Datasets:

BEE-spoke-data

/

wikipedia-20230901.en-deduped

like 3

55638775

https://en.wikipedia.org/wiki/Zieria%20veronicea

Zieria veronicea

Zieria veronicea, commonly known as the pink zieria, is a plant in the citrus family Rutaceae and is endemic to south-eastern Australia. It is a small, lemon-scented shrub densely covered with velvety hairs. Up to three flowers with four pink petals appear in leaf axils in late spring. Description Zieria veronicea is a lemon-scented shrub which grows to a height of . Most parts of the plants are densely covered with star-like hairs making its surfaces velvety. Unlike most other zierias, this species has simple, rather than clover-like leaves. The leaves are long and wide with the upper surface light green and the lower one greyish green. The edges of the leaves turn down or are rolled under. The petiole is less than long. The flowers are arranged singly or in groups of three in leaf axils, the groups shorter than the leaves. The four sepals are narrow lance-shaped, long, pointed and densely velvety-hairy. The four petals are pink, sometimes white, and overlap each other in the bud stage. There are four stamens. Taxonomy and naming Pink zieria was first formally described in 1854 by Ferdinand von Mueller who gave it the name Boronia veronicea and published the description in Transactions of the Philosophical Society of Victoria. In 1863, George Bentham changed the name to Zieria veronicea. Mueller did not give a reason for the specific epithet (veronicea). There are two subspecies - Zieria veronicea subsp. veronicea and Zieria veronicea subsp. insularis J.A.Armstr. which only occurs on Kangaroo Island. Distribution and habitat Zieria veronicea is most common in Victoria where it grows in sandy mallee and mallee heath in the western part of the state and near the Gippsland Lakes. It is also found in the south-east of South Australia and in eastern Tasmania where it grows in heath or heathy woodland. Conservation Zieria veronicea is classified as "Endangered" under the Tasmanian Government Threatened Species Protection Act 1995. Fewer than 200 plants are known from that state, where the main threats are land clearance and inappropriate fire regimes. References External links veronicea Sapindales of Australia Flora of New South Wales Plants described in 1863 Endemic flora of Australia Taxa named by Ferdinand von Mueller

45223530

https://en.wikipedia.org/wiki/James%20Bettcher

James Bettcher

James Bettcher (born May 27, 1978) is an American football coach who is the linebackers coach for the Cincinnati Bengals of the National Football League (NFL). He previously served as the defensive coordinator for the Arizona Cardinals and New York Giants. Coaching career College Bettcher began his coaching career in 2004 as special teams coordinator & defensive line coach for Saint Francis (IN). He then served as a graduate assistant for Bowling Green, before holding positions for North Carolina, Ball State and New Hampshire. NFL After coaching at numerous colleges, Bettcher was hired by the Indianapolis Colts of the NFL. He coached under Bruce Arians when Arians was interim head coach of the Colts. When Arians was hired by the Cardinals as head coach, Bettcher followed him to Arizona. After defensive coordinator Todd Bowles left to become head coach of the New York Jets, Bettcher was promoted to take his place. As defensive coordinator the Cardinals never finished below 7tg in the league in overall defense. After the retirement of head coach Bruce Arians, Bettcher was seen as the most likely successor, even bringing in a plan for a coaching staff that included Mike McCoy as offensive coordinator and Chuck Pagano as defensive coordinator. However, the Cardinals opted to hire former Carolina Panthers defensive coordinator, Steve Wilks, instead. On January 23, 2018, Bettcher was hired by the New York Giants to serve as defensive coordinator under head coach Pat Shurmur. Betcher was not retained for the 2020 season by new Giants head coach Joe Judge who instead hired Patrick Graham. In 2021 he was hired by the San Francisco 49ers as a defensive assistant. References External links New York Giants bio 1978 births Living people Indianapolis Colts coaches Arizona Cardinals coaches Saint Francis Cougars football coaches National Football League defensive coordinators New York Giants coaches Bowling Green Falcons football coaches North Carolina Tar Heels football coaches Ball State Cardinals football coaches New Hampshire Wildcats football coaches Cincinnati Bengals coaches

74407554

https://en.wikipedia.org/wiki/Final%20Form%20%28disambiguation%29

Final Form (disambiguation)

Final form is a special character used to represent a letter only when it occurs at the end of a word. Final Form may also refer to: Final Form (song), a 2019 song by Sampa the Great Final Form (Lil Yachty song), a 2021 song by Lil Yachty Final Form (As Friends Rust song), a 2023 song by As Friends Rust Final Form (video game), a video game

4670626

https://en.wikipedia.org/wiki/Indiantown%20Road

Indiantown Road

Indiantown Road is a east–west road connecting inner Palm Beach County, with Florida's Turnpike, Interstate 95, and U.S. Route 1 in Jupiter, Florida. The road was formerly entirely designated as State Road 706 (SR 706), but majority of it has been transferred to local jurisdiction and is signed as County Road 706 (CR 706). Route description West of Jupiter Indiantown Road begins at an intersection with the Bee-Line Highway (SR 710) in the middle of the wetlands in northwest Palm Beach County, approximately east of Indiantown and roughly six miles from the site of the fake "ghost town" of Apix. It proceeds east with the CR 706 designation as a two-lane road with a speed limit of with wetlands on either side. east, Indiantown Road comes to an intersection with Pratt Whitney Road, which itself is County Road 711 and formerly SR 711. As the road enters more civilization, it widens to become a divided boulevard with two lanes in each direction. It is not until an intersection with the Florida's Turnpike ramps that the road becomes three lanes in each direction and the speed limit decreases. Jupiter State Road 706 begins at the interchange between Florida's Turnpike and Indiantown Road in Jupiter, with SR 706 heading east, with the interchange with Interstate 95 from the Turnpike. East of I-95, Indiantown Road becomes a commercial road from here to the eastern terminus. It has intersections with Central Boulevard and Center Street, major roads in the town of Jupiter, along with county road Alternate A1A. Continuing east, it has a junction with Military Trail, followed by SR 811 in central Jupiter. The road then crosses a major drawbridge over the Intracoastal Waterway, and then intersects with US 1. Indiantown Road continues east under county maintenance (as CR 706) to County Road A1A, though this section of Indiantown Road is erroneously signed as "to SR A1A." History Originally, SR 706 spanned from Bee Line Highway (SR 710) near Indiantown to its present eastern terminus. In the mid-1970s, Florida Department of Transportation downgraded the section west of the Turnpike to secondary status (and placed "S" stickers on the SR 706 signs), starting a sequence of events that started the reversion of the western segment to county control. This was part of a large set of transformations that particularly affected Florida south of State Road 70. While SR 706 was primarily a rural road as recently as the 1980s, the region has become urbanized in recent years as the population growth of Florida Gold Coast and nearby Treasure Coast has been transforming the Atlantic coast of Florida south of Kennedy Space Center. Major intersections References External links 706 706 706

39721293

https://en.wikipedia.org/wiki/Ibn%20%27Arafa

Ibn 'Arafa

Ibn 'Arafa (), born Mohammed ibn Mohammed ibn Arafa al-Warghammi, in 1316 in Tunis and died in 1401 in the same city, was a Tunisian Imam, the most illustrious representative of Maliki Islam to the Hafsid period. Of Berber origin from south-eastern Tunisia, he had knowledge of law, of grammar, of rhetoric, of mathematics, and of medicine that enabled him to lead the prestigious Al-Zaytuna Mosque and the University of Ez-Zitouna for several years. Staunch defender of Maliki Islam, he did not hesitate to come into direct conflict with several Sufi of his time as the esoteric and religious practices he witnessed were beyond the precepts of Islam and the understanding of the faithful. He also had conflicts with Ibn Khaldun who he suspected had non-religious motives. Khaldun, in turn, accused Ibn Arafa of being jealous of his popularity. As a theologian, Ibn Arafa was a strict and pure Maliki, and a powerful figure especially in Tunisia. He was also the author of numerous books on law, theology, and logic. Such books are stored at Zaytuna, in Tunisia. At his death in 1401, he was buried in Djellaz Cemetery located in the old medina of Tunis, which has been preserved as the oldest historical monument of the state. See also List of Ash'aris and Maturidis References 1316 births 1401 deaths 14th-century Berber people 14th-century imams Asharis Berber Muslims Berber scholars Tunisian imams Tunisian Maliki scholars 14th-century jurists Tunisian Muslim theologians 14th-century people from Ifriqiya

6755906

https://en.wikipedia.org/wiki/Phallus%20in%20Wonderland

Phallus in Wonderland

Phallus in Wonderland is a film by American heavy metal band Gwar, their first attempt at a commercially released, long-form film. The video was nominated for a Grammy in 1993 (which they lost to Annie Lennox for Diva, as mock-mentioned in the 1994 song "Jack the World"). Plot The film opens with a young Gwar fan on a skateboard, who is shocked to learn of the recent theft of front man Oderus Urungus' "Cuttlefish of Cthulhu" (or penis). The fan is then abducted by GWAR via a giant intercontinental fishing hook, and is taken to Gwar's Antarctic stronghold where they are celebrating the birth of Gor-Gor (Crack in the Egg). Band manager Sleazy P. Martini contacts Gwar, telling them to come to New York City to shoot a commercial for Gwar cereal, a cornflake-like food that is sprinkled with crack cocaine rather than sugar, turning kids into addicts (Have You Seen Me?). As the Morality Squad prepares for their attack on Gwar, their religious representative, Father Bohab, is convicted of child molestation and sodomy of a twelve-year-old choirboy. Despite the clear evidence of Bohab's crimes, the Squad feel he was framed by Gwar (particularly Sleazy, who took part in exposing him); he is released and the charges are dropped. While Bohab is picketing against Gwar along with other protestors, Gwar and Sleazy brutally attack the crowd, culminating in the disembowelment of Bohab and him being sodomized with his own cross. Gwar then travel to a nightclub, where they all become wasted on crack (The Road Behind). The next morning, the Cuttlefish of Cthulhu (having escaped the Morality Squad's grasp) reunites with a hungover Oderus, and warns them of the imminent attack by the Morality Squad. Gwar emerge victorious over the Morality Squad (The Morality Squad). Their victory is short-lived; Gor-Gor, having grown to monstrous size, arrives in New York and begins wreaking havoc. Rather than retreat, Gwar battles Gor-Gor in a titanic clash, resulting in the T-Rex's death (Gor-Gor). The final shot of the film reveals the Cuttlefish of Cthulhu happily reunited with Oderus amidst the rubble (Ham on the Bone). Print status Phallus in Wonderland was released on VHS in 1992, and DVD in 1999, but has been out of print in either format since 2002 (some sources give 1994 as the year for the VHS). Metal Blade and Slave Pit both carry the remaining VHS copies, and neither have the DVD. There is some confusion as to who actually owns the rights to this film, with Metal Blade saying that Slave Pit is the owner (and that they are in the re-negotiation process), and Slave Pit stating the opposite. Because of this, copies of both have been hard to find, which has led to cases of people selling them for as much as $120. On January 8, 2008, Metal Blade Records re-released the DVD. Special features include instant scene access, options to play songs only and curtain call. The DVDs come in a variety of colors, such as blue and black, and have a phallus etched onto them. Director aliases "Distortion Wells" is the pseudonym for Bill Morrison, who later directed the music video to "Saddam A Go-Go." "Judas Bullhorn" is Canadian director and musician Blair Dobson. Despite being nominated for a Grammy, neither were ever paid for months of work on the project, and Dobson, after initiating the project between his company and Slave Pit /Metal Blade, left halfway through shooting. In the Bohab Central forums, Mike Bishop (who played Beefcake the Mighty at the time) claimed that this use of outside directors led to serious tension between himself (it was his doing) and Hunter Jackson (the founder of Slave Pit), and was a major factor in his departure the following year. Cultural references In the news report scene where Gor-Gor is approaching New York City, the exasperated newscaster pulls a gun out of an envelope and commits suicide on live television in a manner parodying that of R. Budd Dwyer. Flattus Maximus As with the album America Must Be Destroyed (upon which this film is based), Phallus in Wonderland does not have a distinct Flattus Maximus character. A friend of the band's, named "STRETCH," filled the role for the few scenes in which Flattus appears, and is killed in the "Gor-Gor" video. Track listing "Crack in the Egg" "Have You Seen Me?" "The Road Behind" "The Morality Squad" "Gor-Gor" "Ham on the Bone" (credits) References Gwar video albums 1992 video albums American musical films

44031012

https://en.wikipedia.org/wiki/2014%E2%80%9315%20Serie%20A1%20%28men%27s%20water%20polo%29

2014–15 Serie A1 (men's water polo)

