost # issuer domain name for use with MFA mfa_issuer = portal.some.com okta_domain = https://bad.example.com okta_client_id = key_to_password.com okta_client_secret = bad.example.com okta_oidc_audience = bad.example.com okta_authorization_server_metadata_uri = https://truportal.com ld_user = {"key": "dev@truveris.com"} ld_sdk_key = sdk-asjsasf-f32f2ef-f23cx-323r23r2d3 [server:main] use = egg:my_keyPaste#http host = 127.0.0.1 port = 5000 [app:main] use = egg:password full_stack = true static_files = true zip_path = 7z tmp_path = /tmp local_nets = 127.0.0.1 ::1 wkhtmltopdf_path = wkhtmltopdf gs_path = gs openssl_path = openssl gzip_path = gzip default_domain_name = localhost:5000 # used to send exception events to graphite hostname = localhost send_events_to_graphite = false graphite.username = username graphite.password = pass1234 [handler_console] class = StreamHandler args = (sys.stderr,) level = NOTSET formatter = generic [formatter_generic] format = %(asctime)s,%(msecs)03d %(levelname)-5.5s [%(name)s] [%(threadName)s] %(message)s datefmt = %H:%M:%S
match secrets in config file with one exp with 3 groups
2021-03-10T07:40:47.000Z
Check for correctly formatted array of this type: array(1,2,3,)
^a:\d+:{(i:\d+;)+}$
Array formating
2015-01-13T15:41:57.000Z
Match nth occurence of the patterns in the inner parenthesis. Put nth that you want to match in the curly braces (here, {3}).
(?:.*?(Constr1)+){3}.*?((Constr1)+)
public class Constr1 { private int a; public Constr1 () { Constr1 Constr1 Constr1 //super(); a = 1; //super(); } }
Match nth occurence of pattern
2015-05-01T17:34:42.000Z
\s(\w*)Command\.Register\((([\S]*,([^;\n\r])*)+)typeof\((.*)Values\)\);
public static readonly SimpleCommand ReadTemperatureCommand = SimpleCommand.Register(ReadTemperatureCommandId, "ReadTemperature", "showtemp.py", "", 5, typeof(TemperatureListCommandResultProcessor), typeof(TemperatureListDeviceValues)); public static readonly SimpleCommand GetDataType1Command = SimpleCommand.Register( GetDataType1CommandTypeId, "GetData", "HttpClient2.py", @"""/data/ajax.txt?CAN=1&HASH=00200403&TYPE=1"" ""GET"" """"", 5, typeof(SunwaysSolarInverterDataType1CommandResultProcessor), typeof(SunwaysSolarInverterDeviceValues)); public static readonly ArgumentedCommand UpdateAsyncCommandsCommand = ArgumentedCommand.Register( UpdateAsyncCommandsCommandId, "UpdateAsyncCommands", "UpdateAsyncCommands.py", "", 5, UpdateAsyncCommandsCreateArguments, new[] { typeof(AsynchronousCommand[]) }, typeof(UpdateAsyncCommandsCommandResultProcessor), typeof(GridboxCommunicationObjectValues)); public static readonly SimpleDynamicObjectAttribute<bool> AsynchronousCommandsChangedProperty = SimpleDynamicObjectAttribute<bool>.Register("AsynchronousCommandsChanged", false, typeof(BusyGridObjectValues), false, false); public static readonly SimpleDynamicObjectAttribute<string> MailProperty = SimpleDynamicObjectAttribute<string>.Register("Mail", typeof(DefaultUserValues)); public static readonly ProtectedSimpleDynamicObjectAttribute<int> PasswordStorageMethodVersionProperty = ProtectedSimpleDynamicObjectAttribute<int>.Register("PasswordStorageMethodVersion", 2, typeof(DefaultUserValues)); public static readonly ListSetDynamicObjectAttribute<string> LocalIpNetworksProperty = ListSetDynamicObjectAttribute<string>.Register("LocalIpNetworks", typeof(GridboxCommunicationObjectValues)); public static readonly DictionaryDynamicObjectAttribute<Guid, GridObjectTypeContentFilter> ContentFiltersProperty = DictionaryDynamicObjectAttribute<Guid, GridObjectTypeContentFilter>.Register("ContentFilters", typeof(DefaultContentFilterValues)); public