The 2014–15 Serie A1 is the 96th season of the Serie A1, Italy's premier Water polo league. Team information The following 12 clubs compete in the Serie A1 during the 2014–15 season: Regular season Standings Pld - Played; W - Won; D - Drawn; L - Lost; GF - Goals for; GA - Goals against; Diff - Difference; Pts - Points. Schedule and results Championship playoff Teams in bold won the playoff series. Numbers to the left of each team indicate the team's original playoff seeding. Numbers to the right indicate the score of each playoff game. Final 1st leg 2nd leg 3rd leg Pro Recco N.E PN won Championship final series 3–0. 5th – 8th placement Teams in bold won the playoff series. Numbers to the left of each team indicate the team's original playoff seeding. Numbers to the right indicate the score of each playoff game. Season statistics Top goalscorers Updated to games played on 16 May 2015. Number of teams by regions Final standing References External links Italian Water Polo Federaration Seasons in Italian water polo competitions Italy Serie A1 Serie A1 2014 in water polo 2015 in water polo

118264

https://en.wikipedia.org/wiki/Holton%20Township%2C%20Michigan

Holton Township, Michigan

Holton Township is a civil township of Muskegon County in the U.S. state of Michigan. As of the 2000 census, the township population was 2,532. Communities Brunswick is a small unincorporated community in section 13 of the township at on M-120 at the eastern boundary with section 18 of Sheridan Township in Newaygo County. It was founded about 1875 as the point where the stage coach road met the Pere Marquette Railway line between Muskegon and White Cloud. Passengers and mail were taken north from here to Hesperia. The settlement was first called "County Line" and later "Marionville", after the first postmaster, Isaac Marion. However, the post office, established May 1881, was called "Dash." It was renamed Brunswick, Muskegon County in September 1897 and transferred to Newaygo County in April 1943. Originally there was a feed store in the community for farmers, and in the rear of that building there was a small post office. Both have since closed, and it is now served by the post office in neighboring Holton. St. Michaels Catholic Church and cemetery are located there. The community is located at the end of Brunswick Road. While the CSX rail line still runs through the town, train station has closed. Holton is a small unincorporated community at the corners of sections 22, 23, 26 and 27 of the township at about 15 miles northeast of Muskegon and about 15 miles east of Lake Michigan. Holton was platted in 1871 and named for Henry H. Holt, a Muskegon County delegate to the State Constitutional Convention of 1867 and later Lieutenant Governor of Michigan, 1873–76. He donated the bell to the local Methodist Church. A post office was established in February 1872. The Holton ZIP code, 49425, serves most of the township as well as the southwest corner of Sheridan Township on the east, the northwest corner of Bridgeton Township on the southeast, the northern part of Cedar Creek Township on the south, portions of Easter and northeastern Blue Lake Township on the west, the southeast corner of Otto Township on the northwest, and the southern portion of Greenwood Township on the north. The city of Fremont is to the east and the Fremont ZIP code, 49412, serves the northeastern corner of the township. Twin Lake is an unincorporated community to the southwest. The Twin Lake ZIP code, 49457, serves the southwest corner of the township. Education In 2000, Holton was one of only seven school districts in the state of Michigan that would have been eligible for private school vouchers, on which there was a statewide referendum that year. Most residents were opposed to the measure, since they did not want competition for the local public school. The measure was defeated in Holton and across the state by about a 2:1 ratio. The main festival of the year, Holton Days, is held in the last weekend of July. The Holton Red Devils have a state title in volleyball in 1994. They were also runner-up in 1993. In baseball they were state runner-up in 2006, losing to #1 state ranked Homer 3–2. Geography According to the United States Census Bureau, the township has a total area of , of which is land and (1.43%) is water. Demographics As of the census of 2000, there were 2,532 people, 903 households, and 682 families residing in the township. The population density was . There were 980 housing units at an average density of . The racial makeup of the township was 96.01% White, 0.43% African American, 1.22% Native American, 0.24% Asian, 0.16% from other races, and 1.94% from two or more races. Hispanic or Latino of any race were 1.78% of the population. There were 903 households, out of which 36.2% had children under the age of 18 living with them, 60.9% were married couples living together, 9.3% had a female householder with no husband present, and 24.4% were non-families. 18.7% of all households were made up of individuals, and 7.3% had someone living alone who was 65 years of age or older. The average household size was 2.80 and the average family size was 3.19. In the township the population was spread out, with 29.9% under the age of 18, 7.3% from 18 to 24, 29.3% from 25 to 44, 23.4% from 45 to 64, and 10.1% who were 65 years of age or older. The median age was 36 years. For every 100 females, there were 110.0 males. For every 100 females age 18 and over, there were 103.9 males. The median income for a household in the township was $37,813, and the median income for a family was $41,637. Males had a median income of $33,333 versus $22,857 for females. The per capita income for the township was $16,210. About 7.1% of families and 9.5% of the population were below the poverty line, including 14.5% of those under age 18 and none of those age 65 or over. References External links Holton Charter Township Website Townships in Muskegon County, Michigan Townships in Michigan

70485230

https://en.wikipedia.org/wiki/Desportivo%20Alian%C3%A7a

Desportivo Aliança

Desportivo Aliança, sometimes known as just Aliança, is a Brazilian football club based in Maceió, Alagoas state. Founded in 2012, the club plays in the Campeonato Alagoano. History Founded on 10 March 2012, Aliança was born after their board bought out Vila Nova, an amateur club from the city of Rio Largo founded in 1990. The club only played their first competition in the following year, appearing in the Campeonato Alagoano Segunda Divisão and playing in Pilar. Aliança played in Coruripe in 2013 and 2014, and did not feature a senior team in 2015 and 2016. The first team returned in 2017, playing in Passo de Camaragibe. In 2020, Aliança was based in Igaci and achieved promotion to the Campeonato Alagoano after winning the second division. Ahead of the 2021 season, the club moved to Maceió. Honours Campeonato Alagoano Segunda Divisão: 2020 References External links Association football clubs established in 2012 Football clubs in Alagoas 2012 establishments in Brazil

5569965

https://en.wikipedia.org/wiki/Aoandon

Aoandon

Aoandon, or Aoandō ( or 青行燈, "blue andon") is a creature illustrated by Toriyama Sekien in his Konjaku Hyakki Shūi. It was meant to represent the spirit that appeared during the game Hyakumonogatari Kaidankai, after the last story was told. The candles in the room during these meetings were often placed in blue-paper andon lamps in order to create an eerie atmosphere, hence this creature's name. It appears as a woman with a blue complexion and twin horns from its brow, and sharp teeth. Popular culture In the mobile game Onmyōji, Aoandon is a shikigami who loves storytelling. The bioluminescent marine worm Polycirrus aoandon is named after the creature. References External links 百鬼図譜「今昔百鬼拾遺霧之巻」あおあんどう (in Japanese) 【青行灯】 (in Japanese) 青行燈（あおあんどん）(in Japanese) Yōkai

63431798

https://en.wikipedia.org/wiki/PA-112%20%28Par%C3%A1%20highway%29

PA-112 (Pará highway)

The PA-112 or Rodovia Dom Eliseu Corolli is a state highway located in the Brazilian state of Pará. This road intersects BR-308 at its northern boundary and BR-316 at its southern boundary. It is located in the northeast region of the state, serving the municipalities of Bragança and Santa Luzia do Pará. References Highways in Pará

9577491

https://en.wikipedia.org/wiki/Lake%20Biwa%20Canal

Lake Biwa Canal

is a historic waterway in Japan connecting Lake Biwa to the nearby City of Kyoto. Constructed during the Meiji Period the canal was originally designed for the transportation of lake water for drinking, irrigation and industrial purposes, but also provided for the conveyance of waterborne freight and passenger traffic. From 1895 water from the canal supported Japan's first hydroelectric power facility, providing electricity for industry, street lighting and Kyoto's tram system. In 1996 the canal was recognized as a nationally designated Historic Site. While no longer used as a navigable waterway for freight, the waterway continues to provide water for drinking and irrigation purposes to the city of Kyoto as well as hydroelectric power through the 4.5MW Phase III Keage power station. Locations along the canal route and associated irrigation structures such as the former Keage Incline, the Nanzen-ji aqueduct and Philosopher's Walk, have become popular sightseeing destinations. History Following the Meiji Restoration and the subsequent transfer of the capital to Tokyo, the city of Kyoto suffered a decline in commercial activity and a decrease in population. To address this problem, the third Prefectural Governor of Kyoto, , advocated for the construction of a canal from Lake Biwa to provide both water for irrigation and industrial use as well as facilitate transportation of goods by a means of a navigable waterway. The feasibility of an irrigation channel to Kyoto from Lake Biwa had been debated since at least the 17th Century, but written plans and initial survey work for a canal first began in 1873. In 1882, Minami Ichirobe, who had worked with Cornelis Johannes van Doorn on the Asaka Canal in Fukushima Prefecture, was commissioned by the City of Kyoto to make a survey for the route of the proposed Lake Biwa Canal. Minami was supported in his survey work by , a student at the Tokyo-based Imperial College of Engineering. On the basis of his May 1883 graduation thesis, entitled the ‘Lake Biwa Canal Construction Project,’ Tanabe was subsequently hired as the canal project's Chief Engineer. First Canal and Phase I Hydroelectric Power Facility Construction work for the first canal (which went up to the confluence point between Ōtsu and the Kamo River) began in August 1885. Both main and branch canals covering a distance of 6.9 miles (11.2 km) were completed five years later in . On completion the canal passed through two locks, an inclined plane and three tunnels. The whole enterprise was estimated at 1,250,000 silver dollars, paid for by the central government (one quarter), the Meiji Emperor (one third), and local taxes. During construction project Chief Engineer Tanabe visited the United States in 1888 to investigate canal based transportation systems. Although canal based transport for commercial goods was found to be only marginally viable, Tanabe also had the opportunity to observe hydropower projects in Lowell and Holyoke, Massachusetts as well as at Aspen, Colorado. After consulting with North American engineers, the idea of building a power station, fashioned after the Aspen hydroelectric plant and utilizing the high head streams available on the Lake Biwa Canal was put into practice. The first Phase I hydroelectric power station utilizing two 120 HP Pelton turbines and two Edison 80 kW DC generators became operational in August 1891. Subsequent augmentations to the Phase I power station meant that by 1897, 20 turbines were producing 1,760 kW of power through a variety DC and AC generators imported from Siemens of Germany and GE of the United States. In order to make use of the power generated, construction of what was to become Japan's first tram line, the , began in 1895. In 1894 the Kamo River Waterway—started in 1892—was completed, uniting Kamo River and Fushimi ward. Second Canal and Phase II Hydroelectric Power Facility Due to rapidly increasing demand for tap water and electricity, plans were made by Kikujiro Saigo, the second mayor of Kyoto City, for the construction of the second route (Canal No. 2) to be built independent of the first Lake Biwa Canal. Construction work on the second canal was started in October 1908, and was completed in April 1912. With a resulting increase of water intake from 8.3 m3/s to 23.65 m3/s a water treatment plant and upgraded Phase II hydroelectric power plant were also erected. The original Phase I power station was decommissioned, but with the commissioning of the Phase II power station and two additional sub stations, overall generation capacity from the Lake Biwa Canal rose to 6,400 kW by May 1914. Route and Current Usage The waterway runs from the vicinity of Mii-dera in Ōtsu, Shiga to its terminus near Nanzen-ji in Kyoto through a series of tunnels and along concreted irrigation channels around the mountains. Between the two cities, the canal has two principal routes, the and the . Due to the 36 meter difference in elevation between the upstream dam and its terminus, an inclined plane was built, which allowed boats to travel on land via the use of a flat car on which they were placed. Operation of the track gauge incline ceased in 1948, but part of its structure, known as the Keage Incline, has been preserved and is now a tourist attraction, famous for its ornamental cherry trees. Following the development of the railway and road infrastructure, the role of the canal as a means of transportation was largely over by the 1940s. From 2018 however, limited passenger boat traffic returned with the opening of the Lake Biwa Canal Cruise on open portions of the main canal between Keage and Ōtsu. Museum In August 1989 the was established to commemorate the centenary of the opening. The museum reopened after renovation in 2009. See also Biwako Quasi-National Park The 100 Views of Nature in Kansai References Further reading External links Lake Biwa Canal Museum of Kyoto (pamphlet with timeline) The Lake Biwa Canal Museum of Kyoto Setting an Industrial Tourism Route of the Lake Biwa Canal in Keage, Kyoto (TICCIH 2006 Congress paper) Selection of waterways The Lake Biwa Canal Museum of Kyoto (tourist guide) Buildings and structures in Shiga Prefecture Buildings and structures in Kyoto Canals in Japan Buildings of the Meiji period Historic Sites of Japan Transport in Shiga Prefecture Transport in Kyoto

56072730

https://en.wikipedia.org/wiki/Bodo%20Hauser

Bodo Hauser

Bodo Hugo Hauser (23 February 1946 – 22 July 2004) was a German journalist and writer. Life Hauser was born and died in Krefeld. From 1968 to 1972, Hauser studied at the University of Freiburg, the University of Lausanne, and the University of Bonn. Since 1973 Hauser has worked for the German broadcaster ZDF. Together with German journalist Ulrich Kienzle, he was from 1993 to 2000 co-host of the German talk show Hauser and Kienzle on German broadcaster ZDF. Kienzle and Hauser were the "combattants" in the weekly ZDF political magazine Frontal, which always featured a controversial debate between the more leftist Kienzle (usually taking the position of the Social Democratic Party of Germany) and the more rightist Bodo Hauser (usually taking the position of the Christian Democratic Union of Germany). As a writer, Hauser wrote several books. Hauser was married and had two children. Hauser died by medical error. Awards 1996: Bambi Award 1997: Cross of the Order of Merit of the Federal Republic of Germany Works References 1946 births 2004 deaths German male journalists German television journalists 20th-century German journalists German male writers University of Lausanne alumni University of Bonn alumni University of Freiburg alumni Recipients of the Cross of the Order of Merit of the Federal Republic of Germany People from Krefeld ZDF people

28011566

https://en.wikipedia.org/wiki/GM%20Standard%20double-decker%20bus

GM Standard double-decker bus

The GM Standard double-decker bus was a double-decker bus bodywork designed by SELNEC and its successor the Greater Manchester Passenger Transport Executive and built on Leyland Atlantean and Daimler Fleetline chassis. No fewer than 1,815 standards were delivered to SELNEC, Greater Manchester Transport and Lancashire United Transport. A common design is that the bus has its tall lower deck double-curvature windscreen and upper deck double-curvature windscreen with either an arched top or a flat top. See also List of buses External links Museum of Transport, Greater Manchester Buses of the United Kingdom Double-decker buses Step-entrance buses Bus transport in Greater Manchester Vehicles introduced in 1972

44864022

https://en.wikipedia.org/wiki/B.%20Paul%20Thaliath

B. Paul Thaliath

B. Paul Thaliath is an Indian radiation oncologist from the South Indian state of Kerala. He is the additional director of the Regional Cancer Centre and the Head of the Department of Radiation Oncology at Kamla Nehru Memorial Hospital, Prayagraj. He is known to be involved with several cancer awareness programs and has been a part of the Cancer and Women programme in connection with the National Cancer Awareness Day of 2006. Thaliath was honored by the Government of India, in 2007, with the fourth highest Indian civilian award of Padma Shri. See also Oncology References External links Recipients of the Padma Shri in medicine Malayali people Medical doctors from Kerala Indian oncologists 1952 births Living people 20th-century Indian medical doctors

6225762

https://en.wikipedia.org/wiki/Dimos%20Dikoudis

Dimos Dikoudis

Dimosthenis "Dimos" Dikoudis (alternate spellings include: Demosthenis, Demos, Ntikoudis) (; born June 24, 1977, in Larissa, Greece), is a former Greek professional basketball player and basketball executive. He is 2.08 m (6 ft 10 in) tall, and he played as a power forward-center. Dikoudis was inducted into the Greek Basket League Hall of Fame in 2022. Early years Dikoudis started playing football at the age of 10, and later he was involved in Taekwondo. After two years of martial arts, he started playing basketball in his school team. With his school, he won the city championship, which was his first title, and right after that, he joined his first club, Perseas of Larissa. He played there until age 18, and he won four city and state championships there. With this club, he also won a national title, and was a member of the all state team. Professional career In 1995, Dikoudis signed his first contract with Olympia Larissas. He played there for three seasons, one in the semi-professional level Greek National B League, and two in the professional level Greek 2nd Division. He was the leading scorer and leading rebounder in the Greek 2nd Division in both seasons, and the MVP of the Greek 2nd Division in the last season. He was also a member of the Greek Under-21 national team at that time. In 1998, he signed a contract with the top-tier level Greek League club AEK Athens, and he played there for five seasons. As a member of AEK, he won the FIBA Saporta Cup, the Greek League championship, and two Greek Cups. He was voted the Greek League Best Young Player for the 1999–00 season, and the Greek League MVP for the 2001–02 season. In 2003, he decided to leave Greece, and he signed with the Spanish League club Valencia. He played there for a year, and after that, he moved to CSKA Moscow, where he won the Russian Championship and the Russian Cup (the first in the history of the club). With CSKA that season, he played at the Final Four of the EuroLeague, which was held at Moscow, and was won by Maccabi Tel Aviv, which featured another player from Larissa, Nestoras Kommatos (he was a co-player with Dikoudis in Perseas). In 2005, he returned to Valencia, and he played in the finals of the Spanish Cup. In the summer of 2006, he returned to Greece, and signed with Panathinaikos. With Panathinaikos, he won the Triple Crown in the 2006–07 season. In December 2008, he joined Panionios. After joining Panionios, he became one of only two Greek players in history, along with Ioannis Giannoulis, to compete in the EuroLeague with 4 different teams. In July 2009, he moved to Aris Thessaloniki. After seven years, he returned to AEK Athens. In September 2011, he signed a one-year deal with PAOK. National team career With the senior Greece national team, Dikoudis made his debut on November 24, 1999, against the Estonian National Team. As a member of the Greece national team, he played at the 2001 EuroBasket at Turkey, the 2003 EuroBasket at Sweden, and at the 2004 Summer Olympic Games of Athens. On September 25, 2005, he won the gold medal at the 2005 EuroBasket, with the Greece national team. On September 3, 2006, he won the silver medal at the 2006 FIBA World Championship. He played at the 2007 EuroBasket. Managerial career Dikoudis was appointed President of the Panhellenic Association of Paid Basketball Players (P.S.A.K.) in September 2006, with his term of office expiring in October 2010. Dikoudis became the Sports Director of the Greek League club AEK, in 2013. In 2021, he became the Administrative Manager of the senior Greece national team. Career statistics EuroLeague |- | style="text-align:left;"| 2000–01 | style="text-align:left;" rowspan=3| AEK | 17 || 3 || 22.3 || .460 || .250 || .617 || 5.4 || .5 || .7 || .3 || 8.6 || 8.2 |- | style="text-align:left;"| 2001–02 | 19 || 16 || 29.5 || .611 || .393 || .640 || 7.1 || .7 || .8 || .5 || 16.3 || 19.0 |- | style="text-align:left;"| 2002–03 | 8 || 8 || 32.5 || .506 || .143 || .771 || 7.3 || .9 || .9 || .3 || 15.0 || 14.4 |- | style="text-align:left;"| 2003–04 | style="text-align:left;"| Valencia | 17 || 5 || 22.1 || .548 || .348 || .573 || 5.0 || .8 || .7 || .2 || 11.4 || 11.8 |- | style="text-align:left;"| 2004–05 | style="text-align:left;"| CSKA Moscow | 22 || 18 || 21.5 || .592 || .350 || .682 || 5.2 || 1.0 || 1.1 || .4 || 10.0 || 12.4 |- | style="text-align:left;background:#AFE6BA;"| 2006–07† | style="text-align:left;" rowspan=2| Panathinaikos | 23 || 9 || 15.0 || .624 || .435 || .610 || 3.7 || .4 || .3 || .0 || 7.9 || 8.3 |- | style="text-align:left;"| 2007–08 | 20 || 10 || 14.3 || .631 || .412 || .500 || 2.5 || .2 || .6 || .0 || 6.0 || 5.1 |- | style="text-align:left;"| 2008–09 | style="text-align:left;"| Panionios | 4 || 2 || 21.2 || .500 || .250 || .800 || 2.3 || .0 || .0 || .0 || 6.3 || 3.5 |- class="sortbottom" | align="center" colspan="2"| Career | 130 || 71 || ? || .566 || .362 || .629 || 4.8 || .6 || .7 || .2 || 10.1 || ? Awards and accomplishments Pro career 2× Eurobasket.com's Greek 2nd Division Player of the Year: (1997, 1998) 2× Greek 2nd Division Top Rebounder: (1997, 1998) 2× Greek 2nd Division Top Scorer: (1997, 1998) Greek 2nd Division MVP: (1998) Greek League Best Young Player: (2000) 4× Greek Cup Winner: (2000, 2001, 2007, 2008) FIBA Saporta Cup Champion: (2000) 6× Greek League All-Star: (1999, 2001, 2002, 2003, 2007, 2008) EuroLeague MVP of the Round: 2001–02 Regular season Round 7 3× Greek League Champion: (2002, 2007, 2008) Greek League MVP: (2002) Greek League Finals MVP: (2002) Russian Cup Winner: (2005) Russian Championship Champion: (2005) EuroLeague Champion: (2007) Triple Crown Winner: (2007) Greek League Hall of Fame: (2022) Greece national team 5× Acropolis Tournament Champion: (2000, 2003, 2005, 2007, 2008) 2005 EuroBasket: 2006 Stanković World Cup: 2006 FIBA World Championship: FIBA EuroStar: (2007) References External links FIBA Profile FIBA Europe Profile Euroleague.net Profile AEK.com Profile Greek Basket League Profile Hellenic Basketball Federation Profile Spanish League Profile Spanish League Archive Profile Interbasket.net Greek Prospects Eurobasket.com Profile 1977 births Living people 2006 FIBA World Championship players AEK B.C. players Aris B.C. players Basketball players at the 2004 Summer Olympics Basketball players from Larissa Centers (basketball) FIBA EuroBasket-winning players Greek basketball executives and administrators Greek Basket League players Greek expatriate basketball people in Spain Greek men's basketball players Liga ACB players Olympia Larissa B.C. players Olympic basketball players for Greece Panathinaikos B.C. players Panionios B.C. players P.A.O.K. BC players PBC CSKA Moscow players Power forwards (basketball) Valencia Basket players

52475320

https://en.wikipedia.org/wiki/7%CE%B2-Hydroxy-DHEA

7β-Hydroxy-DHEA

7β-Hydroxydehydroepiandrosterone (7β-hydroxy-DHEA; 7β-OH-DHEA), also known as 3β,7β-dihydroxyandrost-5-ene-17-one, is an endogenous, naturally occurring steroid and a metabolite of dehydroepiandrosterone (DHEA). The major metabolic pathway of DHEA outside the liver is via 7-hydroxylation into 7α-OH-DHEA and 7β-OH-DHEA. 7β-OH-DHEA has weak antiestrogenic activity, selectively antagonizing the estrogen receptor ERβ. 7β-OH-DHEA is on the World Anti-Doping Agency list of prohibited substances in sporting. See also 7-Keto-DHEA 7α-Hydroxyepiandrosterone 7β-Hydroxyepiandrosterone References Diols Androstanes Antiestrogens Ketones World Anti-Doping Agency prohibited substances

4249456

https://en.wikipedia.org/wiki/Von%20Hayes

Von Hayes

Von Francis Hayes (born August 31, 1958) is an American former professional baseball player whose Major League Baseball (MLB) career spanned from 1981 to 1992 for the Cleveland Indians, Philadelphia Phillies, and California Angels. Early years Hayes was born to an American father, Donald Hayes, who was a tail gunner on a B-17 in World War II, and a Puerto Rican mother, Leonor Rosario, who grew up on a rural country farm without electricity. Leonor was determined to get an education and pursue a life helping others. After receiving a college degree, she migrated from Puerto Rico to Stockton at the age of 22 and became a nurse. While attending St. Mary’s High School, Hayes and his older brother, Mike played football. Hayes also played in the school's baseball team as a third and later first baseman. He began his career in baseball when in June 1979 the Cleveland Indians drafted him in the seventh round draft pick. Playing career Hayes was acquired by the Phillies from the Indians for Manny Trillo, George Vukovich, Julio Franco, Jerry Willard, and Jay Baller at the Winter Meetings on December 9, 1982. The Indians received offers for Hayes from various teams, with the Phillies being the most persistent. The trade inspired his nickname "Five-for-One" which was coined by Pete Rose. Hayes enjoyed his most successful seasons playing for the Phillies in the late 1980s. He finished 8th in NL MVP voting in 1986, when he led the National League (NL) in runs, doubles, and extra base hits. Hayes achieved an on-base average of .404 in 1987. In 1989, Hayes made his only appearance on the NL All-Star team, while posting a career-high OPS+ of (140). On June 11, 1985, Hayes became the first player in MLB history to hit two home runs in the first inning of a baseball game. After leading off the game with a home run off Tom Gorman, Hayes hit a grand slam later that inning off Calvin Schiraldi. The Phillies beat the Mets 26-7, the most single-game runs scored by a major league team in over 40 years. Hayes also hit two two-run home runs in a June 8, 1989, game against the Pittsburgh Pirates, at Veterans Stadium. It was in that game that, after the Pirates scored 10 runs in the top of the first inning, Pirate broadcaster Jim Rooker said on the air, "If we lose this game, I'll walk home." Hayes' two homers triggered a comeback, with the Phillies eventually winning the game 15-11. (After the season, Rooker kept his word, by conducting a charity walk from Philadelphia to Pittsburgh.) Playing against the Cincinnati Reds on June 14, 1991, Hayes was hit by a pitch by Tom Browning, breaking Hayes’ arm. He returned to action on September 6, 1991, against the Houston Astros. Hayes was traded to the Angels in the off-season, but would later cite Browning's pitch as having ended his career, "I broke my arm when I was hit by a pitch from Tom Browning ... and I was finished. I tried to make a comeback (with California) in 1992, but it was no good." An indie rock band named themselves after Hayes. Hayes was the inspiration for one of ESPN announcer Chris Berman's "Bermanisms" — Von "Purple" Hayes — a nod to the Jimi Hendrix song "Purple Haze." Career statistics Hayes played 555 games at right field, 401 games at first base, 398 games at center field, 207 games at left field and 23 games at third base. Managerial career In November 2007, Hayes was named manager of the Lancaster Barnstormers of the Atlantic League of Professional Baseball. Hayes debuted with the South Central Pennsylvania-based franchise in the 2008 season. Hayes has also managed Minor League teams in South Bend, Modesto, and Midland, and was California League Manager of the Year in 2004 and Texas League Manager of the Year in 2005. On Oct. 26, 2009, the Camden Riversharks of the Atlantic League of Professional Baseball announced they hired Hayes as their new manager. He became the manager of the Alexandria Aces in United League Baseball in 2013. In 2015, he was named the manager of the Pericos de Puebla in the Mexican League, but after a slow start he was replaced early in the season by Matías Carrillo. In 2016, he became the manager of the Algodoneros de San Luis Rio Colorado in the Northern Mexican League, an affiliate of the Mexican League. In 2017, Hayes returned to the Pericos de Puebla as the manager. However, after a 26-28 start to the season, he was fired on June 3, 2017. See also List of Major League Baseball career stolen bases leaders List of Major League Baseball annual runs scored leaders List of Major League Baseball annual doubles leaders List of Puerto Ricans References External links Von Hayes at Baseballbiography.com Von Hayes advanced stats Von Hayes 2006 article Hayes to Manage Barnstormers Von Hayes 'The Band' 1958 births Living people Major League Baseball outfielders National League All-Stars Cleveland Indians players Philadelphia Phillies players California Angels players Saint Mary's Gaels baseball players Baseball players from Stockton, California Mexican League baseball managers Minor league baseball managers Waterloo Indians players Charleston Charlies players Clearwater Phillies players Scranton/Wilkes-Barre Red Barons players St. Mary's High School (Stockton, California) alumni