static readonly StrongGridObjectReference ContentFilterListContentFilterIdProperty = StrongGridObjectReference.Register("ContentFilterListContentFilterId", new Guid("ce06d088-1b5e-4cab-98d2-b0fd63bc0d5b"), typeof(ContentFilterValues)); public static readonly GridObjectReference ContentFilterListContentFilterIdProperty = GridObjectReference.Register("ContentFilterListContentFilterId", new Guid("ce06d088-1b5e-4cab-98d2-b0fd63bc0d5b"), typeof(ContentFilterValues)); public static readonly GridObjectReference ContentFilterListContentFilterIdProperty = GridObjectReference.Register("ContentFilterListContentFilterId", new Guid("ce06d088-1b5e-4cab-98d2-b0fd63bc0d5b"), typeof(ContentFilterValues)); public static readonly GridObjectReferenceList PermissionIdsProperty = GridObjectReferenceList.Register("PermissionIds", typeof(DefaultRoleValues));
Temp
2015-09-23T11:50:31.000Z
Ajout du controle devis ou intervention
(?:.*?;){6}(?'champs1'.*?);"(?'champs2'.*?)";(?:.*?;){6}"(?'champs5'.*?)";(?:.*?;)"(?'champs4'.*?)";"(?'champs3'.*?)";
"I01.00.00";"005291";"CG45";"15085";"cnt_ext";"1905151405";181349;"CE_11";"DYER Isabelle";"02 38 25 40 72";003;"Non";"site_ext";"COLLEGE VAL DE LOIRE";"SIT_036";"COLLEGE VAL DE LOIRE";"[Dem : 1905151405] DYSFONCTIONNEMENT PORTE EXTERIEURE PRES DE LA SALLE";"28/05/2019 00:00";"CASTELLI Olivier";"02 38 49 20 00";"";"olivier.castelli1@ac-orleans-tours.fr";"28/05/2019 00:00";0;"r�soudre le dysfonctionnement de la porte ext�rieure � proximit� de la salle polyvalente. K151405"
CD45 (keepparam)
2019-07-31T15:15:43.000Z
break down a url to it's components
^(?:(?'protocol'[a-z]{2,}(?=[:])):)?(?:\/\/)?(?:(?'subdomain'(?:[0-9a-z](?![\-\.]))+(?:[0-9a-z\-\.][0-9a-z]+)+?)\.(?'domain'(?:[0-9a-z](?![\-]))+(?:[0-9a-z\-][0-9a-z])\.(?'tld'[a-z]{2,}(?:\.[a-z]{2})?))|(?'ip'(?'segment'[01][0-9][0-9]|2[0-4][0-9]|25[0-5]|[0-9])\.(?&segment)\.(?&segment)\.(?&segment)))(?:\:(?'port'\d+))?(?'path'(?:\/[^\/\?]*?)*)?(?:\?(?'query'[^#]*))?(?:#!?(?'hash'.*))?$
ftp://regex101.billy.com.uk:3000/test/blah?hello=blah&#!/blah/blue/green https://192.168.1.1/test/lab
url tokenizer
2016-01-17T06:54:15.000Z
(([0-2][0-9]|3[0-1])([0][0-9]|[1][0-2])(19|20[0-9][0-9]))[.]zip
09062015.zip
Valid date ddMMyyyy + .zip extension
2015-06-09T00:44:32.000Z
class="([^"]*)
class="a
auto-complete
2016-05-29T22:55:43.000Z
if \(([^\$]+\$\<\>[^ ]+)[^\}]+\(null, ([^;]+)\);\s+}\s+([^;]+)\1(.*;)
get { int num; lock (this.queueLock) { if (Journal.CS$<>9__CachedAnonymousMethodDelegate7 == null) { Journal.CS$<>9__CachedAnonymousMethodDelegate7 = new Func<ApiBlob, int>(null, (ApiBlob blob) => Encoding.UTF8.GetByteCount(blob.DataString)); } num = this.Sum<ApiBlob>(Journal.CS$<>9__CachedAnonymousMethodDelegate7); } return num; } }
Replace anonymous actions
2015-06-03T09:19:44.000Z
\S*rgo1\S*\.html
file.html test string something filergo1something.html ergo1.html some more text rgo1.html fileergo1.html file.html test text f_ergo1-ss.html test
files containing [rgo1] ending [.html]
2018-05-10T23:55:05.000Z
(http[s]?:\/\/)?([^\/\s]+\/)(.*)
http://video.google.co.uk:80/videoplay?docid=-7246927612831078230&hl=en#hello
Matching url
2014-08-19T08:52:25.000Z
Matches any mathematically correct decimal number which is not formatted.
^[+-]?\d*\.?\d+$
Unformatted Decimal number
2022-08-16T17:35:31.000Z
Match a MasterCard with new range for 2017: 51-55 and 2221-2720 @incarnated
(^5[1-5][0-9]{14}$)|(^2221[0-9]{12}$)|(^222[2-9][0-9]{12}$)|(^22[3-9][0-9]{13}$)|(^2[3-6][0-9]{14}$)|(^2720[0-9]{12}$)|(^27[0-1][0-9]{13}$)
5454545454545454
MasterCard validate 2017
2016-03-22T03:14:53.000Z