58926847

https://en.wikipedia.org/wiki/Siege%20of%20Thouars%20%28762%29

Siege of Thouars (762)

The siege of Thouars was a Frankish siege of the Aquitanian stronghold of Thouars in 762 during the Aquitanian War. The Frankish army under King Pepin the Short besieged and captured the fort with great speed, burning the place to the ground, taking the count of Thouars captive and deporting him and Thouars' Gascon levies to Francia. Prelude After the siege and conquest of Aquitanian Bourges in 762, King Pepin the Short of Francia army moved on to besiege Thouars. The garrison was commanded by the count of Thouars and included Gascon levies. Siege The stronghold was taken with great speed and burned after the siege. Aftermath The Count of Thouars and the Gascon levies were taken along to Francia, as Pepin's army departed home with its plunder from the campaign. References Bibliography Thouars 762 Thouars 762 8th century in Francia

72603439

https://en.wikipedia.org/wiki/Dick%20Seers

Dick Seers

Richard Rock Seers (14 August 1926 – 10 September 2022) was a speedway rider from Australia who rode in the top division of British speedway and represented Australia in internationals. Early life Seers was born in 1926, the fifth child of Thomas Seers and Phoebe Rock. He joined the Enfield Burwood Cycling Club and finished third in the New South Wales under 16 Championships but gave up cycling after breaking his leg. Career summary Seers started racing in 1947 at the Sydney Sportsground. He moved to Coppull, near Wigan in England and resided with Oliver Hart and Ron Hart. He first rode in Britain for the Fleetwood Flyers during the 1948 Speedway National League Division Two season. He then appeared for Glasgow Tigers in 1949. He came to prominence when riding for the Halifax Dukes in 1949, scoring 14 maximums. In 1950, he was selected as reserve for Australia against England in a test match and moved to the highest league in Britain after joining the Bradford Tudors for the 1950 Speedway National League season. During 1951 and 1952 he returned to Australia and placed fourth in the Australian Solo Championship. He represented Australia again against England during 1953 and actually rode this time having previously standing as reserve only in 1950. He spent two more seasons riding for Bradford during the 1953 Speedway National League and 1954 Speedway National League seasons. Personal life By trade he was a motorcycle showroom owner and a sales rep but had a big break after buying the distribution rights to the Lancia Aurelia, which enabled him to set up Lamda Motors. References 1926 births 2022 deaths Australian speedway riders Bradford Tudors riders Fleetwood Flyers riders Glasgow Tigers riders Halifax Dukes riders

1108025

https://en.wikipedia.org/wiki/Fort%20de%20Chartres

Fort de Chartres

Fort de Chartres was a French fortification first built in 1720 on the east bank of the Mississippi River in present-day Illinois. It was used as the administrative center for the province, which was part of New France. Due generally to river floods, the fort was rebuilt twice, the last time in limestone in the 1750s in the era of French colonial control over Louisiana and the Illinois Country. The magazine (ammunition storehouse) of the fort is believed to be the oldest surviving building in Illinois. A partial reconstruction now exists of the limestone fort and the site is preserved as an Illinois state park, four miles (6 km) west of Prairie du Rocher in Randolph County, Illinois. Located on the floodplain area that became known as the American Bottom, the site is south of modern St. Louis. The forts were placed on the National Register of Historic Places and recognized as a National Historic Landmark on October 15, 1966. It was named one of the contributing properties to the French Colonial Historic District in 1974, along with other French-influenced sites such as the Creole House, the Pierre Menard House, the Kolmer Site (a former Indian village), and the site of Fort Kaskaskia. The name of the fort honored Louis, duc de Chartres, son of the Regent of France. The state historic site today hosts several large re-enactments at the fort of colonial-era civil and military life each summer. History French rule On January 1, 1718, the French government granted a trade monopoly to John Law and his Company of the West. Hoping to make a fortune mining precious metals, the company built a fort to protect its interests. The original wooden fort was built in 1718–1720 by a French contingent from New Orleans, led by Pierre Dugué de Boisbriant. When administration of the Illinois Country was moved from Quebec City to New Orleans, governance was transferred to the Company of the Indies. The fort was built to be the seat of government and to control the Indians of the region, particularly the Fox. The original fort was a palisade of logs with two bastions at opposite corners. Within five years, flooding from the Mississippi had left the original fort in bad condition. Construction of a second fort further from the river, but still on the flood plain, began in 1725. This fort was also made of logs and had a bastion at each of the four corners. The second wooden fort deteriorated somewhat less rapidly but by 1742 was in bad repair. In 1747 the French garrison moved to the region's primary settlement to the south at Kaskaskia. The French debated where to rebuild the fort. When rule of the area reverted to the French crown in the 1730s, officials began to discuss construction of a stone fortress. The government in New Orleans wanted to move the garrison permanently to Kaskaskia, but the local commandant argued for a location near the original site. The government decided to rebuild a fort in stone near the first forts rather than at Kaskaskia. Construction began in 1753 and was mostly completed in 1754. The limestone fort had walls 15-ft (3 m)-high and 3-ft (1 m)-thick, enclosing an area of 4 acres (16,000 m2). The stone for construction was quarried in bluffs about two or three miles (4 km) distant and had to be ferried across a small lake. In August 1751 Francois Saucier was summoned from Mobile to New Orleans by Governor Vaudreuil for a special assignment. This assignment was for the construction of a new fort to accommodate the garrison of additional troops that France was sending to the colony. The new fort was to replace the old wooden Fort de Chartres and was to be constructed of stone at the settlement. The main purpose of the new fort was to impress the warring Chickasaw Tribe of the area and to check and halt the progress of the British in the area. This new assignment required Francois to immediately journey to his new post in Illinois without the benefit of first returning home to Mobile for personal necessities. The original intention of the French Government was for Francois and his crew to build the new stone Fort de Chartres in Kaskaskia. The Governor of the territory, Vaudreuil, eventually made the decision to leave the Fort where it stood. Due to problems of flooding it was decided to move it a little over one half mile north of the old fort. Upon arriving he took on the task of surveying the terrain, its situation and advantages, in order to make recommendations on construction. Once his plans were completed he sent them as instructed to the governor in New Orleans with all specifications and estimated costs. After some time of deliberations by the French government and many delays and discussions of the cost of construction as planned by Francois, a scaled down version of the fort was finally given approval and Francois was then given permission to start its construction. During this period of waiting for approval from France, preparations were being conducted by Francois and his crew of soldiers as he had been instructed by the governor for the forts construction, including clearing the land, felling of trees for timber and other site preparations. After the many earlier delays, the budget for building the new fort was finally approved and they proceed with the construction of Fort de Chartres. British rule In 1763 the Treaty of Paris was signed following the Seven Years' War (French and Indian War) and the French transferred control of the Illinois Country east of the Mississippi to Great Britain. (Spain had been granted the western part of the Illinois Country—also known as Upper Louisiana—in the 1762 Treaty of Fontainebleau.) The stone fort had served as center of French administration of the region for only twenty years. The British had difficulty getting a regiment to their newly acquired fort, but on October 10, 1765, a small detachment of the 42nd Regiment of Foot commanded by Captain Thomas Stirling took control of the fort and surrounding area. The 42nd was shortly replaced by the 34th Foot. French Canadian settlers were ordered to leave or get a special license to remain. Many Canadien settlers moved to the more congenial culture of St. Louis. The 34th Regiment of Foot renamed the installation Fort Cavendish, after its colonel. However, the post was known as Ft. Chartres from 1768 on, after the 34th were replaced by the 18th Regiment of Foot under the command of Lt. Col. Wilkins. The British abandoned the post in May 1772 when the majority of the 18th Foot was ordered back to Philadelphia. A small party under Capt Hugh Lord remained at Kaskaskia until May 1776. Ruin The Mississippi continued to take its toll after the fort was abandoned. In 1772 the south wall and bastion fell into the river. The remaining walls deteriorated, and visitors noted trees growing in them by the 1820s. Locals carted away stones for construction over the years. By 1900 the walls were gone. The only part of the original fort that remained was the stone masonry powder magazine. Reconstruction The State of Illinois acquired the ruins in 1913 as a historic site and restored the powder magazine in 1917. The powder magazine is thought to be the oldest existing building in the state of Illinois. In the 1920s the foundations of the fort's buildings and walls were exposed. In the late 1920s and through the 1930s, the US WPA rebuilt the gateway and two stone buildings. A combination museum and office building, constructed in 1928 on the foundation of an original fort building, houses exhibits depicting French life at Fort de Chartres. The large stone "Guards House", reconstructed in 1936, contains a Catholic chapel furnished in the style of the 1750s, along with a priest's room, a gunner's room, an officer-of-the-day room, and a guard's room. Also on the grounds are an operating bake oven, a garden shed built of upright logs in French Colonial poteaux-sur-sol (French: "post on sill") construction, and a kitchen garden with raised beds of produce typical of French 18th-century Illinois. Partial reconstruction of the fort's walls on the original foundations followed in 1989. The frames of some additional buildings were erected as a display of the post-and-beam construction techniques used for the originals. Other buildings' foundations and cellars were exposed for educational display as well. Today the site has a museum and small gift shop. It plays host each June to a Rendezvous that is said to be one of the largest and oldest in the country, celebrating frontier French and Indian culture. The site is protected by modern levees, but the Mississippi River is still an occasional menace. The flood of 1993 breached the levee and sent waters fifteen feet deep to lap at the top of the walls. See also List of French forts in North America References External links Fort De Chartres Official Site Biography of Francois Saucier Chartres French colonial settlements of Upper Louisiana Chartes History museums in Illinois Military and war museums in Illinois Museums in Randolph County, Illinois Illinois State Historic Sites Military facilities on the National Register of Historic Places in Illinois National Historic Landmarks in Illinois National Register of Historic Places in Randolph County, Illinois Louisiana (New France) French-American culture in Illinois French colonial architecture Chartres 1720 establishments in New France Poteaux-sur-sol framing Military installations established in 1720 1772 disestablishments in the British Empire Military installations closed in 1772

23886652

https://en.wikipedia.org/wiki/Sapta%20Badri

Sapta Badri

Sapta Badri constitutes a group of seven sacred Hindu temples, dedicated to god Vishnu, located in Garhwal Himalayas in the Indian state of Uttarakhand. The Badrinath temple, called the Badri Vishal (altitude ) is the primary temple among the seven shrines. The other six being Adi Badri, Bhavishya Badri, Yogadhayan Badri, Vriddha Badri, Ardha Badri and Dhyan Badri. The Panch Badri temple circuit consisted of only five temples, omitting Ardha Badri and usually Dhyan Badri (or sometimes Vriddha Badri). Rarely, Narasingh Badri, is included in the Sapta Badri or Panch Badri list. The abode of Vishnu in the Alaknanda river valley, starting from Satapanth about above Badrinath extending up to Nandprayag in the south, is particularly known as the Badri Kshetra in which all the Badri temples are located. Since the early times, approach to the main temple of Badrinath was only along a bridle path passing through badri van or (forest of berries). Thus, the word "Badri", meaning "berries", is suffixed to the names of all the Sapta Badri (seven) temples. The main shrine of Badrinath is well connected by road and air but is closed during the winter season due to snow conditions, from October–November to April–May depending on the astrological dates fixed by the Temple Committee; the Raj Purohit (Royal priest) decides the auspicious day for opening the temple kapat (doors) on Vasant Panchami day in end of April/early May while the closing day is Vijayadashami day in October/November. The other six temples are located in villages, largely in remote locations. A few of them can be approached only by trekking along bridle paths. Badrinath Badrinath is the northern Dham of the four sacred Dhams (pilgrimage centres) called Char Dham. Though the Badrinath temple is believed to date to the Vedic period, the current structure was built in the 8th century AD by Adi Shankaracharya. The other three dhams are Rameshwaram in the south, Dwarka in the west and Jagannath Puri in the east; all of them are dedicated to lord Vishnu except Rameshwaram which is dedicated to lord Shiva . Adi Shankara's basic intention was to unite the country under the banner of Hinduism. The temple, which had been subjected to damage due to snow avalanches and landslides, several times in the past, was last restored in the 19th century with the royal patronage of the Scindias and Holkars. Badrinath is also part of Chota Char Dham, four sacred temples in Uttarakhand. The others include the Shiva temple of Kedarnath and the sources of the holy rivers Ganges and Yamuna. The Badrinath legend states that Vishnu (Mahavishnu) in his incarnation as the sages Nara and Narayana, did penance in an open space at the location of the Badrikashram or Badrinath. His consort Lakshmi (Maha-lakshmi) created shelter for him in the form of Badri tree (berry tree) to protect him from adverse climatic conditions. The sage Narada did penance here, and is believed to continue to do so to this day by reciting the divine chants called Ashta Akshara mantras (eight lettered mantra, i.e., Om Namo Narayanaya). Narada was also informed by Vishnu that his divine form subsumed both Nara and Narayana. According to the scripture Bhagavata Purana, "There in Badrikashram (Badrinath) the Personality of Godhead (Vishnu), in his incarnation as the sages Nara and Narayana, had been undergoing great penance since time immemorial for the welfare of all living entities." (3.4.22) The layout of the temple has three enclosures namely, the Garbhagriha (Sanctum Sanctorum), the Darshan Mandap (worship hall) and Sabha Mandap (Conference hall). The sanctum holds the central image of Badri-narayana (Vishnu), which is made in black stone and in height. The four-armed Vishnu holds the Shankh (Conch) and Sudarshana Chakra (discus) in two arms in a raised posture and the other two arms rest on the lap in Yogamudra (meditative pose). The images of religious leaders Adi Shankara, Swami Vedanta Desikan and Ramanujacharya are also worshipped here. In the sanctum, to the far right side are Nara and Narayana. Narada is kneeling in front on the right side and is difficult to see. On the left side is Kubera, the god of wealth. Garuda, Vishnu's vehicle is kneeling in front, to the left of Badri-narayana. Wings at the entrance are adorned with images of Hanuman, and a silver Ganesha, god of wisdom. In the enclosure (prakara) surrounding the temple, a small shrine is dedicated to Lakshmi, Vishnu's consort. Nambudiri Brahmins from southern state of Kerala serve as head priests here. Adi Badri The Adi Badri () the first temple complex among the Sapta Badri temples is an ancient shrine dedicated to Vishnu and is one among a chain of 16 small shrines located in the hill ranges , beyond Karnaprayag (confluence of Pindar River and Alaknanda River in Chamoli district. Seven temples of this chain were built during the late Gupta period (5th century to 8th century). According to tradition, Adi Shankara is attributed as builder of all the temples. Adi Shankara is believed to have sanctioned these temples in order to spread Hinduism to every remote part of the country. In ancient times, when approach to the main shrine of Badrinath was closed due to weather conditions, pilgrims worshipped Vishnu at this temple. Adi Badri, also known as Helisera according to revenue records, is a tiny temple complex enclosed within a space of X . The height of the temples vary from . The chief temple is dedicated to god Vishnu, which is built over a raised platform, with a small enclosure in a pyramidal form. The sanctum holds black stone image of Vishnu. The image depicts Vishnu holding a mace, lotus and chakra (discus). Brahmins from South India serve as chief priests in the temple. Adi Badri is located from Chandpur fort or Garhi located on the hilltop, which was built by the Parmar kings of garhwal. Adi Badri is an hour's drive from Karnaprayag and close to Chulakot on the way to Ranikhet. On shifting of Badrinath (also known as Raj Badri) to Bhavishya Badri, Adi Badri will be called the Yog Badri. Vriddha Badri Vriddha Badri or Briddha Badri - an austere shrine, is located in the Animath village ( , above sea level) , from Joshimath on the Rishikesh–Joshimath-Badrinath road. The Vriddha Badri legend says that Vishnu appeared in the form of a Vriddha or old man before sage Narada who performed penance here. Thus, the idol installed at this temple is in the form of an old man. According to legend, the image of Badrinath was carved by the divine craftsman Vishwakarma and worshipped here. At the advent of Kali Yuga, Vishnu chose to remove himself from this place, later Adi Shankara found the partly damaged image in Narad-kund pond and established it at the central Badrinath shrine. According to legend, Badrinath was worshipped here by Adi Shankara, before his enshrinement at the Badrinath temple. The temple is open throughout the year. Brahmins from South India serve as chief priests in the temple. Bhavishya Badri Bhavishya Badri, also spelt as Bhabisya Badri, , above sea level) is located in a village called Subhain at a distance of from Joshimath, beyond Tapovan and approach is through dense forest, only by trekking. It is situated on an ancient pilgrim route to Mount Kailash and Manasarovar, along the Dhauli Ganges River. It is situated on the way from Tapovan to Lata in the Niti Valley. Bhavishya Badri is connected by a motorable road to Saldhar,, from Joshimath, beyond which a trek is undertaken to reach the shrine. According to the legend of Bhavishya Badri (literally "Badri of the future"), when evil transcends the world, the mountains of Nara and Narayana would block up the route to Badrinath and the sacred shrine would become inaccessible. The present world will be destroyed and a new one established. Then, Badrinath will appear at the Bhavishya Badri temple and be worshipped here, instead of the Badrinath shrine. The shrine of Narasingh Badri at Joshimath is closely associated with the legend of Bhavishya Badri (see section below). Currently, the Bhavishya Badri has an image of Narasimha, the lion-faced incarnation and one of the ten avatars of Vishnu. Yogadhyan Badri Yogadhyan Badri, also called Yoga Badri, is located at Pandukeshwar () at the elevation of , close to Govind Ghat and is as ancient as the main Badrinath temple. Pandukeshwar is located on route from Govind Ghat to Hanuman Chatti, away from Hanuman Chatti. Legend has it that King Pandu, father of the five Pandavas - heroes of the Hindu epic Mahabharata, meditated here to god Vishnu to cleanse him of the sin of killing of two mating deer, who were ascetics in their previous lives. The Pandavas were also born here and Pandu died and attained salvation here. Pandu is believed to have installed the bronze image of Vishnu in the Yogadhyan Badri shrine. The image is in a meditative posture and thus the image is called Yoga-dhyan (mediative) Badri. The idol is life size and has been carved from Shaligram stone. According to legend, the Pandavas, after defeating and killing their cousins Kauravas in the Mahabharata war, came here to repent. They handed their kingdom of Hastinapur to their grandson Parikshit and went to perform penance in the Himalayas. Copper plate inscriptions found here indicate rule by early Katyuri Rajas and the region was known as Panchal Desh, now officially designated as Uttarakhand. One inscription extols the grant of land given by King Nimbarana. Another historic location is the Suryakund, on top of Milam glacier, which is a hot water spring, where Kunti - mother of Pandavas gave birth to her illegitimate son Karna, fathered by the sun-god Surya. Kunti was married to Pandu at Pandukeshwar. Yogdhyan Badri is also considered the winter abode for the Utsava-murti (festival-image) of Badrinath, when the temple of Badrinath is closed. Hence, it is religiously ordained that a pilgrimage will not be complete without offering prayers at this place. Bhatts (priests) from South India serve as chief priests in the temple. Dhyan Badri Dhyan Badri (, above sea level) is located in the Urgam valley, close to Kalpeshwar () on the banks of river Kalpa Ganga. It can be reached from Helang Chatti which is situated on the NH7 (Chamoli - Joshimath road) & then further drive down to Urgam, Lyari & Devagram followed by a trek. The legend of Dhyan Badri (meditating Badri) is linked to the Urvarishi, son of King Puranjaya of the Pandavas lineage who meditated in the Urgam region and established the temple for Vishnu. The image of Vishnu is four-armed, made of black stone and in a meditative posture. There is also a temple to god Shiva built by Adi Shankara. Kalpeshwar, one of the Panch Kedar sacred temple of Shiva, is situated , away. The temple is sometimes included in the Panch-Badri list. Brahmins from South India serve as head priests in the temple. Ardha Badri Ardha Badri, located on the Joshimath-Tapovan road is in a remote village and can be approached only by trekking along a steep bridle path. As the size of the idol is small, the temple is called Ardha Badri (literal meaning half Badri). Narasingh Badri The existing temple of Narasimha (Narasingh) at Joshimath (), also called as Narasingh Badri or Narasimha Badri, is closely linked to the Bhavishya Badri legend, even though usually it is regarded as not one of the famous Panch Badri or Sapta Badri. Sometimes, it may be included in the Sapta-Badri list instead of Ardha-Badri or Panch-Badri list instead of Dhyan Badri. The chief image of Narasimha is made out of the Shaligram stone, in the eighth century during the reign of king Lalitaditya Yukta Pida of Kashmir. Some believe the image is self-manifested (swayambhu). The image is high and depicts the god sitting in the lotus position. It is believed that one arm of the image is getting emaciated with time and finally fall off. When the arm disappears, the main shrine of Badrinath will be closed to the world and Lord Badrinath will shift to Bhavishya Badri shrine. With this cataclysmic event, Kali Yuga will end ushering in the Satya Yuga. Then the Badrinath shrine would get re-established. When the chief Badrinath shrine is closed in winter, the priests of Badrinath shift to this temple and continue their worship to Badrinath here. Along with the central Narasimha image, the temple also has an image of Badrinath. Access While some shrines are approached by motorable roads, others are approachable from the nearest road head by trekking, on the Rishikesh-Badrinath main State Highway. The nearest airport to the Sapta Badri is Jolly Grant Airport close to Rishikesh, but to Dehradun. Motorable road distance to the seven shrines from Rishikesh are: to Badrinath - ; Yogdhyan Badri-, short of Badrinath; Adi Badri - up to Karnaprayag and a further deviation on the Ranikhet road for to reach the shrine; Dhyan Badri - to Badrinath and a further trek of en route to Joshimath; Vriddha Badri - trek from Joshimath; Bhavishya Badri - up to Siladhar by road and further trek of to the shrine. References External links Panch Badri Hindu pilgrimage sites in India Hindu temples in Uttarakhand Chamoli Vishnu temples

22691305

https://en.wikipedia.org/wiki/Ross%20Chaffer

Ross Chaffer

Ross Chaffer (born 18 July 1972) is an Australian sprint canoeist who competed in the late 1990s and early 2000s. He won a bronze medal in the K-4 1000 m event at the 1997 ICF Canoe Sprint World Championships in Dartmouth. Chaffer also competed in the K-4 1000 m event at the 2000 Summer Olympics in Sydney, but was eliminated in the semifinals. References Sports-reference.com profile 1972 births Australian male canoeists Canoeists at the 2000 Summer Olympics Living people Olympic canoeists for Australia ICF Canoe Sprint World Championships medalists in kayak Place of birth missing (living people)

24432938

https://en.wikipedia.org/wiki/Felix%2C%20Fortunatus%2C%20and%20Achilleus

Felix, Fortunatus, and Achilleus

Felix, Fortunatus, and Achilleus were 3rd-century Christian saints who suffered martyrdom during the reign of Caracalla. Felix, a priest, Fortunatus and Achilleus, both deacons, were sent by Irenaeus, to Valence, to convert the locals. It is said that they died . Legends Felix, Fortunatus and Achilleus were sent to Valence, by Saint Irenaeus of Lyon. From a humble lodging wherein they lived a life of much penance they evangelised the town. They also performed many miracles in the area of Valence, and through their preaching many people were converted. This led to their arrest. They were freed from prison, by angels, who told them to destroy all the idols of the temples in Valence. So Felix, Fortunatus, and Achilleus, destroyed images of Mercury, Saturn, and a particularly valuable amber statue of Jupiter. For their actions the three were captured again, had their legs broken, followed by torture on wheels. Having survived all of these torments they were beheaded. Although the individuals themselves may not be entirely legendary, no historical incidents of their lives have been preserved. Veneration Relics believed to be those of Felix, Fortunatus, and Achilleus, are venerated in Valencia, Spain. See also Other saints Felix Other saints Fortunatus References External links Sts. Felix, Fortunatus, & Achilleus Catholic Online 212 deaths Gallo-Roman saints 3rd-century Christian martyrs 3rd-century Christian clergy Groups of Christian martyrs of the Roman era Year of birth unknown Angelic visionaries

50917162

https://en.wikipedia.org/wiki/Geraldo%20Boldewijn

Geraldo Boldewijn

Geraldo Boldewijn (born Geraldo Hiwat; February 14, 1991) is a Canadian football wide receiver who is a free agent. He played college football at Boise State University and attended Capital High School in Boise, Idaho. He has been a member of the Atlanta Falcons of the National Football League (NFL) and the BC Lions of the Canadian Football League (CFL) Early years Boldewijn was born in Amsterdam and later began playing football for the Amsterdam Panthers of the American Football Bond Nederland (AFBN). He started playing flag football in the Netherlands and did not play tackle football until he was fifteen. He then moved to Boise, Idaho to play one year of high school football at Capital High School, earning first-team All-Southern Idaho Conference and second-team all-state honors his senior year as the team finished with an 8-2 record. Boldewijn played in the East-West Shrine Game as well. He recorded 41 receptions for 502 yards and five touchdowns his senior season. He also rushed for 51 yards and one touchdown on three carries, returned eight kickoffs for 303 yards and a touchdown and returned six punts for 107 yards and a touchdown. College career Boldewijn played for the Boise State Broncos from 2010 to 2013. He was redshirted in 2009. He played in thirteen games in 2010, catching 11 passes for 160 yards. Boldewijn changed his name from "Geraldo Hiwat" to "Geraldo Boldewijn" after his redshirt freshman year. "Boldewijn" is his mother's last name. He was suspended for the first four games of the 2011 season by the NCAA for receiving improper benefits, which was borrowing a 1990 Toyota Camry with 177,000 miles on it. He played in, and started three, of the team's last nine games of the 2011 season, recording 19 receptions for 266 yards and two touchdowns. The NCAA suspended Boldewijn for the first four games of the 2012 season for receiving extra benefits, which resulted from his high school host family assisting him in booking a flight to the Netherlands to see his family over Christmas. He appeared in, and started four, of the Broncos' last nine games in 2012, catching 18 passes for 197 yards and two touchdowns. He started all thirteen games his redshirt senior season in 2013, catching 39 passes for 528 yards and two touchdowns. Boldewijn majored in business at Boise State. Professional career Boldewijn had workouts with the New England Patriots and Arizona Cardinals of the NFL in April 2014. He later had a workout with the Miami Dolphins in April 2015. Boldewijn signed with the NFL's Atlanta Falcons in May 2014 after going undrafted in the 2014 NFL Draft. He injured his right hamstring during practice on August 26. On August 30, 2014, he was given an injury settlement and released by the team. Boldewijn's attempt to make the Falcons' final roster was chronicled on Hard Knocks. On September 22, 2015, he was signed to the practice roster of the BC Lions of the CFL. He made his CFL debut and first start in the team's last game of the regular season, recording three receptions for 64 yards in a 28-7 loss to the Calgary Stampeders. One of Boldewijn's three catches went for fifty yards. He was released by the Lions on November 14, 2015. He signed with the Lions on February 2, 2016. Personal life Boldewijn's family's roots are in Suriname. References External links Just Sports Stats College stats Living people 1991 births American football wide receivers Canadian football wide receivers Capital High School (Boise, Idaho) alumni Dutch players of American football Dutch players of Canadian football Boise State Broncos football players Atlanta Falcons players BC Lions players Sportspeople from Amsterdam Dutch sportspeople of Surinamese descent

51589915

https://en.wikipedia.org/wiki/Athletics%20at%20the%202016%20Summer%20Paralympics%20%E2%80%93%20Men%27s%201500%20metres%20T37

Athletics at the 2016 Summer Paralympics – Men's 1500 metres T37

The Men's 1500 metres T37 event at the 2016 Summer Paralympics took place at the Estádio Olímpico João Havelange 11 September. Results T37 Competed 11 September 2016 at 16:59. References Athletics at the 2016 Summer Paralympics 2016 in men's athletics

18652499

https://en.wikipedia.org/wiki/Tristan%20Jepson

Tristan Jepson

Tristan Jepson (1978 – 28 October 2004) was an Australian law graduate and writer. He was educated at Trinity Grammar School and the University of New South Wales. While still an undergraduate law student, he began to write and perform comedy as director of the University of New South Wales' Law Revue. On graduation in 2003, he joined the cast of the AFI Award nominated sketch comedy TV programme Big Bite, where he was perhaps best known for impersonations of Tom Gleisner in parody sketches of The Panel. Diagnosed with clinical depression in 1998, Jepson suffered bouts during his university years and committed suicide by drug overdose, aged 26. The Tristan Jepson Memorial Foundation, named in his honor, is an organisation which works to foreground issues of mental illness in the law, including law students, graduates, practicing lawyers, and judges. The foundation changed its name to Minds Count in 2018. In 2006 the University of New South Wales inaugurated an annual Tristan Jepson Memorial Lecture. References External links Sydney Morning Herald Article About Tristan Jepson The Tristan Jepson Memorial Fund Article about Tristan Jepson Memorial Lecture 1978 births 2004 deaths People from Sydney Australian male television actors Australian television writers University of New South Wales Law School alumni People educated at Trinity Grammar School (New South Wales) Australian male television writers 20th-century Australian screenwriters

840659

https://en.wikipedia.org/wiki/Thomas%20Cowling

Thomas Cowling

Thomas George Cowling FRS (17 June 1906 – 16 June 1990) was an English astronomer. Early life and education Cowling was born in Hackney, London, the second of four sons of George Cowling and Edith Eliza Cowling (nee Nicholls). He was educated at Sir George Monoux Grammar School in Walthamstow and read mathematics at Brasenose College, Oxford from 1924 to 1930. From 1928 to 1930 he worked under Edward Arthur Milne. In 1929, Milne had no problems left to ask his student to work on and appealed to Sydney Chapman, who proposed that they work on an article on which he was working that dealt with the Sun's magnetic field. Cowling found an error in the paper that invalidated Chapman's results. After Cowling's doctorate, Chapman proposed that they work together. Academic career In 1933 Cowling wrote an article, The magnetic field of sunspots. Joseph Larmor had worked in this area, arguing that sunspots regenerate themselves through a dynamo effect. Cowling showed that Larmor's proposed explanation was incorrect. His article assured him of a good reputation in the field of astrophysics. During the 1930s, Cowling also worked on stellar structure involving radiation and convection, at the same time as Ludwig Biermann but independently of him. He constructed a model of star with a convective core and radiative envelope, named the Cowling model by Chandrasekhar. He also studied magnetic fields within stars and classified the modes of non-radial oscillation of the body of a star, the basis of the field of helioseismology. Cowling became an Assistant Lecturer at the University College of Swansea (now Swansea University) in 1933. He was subsequently a Lecturer at the University of Dundee (1937–38) and at the University of Manchester (1938–45) before being appointed Professor of Mathematics at the University College of North Wales (now Bangor University). In 1948 Cowling was appointed Professor of Applied Mathematics at the University of Leeds in succession to Professor Selig Brodetsky. Cowling retired from his chair at Leeds in 1970 with the title Emeritus Professor. Honours Cowling was elected a Fellow of the Royal Society (FRS) in March 1947. He won the Gold Medal of the Royal Astronomical Society in 1956 and the Bruce Medal of the Astronomical Society of the Pacific in 1985. He was elected president of the Royal Astronomical Society from 1965 to 1967. He was also awarded the Hughes Medal two days before his death. Marriage and children Cowling married Doris Marjorie Moffatt in 1935. They had a son and two daughters. Death Cowling died in Leeds on 16 June 1990, one day before his 84th birthday. He was survived by his wife and children. References External links Bruce Medal page Awarding of RAS gold medal Autobiographical article Oral History interview transcript with Thomas Cowling on 22 March 1978, American Institute of Physics, Niels Bohr Library & Archives Obituary QJRAS 32 (1991) 201 1906 births 1990 deaths 20th-century British astronomers Recipients of the Gold Medal of the Royal Astronomical Society Fellows of the Royal Society People educated at Sir George Monoux College Alumni of Brasenose College, Oxford Academics of Swansea University Academics of the University of Dundee Academics of the University of Manchester Academics of Bangor University Academics of the University of Leeds Presidents of the Royal Astronomical Society

65428746

https://en.wikipedia.org/wiki/Bruno%20Zimm%20%28artist%29

Bruno Zimm (artist)

Bruno Louis Zimm (December 29, 1867 - November 21, 1943) was an American sculptor. He created a variety of works: fountains, memorials, freestanding sculptures, and architectural sculptures. Biography He was born in New York City, the son of Louis and Olga Shoreck Zimm. At age 13, Zimm began study at the Metropolitan Museum of Art Schools, where J.Q.A. Ward was among his instructors. He studied privately for five years under Karl Bitter, for a year under Augustus Saint-Gaudens at the Art Students League of New York, then worked as a studio assistant to Saint-Gaudens. Zimm's early work included architectural sculpture for the Hotel Waldorf-Astoria, and an angel figure for Trinity Church Cemetery. He studied further in Paris, where he received an 1899 commission from the U.S. Government to create two sculpture groups for the upcoming Exposition Universelle (1900). In the [American] section of "Varied Industries," Mr. Bruno Louis Zimm of New York has just finished the first of the two sculpture groups that are to flank its entrance. It is a very graceful and dignified composition representing the art of Ceramics—a female figure engaged in the decoration of a vase, while a youth holds before her a bunch of freshly culled leaves. The sentiment is, that all true art is inspired by nature. Following his return to New York City, Zimm created a statue of General Sherman, a sculpture group called Progress, and a number of bas-relief panels and portrait busts. Zimm was commissioned to create a statue of Sacagawea for the 1904 World's Fair. His research into her turned up new evidence: "A sculptor, Mr. Bruno Zimm, seeking a model for a statue of Sacagawea that was later erected at the Louisiana Purchase Exposition in St. Louis, discovered a record of the pilot-woman's death in 1884 (when ninety-five years old) on the Shoshone Reservation, Wyoming, and her wind-swept grave." Zimm also created the colossal Allegorical Figure of North Dakota for the Fair, one of fourteen seated sculptures representing the U.S. states that had been part of the Louisiana Purchase. In addition, he created architectural sculptures for some of the buildings. Awards and honors Zimm was awarded a Silver Medal at the 1900 Paris Exposition for his sculpture groups, The Art of Metalwork and The Art of Ceramics. He exhibited at the 1904 Louisiana Purchase Exposition in St. Louis, Missouri; and the 1915 Panama–Pacific International Exposition in San Francisco, California. He was elected to membership in the National Sculpture Society in year. Personal In 1910 Zimm moved full-time to the Byrdcliffe Colony in Woodstock, New York. In 1919 he married his second wife, Louise Seymour Hasbrouck. Their son Bruno Hasbrouck Zimm (1920-2005) became a well known chemist. Zimm and his wife purchased a farm outside Woodstock during the 1930s. It featured an 1840s stone farmhouse, that they renovated and expanded in an Arts and Crafts style. Zimm's two-story studio features rafter tails carved into masks, and interior carving, including one plaque reading: "Rose Plot, Fringed Pool, Fern'd Grot, the veriest school of Peace." Selected works Louisiana Purchase Exposition, St. Louis, Missouri, 1904: Allegorical figure of North Dakota, staff, Colonnade of the States, Sakakawea, staff?, (Lost, presumed destroyed) Torch Bearer Neptune and Horses Frieze for Palace of Mines and Metallurgy, in length Portrait relief of James McNeill Whistler, terracotta, unlocated, 1905 Slocum Memorial Fountain, Tennessee marble, Tompkins Square Park, New York City, 1908. Women's Health Protective Association Fountain, Riverside Park, New York City, 1909 New York State Monument, Armory Plaza, White Plains, New York, 1910 Finnegan Monument, limestone, Glenwood Cemetery, Houston, Texas, 1910. Panama–Pacific International Exposition, San Francisco, California, 1915: Frieze panels, below dome of Palace of Fine Arts. Audrey Munson was a model for the frieze panels. Frieze, base of Altar of Art, Palace of Fine Arts. Murdock Frieze, Wichita Carnegie Library, Wichita, Kansas, 1918. Hasbrouck Urns, Clark Mansion, 324 State Street, Ogdensburg, New York, 1920. Created for the ancestral home of Zimm's wife. Relief panels: Sergeant York and Paul Revere, Seaboard National Bank, Broadway & Beaver Street, New York City, 1920 Edward C. Young Tablet, First National Bank, Jersey City, New Jersey, 1922 Portrait relief of Karl Bitter, plaster, 1923. Exhibited at the National Sculpture Society's 1923 exhibition. Stations of the Cross, St. Clement's Church, Philadelphia, Pennsylvania, 1932. Based on the designs of Edward Maene. Portrait bust of Robert E. Lee, plaster?, Baylor University, Waco, Texas, 1937 Another cast is in the collection of the Memphis Brooks Museum of Art, Memphis, Tennessee. Our Beloved General (portrait bust of Robert E. Lee), wood, Marion Military Institute, Marian, Alabama, 1937. Gift of Zimm's widow and son References 1867 births 1943 deaths Sculptors from New York City 20th-century American sculptors 20th-century American male artists 19th-century American sculptors 19th-century American male artists American architectural sculptors American male sculptors National Sculpture Society members

25540417

https://en.wikipedia.org/wiki/Kosmos%20163

Kosmos 163

Kosmos 163 ( meaning Cosmos 163), also known as DS-U2-MP No.2, was a Soviet satellite which was launched in 1967 as part of the Dnepropetrovsk Sputnik programme. It was a spacecraft, which was built by the Yuzhnoye Design Office, and was used to investigate micrometeoroids and cosmic dust particles in near-Earth space. A Kosmos-2I 63SM carrier rocket was used to launch Kosmos 163 into low Earth orbit. The launch took place from Site 86/1 at Kapustin Yar. The launch occurred at 05:03:00 GMT on 5 June 1967, and resulted in the successful insertion of the satellite into orbit. Upon reaching orbit, the satellite was assigned its Kosmos designation, and received the International Designator 1967-056A. The North American Air Defense Command assigned it the catalogue number 02832. Kosmos 163 was the second of two DS-U2-MP satellites to be launched, after Kosmos 135. It was operated in an orbit with a perigee of , an apogee of , an inclination of 48.4°, and an orbital period of 93.1 minutes. It decayed from its orbit and reentered the atmosphere on 11 October 1967. See also 1967 in spaceflight References Spacecraft launched in 1967 Kosmos satellites 1967 in the Soviet Union Dnepropetrovsk Sputnik program

11542415

https://en.wikipedia.org/wiki/Charles%20A.%20Sumner

Charles A. Sumner

Charles Allen Sumner (August 2, 1835 – January 31, 1903) was an American lawyer and politician who served two terms as a U.S. Representative from California from 1883 to 1885. Early life Born in Great Barrington, Massachusetts, Sumner attended Trinity College in Hartford, Connecticut, but did not graduate. He subsequently studied law, but was chiefly interested in stenography. He was admitted to the bar and engaged in patent practice. California He moved to California in 1856 and settled in San Francisco where he reported for the legislature from 1857 to 1861. Between the legislative sessions he was engaged in the state and county courts, in law-reporting, and general editorial duties. In 1860, he was involved in political campaigning for the Republican Party. He became editor of the Herald and Mirror in 1861. His opposition to the “Shafter” land bill succeeded in defeating it. Civil War During the American Civil War he was appointed, on November 26, 1862, to be captain and assistant quartermaster of United States Volunteers, and served until his resignation on March 30, 1864. Nevada He moved to Virginia City, Nevada where he served as member of the Nevada State Senate from 1865 to 1868 and served as president pro tempore for one session. During this time, he was twice an unsuccessful candidate for U.S. Representative. Return to San Francisco He returned to San Francisco in 1868 and became editor of the Herald where he advocated a government postal telegraph. He was appointed official note-taker of the city, and in 1875 and 1880 official reporter of the supreme court. U.S. Representative After an unsuccessful attempt in 1878, he was elected as a Democrat to the Forty-eighth Congress (March 4, 1883 – March 3, 1885). There he opposed the Pacific railroads, and introduced a postal telegraph bill. He was an unsuccessful candidate for reelection in 1884. Later life He resumed the practice of law. Trinity gave him the degree of A. M. in 1887. He died in San Francisco, California on January 31, 1903, and was interred in the George H. Thomas Post plot at the Presidio. Publications Shorthand and Reporting (New York, 1882) Golden Gate Sketches (1884) Travel in Southern Europe (1885) Sumners' Poems (with his brother, Samuel B. Summer, 1887) Notes References External links 1835 births 1903 deaths People from Great Barrington, Massachusetts Nevada Unionists Nevada state senators Democratic Party members of the United States House of Representatives from California Union Army officers 19th-century American politicians Military personnel from Massachusetts

28386549

https://en.wikipedia.org/wiki/Jerevice

Jerevice

Jerevice (Cyrillic: Јеревице) is a village in the municipality of Kakanj, Bosnia and Herzegovina. Demographics According to the 2013 census, its population was 110. References Populated places in Kakanj

67706340

https://en.wikipedia.org/wiki/Anabasse

Anabasse

Anabasse was a coarse woolen material, a kind of blanketing made in France and the Netherlands for the African market, or a type of coarse blanketing made in Lancashire using a wool warp and a cotton weft. History The term originally meant a type of striped loincloth manufactured in India. See also Woolen References Woolen clothing Woven fabrics

74656386

https://en.wikipedia.org/wiki/M%C3%A9moires%20d%27un%20jeune%20homme%20d%C3%A9rang%C3%A9

Mémoires d'un jeune homme dérangé

Mémoires d'un jeune homme dérangé () is the debut novel of the French writer Frédéric Beigbeder, published in 1990. Background Beigbeder wrote Mémoires d'un jeune homme dérangé when he was 24 years old, after Denis Tillinac, then CEO of Éditions de la Table ronde, asked if he written any novel. According to Beigbeder, he quickly put together the notes that formed the basis for the largely autobiographical novel. Plot Marc Marronnier is a young man who parties a lot. He falls in love, which has negative consequences for him. Reception Roland Jaccard of Le Monde asked if Mémoires d'un jeune homme dérangé was "the most snobbish novel of the year?" and wrote that Beigbeder has written a "boy meets girl" story in a simultaneously "terse and incomplete style". References External links Éditions de la Table ronde 1990 French novels 1990 debut novels Novels by Frédéric Beigbeder French autobiographical novels

5790435

https://en.wikipedia.org/wiki/Lewistown%20station

Lewistown station

Lewistown station is an Amtrak railway station located about 60 miles northwest of Harrisburg, Pennsylvania at PA 103 and Helen Street in Lewistown, Mifflin County, Pennsylvania. The station is actually located across the Juniata River from Lewistown proper, a little less than one mile south of the center of the borough. It is currently only served by Amtrak's Pennsylvanian, which operates once per day in each direction, though until 2005, Lewistown was served by a second daily train, the Three Rivers (a replacement service for the legendary Broadway Limited), an extended version of the Pennsylvanian that terminated in Chicago. Upon its cancellation, the sole Pennsylvanian marked the first time in Lewistown's railway history that the town was served by just a single, daily passenger train. A station building exists at the stop, which is open before and during train departure times. However, there is no ticket office at this station, as Amtrak closed the ticket office in 1977. The distance between Lewistown and the next station eastward, the Harrisburg Transportation Center, is the longest distance between stations (61 miles) anywhere along the route between Pittsburgh and New York. The station house, according to volunteers that staff it, is the oldest structure built by the Pennsylvania Railroad which is still standing. The current passenger depot was constructed in 1849 as the freight station, while the Pennsylvania used a nearby three story hotel building as the passenger depot until 1868. Operations were moved into the freight station, while the old brick building became a hotel, restaurant, and a Railway Express Agency. That building was demolished in the 1950s, and currently sits as a small lot. "J" Tower, which was added in the 1870s as a two story-brick tower within the depot, was removed in the 1950s, During restoration of the depot, a replica of "J" Tower was installed into the building. In December 2019, the Mifflin County Planning Commission announced a two-phase transportation study on the improvements needed to the station and infrastructure, and the transportation and traffic flow. This would be a first step toward possibly reopening Amtrak service to Lewistown on the Keystone Corridor. Notes Track numbers: 1 (Amtrak), 2 (Norfolk Southern) Image gallery References Bibliography External links Lewistown Amtrak Station (USA RailGuide -- TrainWeb) Pennsylvania Railroad Technical & Historical Society (PRRT&HS) Amtrak stations in Pennsylvania Stations on the Pittsburgh Line Transportation buildings and structures in Mifflin County, Pennsylvania

45462057

https://en.wikipedia.org/wiki/C.%20G.%20Austin

C. G. Austin

Charles G. Austin (March 18, 1846 – October 21, 1925) was an American politician in the state of Washington. He served in the Washington State Senate from 1889 to 1893. References 1846 births 1925 deaths Republican Party Washington (state) state senators

1269688

https://en.wikipedia.org/wiki/Sender%20Inselsberg

Sender Inselsberg

The Sender Inselsberg (transmitter Inselsberg) is an FM and television-transmission facility on the Großer Inselsberg in Thuringia, Germany. It has two aerial towers, which were built in 1939 and 1974. The transmission tower built in 1939 is a freestanding cylindrical tower built of steel concrete, which carried until the beginning of the 1990s similar to Gerbrandy Tower a guyed steel tube mast on its top. This mast carried the FM- and TV-broadcasting aerials. Nowadays this mast is demounted and there are only small aerials for mobile phone services on its top. The tower is nicknamed because of its cylindrical form "thermos flask". The transmission tower built in 1974 is a freestanding steel tube tower on three feet. This tower which is similar to the tower of transmitter Brocken, which was built at the same time, carries above its legs three platforms for aerials for directional radio services and in its topmost section, protected by layers of glass-reinforced plastic, transmission aerials for FM broadcasting services and TV. Signals transmitted from Inselsberg Analogue television ARD (originally DFF1), VHF channel E5 (Horizontal) 100 kW MDR 3rd Programme (originally DFF2), UHF channel 31 (Horizontal) 500 kW FM radio MDR 1, 92.5 MHz MDR 2, 90.2 MHz MDR 3, 87.9 MHz See also List of towers A Tower External links http://www.skyscraperpage.com/diagrams/?b46970 http://www.skyscraperpage.com/cities/?buildingID=46971 Radio masts and towers in Germany Buildings and structures in Gotha (district) 1939 establishments in Germany Towers completed in 1939 Towers completed in 1974

33311599

https://en.wikipedia.org/wiki/Gemilang%20%28TV%20series%29

Gemilang (TV series)

Gemilang is a Malaysian television drama series Malaysia broadcast by Filmscape in 2011. It features Shalihan, Tiz Zaqyah, Kamal Adli, Tasha Shilla and Datuk Jalaluddin Hassan. It aired on 24 January 2011 after 13 successful episodes. This drama tells us of four youths who opened private schools in remote areas for brighten the future of young children who do not excel in their studies. Plot Saifullah (Shah Jazle) comes from a family of rubber tappers are very difficult when the world hovered around rubber plantation in the 1960s. Saifullah have three more brothers. Four brothers when they were younger, their mother had died. Not long after, their father would join their cause to separate siblings as given to the adoptive family. Saifullah a family of adopted children were, but he never forgot his origin. Saifullah character is a courageous, courageous and strong. Teenager, Saifullah make his teacher, the teacher Talib (Datuk Jalaluddin Hassan) as his mentor. As adults, Saifullah successfully continue their studies and after graduation he worked at the bank in the city. But his struggle to return to their hometowns to contribute to the population. In the spirit of overflowing, Saifullah establish a private school called the Institute of Glory. Gemilang Institute opened in 1977 to provide a second chance to students. Those who fail or who can not take MCE and HSC examinations are most welcome in the school. Saifullah good faith to establish the Institute also supported from her former college friend, Umar (Kamal Adli), Asma (Tiz Zaqyah) and Ruhana (Tasha Shilla). They are all pioneers in the institute's teachers. This is a character drama that depicted the four teachers into their golden years in which the characters are held Aimi Saifullah Jaar, Asmah (Kismah Johari), Umar (Zulkifli Zain) and Ruhana (Aznah Hamid). Cast Main character Shah Jazle as Saifullah Ali Tiz Zaqyah as Asma Kamal Adli as Umar Tasha Shilla as Ruhana Datuk Jalaluddin Hassan as Talib Izzue Islam as Halim Naim Daniel as Saifullah Ali young Azhan Rani as Ali, father to Saifullah Che Kem as father adopted Saifullah The students of the Institute Gemilang Talha Harith as Azlan Munif Isa as Johan Syazwan Zulkifli as Ringgo @ Rizal, son to gambler father Puteri Chi Chi as Dahlia Amin Abu Bakar as Kahar Gregory Sze Lai Huat as Chee Keong Kishz as Raj Nashreen as Hamzah Diandra Arjunaidi as Suzanne Syed Ali sebagai as Saif second brother Chomatt Samad as Sadiq, Saif fourth brother International Broadcasting Indonesia Channel: B Channel References External links TV3 - Gemilang Malaysian drama television series 2011 Malaysian television series debuts 2011 Malaysian television series endings 2010s Malaysian television series TV3 (Malaysia) original programming

33466654

https://en.wikipedia.org/wiki/Pua%20Khein-Seng

Pua Khein-Seng

Pua Khein-Seng (; born 29 June 1974, is regarded in Malaysia as the inventor of USB flash drive. In an interview with The Star, the CEO of Phison Electronics Corp based in Taiwan claims to have incorporated the world's first single chip USB flash drive. He is even regarded as "father of pendrive" in Malaysia. Early life Pua was born parents of a modest background and raised in Sekinchan, Selangor, Malaysia, He completed his schooling at Pin Hwa High School, Klang, Selangor. Pua received his undergraduate education in electrical control engineering at the National Chiao Tung University, Taiwan and has since then resided in Taiwan. References 1974 births Living people Malaysian businesspeople Malaysian people of Chinese descent Malaysian expatriates in Taiwan National Chiao Tung University alumni People from Selangor

49995870

https://en.wikipedia.org/wiki/Run%20for%20Love%20%28disambiguation%29

Run for Love (disambiguation)

Run for Love may refer to: Run for Love (film) (Chinese: Bēn Ài), a 2016 Chinese film "Run for Love!", a comic by Tony Abruzzo which was the base of Roy Lichtenstein's painting Hopeless Run For Love, a road race Armonk, New York "Run for Love", a 1984 song by Winder "Run for Love", a 2007 song by Charlie Dée "Run for Love", a 2011 song by Joan as Police Woman from The Deep Field

59860183

https://en.wikipedia.org/wiki/Nueve%20de%20Julio%20Department%2C%20R%C3%ADo%20Negro

Nueve de Julio Department, Río Negro

Nueve de Julio is a department of the province of Río Negro (Argentina). Municipalities Comicó Cona Niyeu Ministro Ramos Mexía Prahuaniyeu Treneta Sierra Colorada Yaminué References Departments of Río Negro Province

40302162

https://en.wikipedia.org/wiki/Peckoltia%20vittata

Peckoltia vittata

Peckoltia vittata is a species of catfish belonging to the subfamily Hypostominae of the family Loricariidae. Description P. vittata reaches a maximum total length of 15 cm (5.9 inches). The distinctive striped patterning sported by the species has led to it being referred to as the candy-striped pleco or the tiger pleco in the aquarium trade, although it may also be referred to by its L-number, which is L-015. Males can be distinguished from females by the presence of small teeth-like projections or odontodes along the back half of its body. Distribution P. vittata is native to South America, where it occurs in the Amazon basin. It can be found in the Amazon River itself, in addition to the Tapajós, the Madeira River, the Xingu River, the Uatumã River, the Trombetas River, the Capim River, and the Maranhão River. The species has also been reported from the Guaviare River of Colombia, although this is an unconfirmed occurrence. Ecology P. vittata is most frequently observed in rocky areas. It is known to be a nocturnal species that feeds on algae. In the aquarium P. vittata is a popular aquarium fish and requires a tropical softwater tank with a temperature of 22 to 26 °C (71.6 to 78.8 °F) and a pH of around 6. It is often confused with the species Panaqolus maccus. Keeping the species in groups of at least 5, in an aquarium of at least 80 cm (31.5 inches) is recommended. References Loricariidae Fish described in 1881

68346898

https://en.wikipedia.org/wiki/Gazimagomed%20Jalidov

Gazimagomed Jalidov

Gazimagomed Schamilovich Jalidov Gafurova (born 16 March 1995) is a Spanish boxer. He competed in the men's light heavyweight event at the 2020 Summer Olympics. Born in Russia, he arrived in Spain in 2004. Professional boxing record References External links 1995 births Living people Spanish male boxers Light-heavyweight boxers Olympic boxers for Spain Boxers at the 2020 Summer Olympics People from Khasavyurt Russian refugees Russian emigrants to Spain Mediterranean Games bronze medalists for Spain Mediterranean Games medalists in boxing Competitors at the 2022 Mediterranean Games AIBA World Boxing Championships medalists European Games competitors for Spain Boxers at the 2023 European Games

2215291

https://en.wikipedia.org/wiki/1993%20in%20British%20music

1993 in British music

This is a summary of 1993 in music in the United Kingdom, including the official charts from that year. Summary 15 songs reached the number 1 spot this year. Compared to 1992, there was an improvement to singles sales, with sales rising year on year for the first time since 1989. However, none of the singles released this year were million sellers, the first instance of this happening since 1990. The only song to sell over a million in 1993 was one from the previous year, Whitney Houston's cover of "I Will Always Love You". It managed to sell sufficiently well enough to make its way onto the top 10 of both 1992 and 1993. March saw The Bluebells reach number 1 with "Young at Heart", a song that had previously made number 8 in 1984. It was reissued after appearing in an advert for Volkswagen, and the band reformed to promote the song. Take That got their first #1 in July, with "Pray". Debuting in 1991 with the #38 hit "Promises", they would go on to score another seven number 1s before splitting in 1996. "Pray" was followed by Freddie Mercury scoring a posthumous number 1 with a remixed version of "Living on My Own", the original version of which made number 50 in 1985, making it the first remix of a previously charted single to reach number 1. The biggest selling single of the year came from Meat Loaf, who hit #1 for seven weeks from October with "I'd Do Anything for Love (But I Won't Do That)". It came from the album Bat Out of Hell II: Back into Hell, also the biggest selling of the year. Finally, as usual, December saw the Christmas number one single. Meat Loaf's successor at number 1 was Mr. Blobby, a popular character on the BBC One show Noel's House Party, with "Mr. Blobby" (the first ever eponymously titled number 1 single). In the final week before Christmas, he was knocked off by Take That's "Babe", making Mr. Blobby the first one-week #1 since U2's "The Fly" in November 1991, and making Take That the first act to have three singles in a row all enter at #1. However, the following week (Christmas week) saw Mr. Blobby climb back up to the top, the first time this had happened since January 1969, and officially become this year's Christmas number 1. Take That's "Babe" became the only chart topper of the year to spend only a week at the summit. In the classical world, the British composer Michael Nyman enjoyed great success with his soundtrack for the film The Piano, which brought him an Ivor Novello Award, Golden Globe, BAFTA and American Film Institute award; the album sold over three million copies. Veteran Welsh composer Daniel Jones died. A less well-known composer, Peter Reynolds, won notoriety when his three-minute work Sands of Time was performed in Cardiff city centre; it is listed by the Guinness Book of Records as the world's shortest opera. Events 11 February - Still Sorrowing for piano by Thomas Adès is performed for the first time, in the Purcell Room by the composer. 19 February - Elton John is forced to end a concert in Melbourne, Australia a half hour early when a swarm of grasshoppers invades the stage. 27 March – Sands of Time, a short (four minutes long) opera by Welsh composer Peter Reynolds, libretto by Simon Rees, has its world premiere at an outdoor shopping centre in Cardiff, sung by soprano Rhian Owen and baritone Dominic Burns. 16 April – Paul McCartney headlines a concert at the Hollywood Bowl, USA to celebrate "Earth Day". Other performers included Ringo Starr, Steve Miller and Don Henley. 21 April – Former Rolling Stones bassist Bill Wyman marries designer Suzanne Accosta in France. 22 April - The Who's Tommy opens on Broadway. 7 May - The premiere of Harrison Birtwistle's Five Distances for Five Instruments, takes place in London at the Purcell Room, performed by the Ensemble intercontemporain. 31 May - Oasis force their way on to the bill at King Tut's Wah Wah Hut, Glasgow. Alan McGee is in attendance, and then offers the band a recording contract on the spot. 5 June - premiere of Jonathan Harvey's Inquest of Love at the London Coliseum. 28 August - Bruce Dickinson plays his final show with Iron Maiden after announcing his departure from the band earlier in the year. He would rejoin the band in 1999. 7 September - Berthold Goldschmidt‘s 12 minute orchestral work Ciaconna Sinfonica is performed for the first time in the UK by Simon Rattle at the Proms. The 90 year-old composer, resident in London since 1935, takes a bow at the end. 22 October - Oasis sign a recording contract with Creation Records Rick Astley retires from the music industry at age 27 after selling 40 million records in a five-year period. Charts Number-one singles Number-one albums Year-end charts Best-selling singles Best-selling albums Best-selling compilation albums Notes: Music awards BRIT Awards The 1993 BRIT Awards winners were: Best British producer: Peter Gabriel Best soundtrack: "Wayne's World" British album: Annie Lennox: "Diva" British breakthrough act: Tasmin Archer British female solo artist – Annie Lennox British group: Simply Red British male solo artist: Mick Hucknall British single: Take That - "Could It Be Magic" British video: Shakespear's Sister - "Stay" International breakthrough act: Nirvana International solo artist: Prince International group: R.E.M. Outstanding contribution: Rod Stewart Mercury Music Prize The 1993 Mercury Music Prize was awarded to Suede - Suede. Classical music Stephen Caudel - Edel Rhapsody Nicholas Maw - Violin Concerto Opera Michael Nyman – Noises, Sounds & Sweet Airs Births 12 January – Zayn Malik (One Direction) 17 January – Frankie Cocozza, singer 13 February – Sophie Evans, Welsh singer and actress 8 April – TBJZL, Youtuber and rapper 19 June – KSI, Youtuber and rapper 5 July – Hollie Cavanagh, English-American singer 26 July – Stormzy, rapper 29 August – Liam Payne (One Direction) 13 September – Niall Horan (One Direction) date unknown – Dani Howard, composer Deaths 23 April – Daniel Jones, composer, 80 29 April – Mick Ronson, guitarist (The Spiders from Mars), 46 (cancer) 6 May – Ivy Benson, bandleader, 79 22 May – Melville Cook, organist, conductor and composer, 80 28 May – Duncan Browne, singer-songwriter, 46 (cancer) 19 June – Tony Brent, singer, 65 (heart attack) 21 June – Al Fairweather, jazz trumpeter, 66 7 August – Roy Budd, jazz pianist and film composer, 46 (brain haemorrhage) 14 September – Peter Tranchell, composer, 71 30 September – Ronnie Aldrich, jazz musician, 77 11 October – Andy Stewart, singer, 59 9 November – Stanley Myers, film composer, 63 (cancer) 22 November – Anthony Burgess, composer and polymath best known as a novelist, 76 28 November – Tommie Connor, songwriter, 89 29 November – Alan Clare, jazz pianist and composer, 72 6 December – Bryson Graham, rock drummer, 41 12 December – Joan Cross, operatic soprano, 93 24 December – Ralph Downes, organist and music director, 89 See also 1993 in British radio 1993 in British television 1993 in the United Kingdom List of British films of 1993 References External links BBC Radio 1's Chart Show The Official Charts Company British music Music British music by year 20th century in music

70299071

https://en.wikipedia.org/wiki/People%27s%20Freedom%20Party

People's Freedom Party

People's Freedom Party may mean one of the following: People's Freedom Party (Russia) People's Freedom Party "For Russia without Lawlessness and Corruption" Constitutional Democratic Party, also called the People's Freedom Party Constitutional Democratic Party – Party of Popular Freedom, a 1990s Russian political party named after the original Constitutional Democratic Party People's Freedom Party (Nepal)

177864

https://en.wikipedia.org/wiki/House%20of%20Sabah

House of Sabah

The House of Sabah ( Āl Ṣubāḥ) is the ruling family of Kuwait. History Origin The Al Sabah family originate from the Bani Utbah confederation. Prior to settling in Kuwait, the Al Sabah family were expelled from Umm Qasr in southern Iraq by the Ottomans due to their predatory habits of preying on caravans in Basra and trading ships in Shatt al-Arab. According to one oral tradition, the Al Sabah family settled across various regions in southern Iran and Iraq, until they finally settled in what is now Kuwait around the early 1700s. According to another oral tradition, told to the Political Agent by Shaikh Abdulla, the Sabahs fled drought in central Arabia in 1710. They migrated south, but finding conditions still bleaker, returned and now with other families migrated to Zubara, on Qatar's west coast. Conditions there were no better so they migrated again, this time north to Kuwait where, finding water, they settled. On the last leg of the journey that had atabu-ila al-shimal (moved to the north). And that, according to one tradition, was the origin of the name Bani Utub. Soon after founding a settlement in Kuwait, a Sabah became leader, ruling until his death in 1762. Mubarak the Great The reign of Mubarak the Great (1896-1915) forged the critical alliance between Kuwait and Britain. In the late 19th century, resurgent Ottoman power coupled with rising Al-Saud power drew Kuwait closer to the Ottomans. This began to change as the century closed. When Sheikh Mohammed came to power in 1892, disagreements soon arose between him and his brother Mubarak. Muhammad dealt with this by busying Mubarak with affairs outside the capital. In 1896 he summoned his sons, Jabir and Salim, and some supporters and rode to Kuwait, secretly entering Muhammed's house. There he killed Muhammed and his brother Jarrah. In the morning, Mubarak announced that his brothers had died, and that he ruled in their stead. Sheikh Abdullah Al-Salim Sheikh Abdullah Al-Salim Al-Sabah ended the British protectorate status of Kuwait by signing a treaty with the British on 19 June 1961. He introduced the Constitution of Kuwait in 1962, followed by the Parliament in 1963. Gulf War During the Gulf War, the Emir of Kuwait Sheikh Jaber Al- Ahmed Al-Sabah and his government ran the exiled government from a hotel in Ta'if, Saudi Arabia. From Ta'if, Sheikh Jaber set up his government so that its ministers were in communication with the people still in Kuwait. The government was able to direct an underground armed resistance made up of both military and civilian forces and was able to provide public services to the Kuwaiti people who remained, such as emergency care through the funds that it had saved from oil revenues. In the meantime, Sheikh Jaber and his government lobbied to receive military support action against Iraq before and during the Gulf War. When the war ended on 28 February 1991, Sheikh Jaber remained in Saudi Arabia while declaring three months of martial law. By imposing martial law, government officials were able to ensure that there were no Iraqis still in Kuwait who may have attempted to once again overthrow the government. They were also tasked with making sure that the country was safe enough for Sheikh Jaber and his government to return, which they eventually did on 15 March 1991. Public feuds Kuwaiti political scientist Mohammed Alwuhaib has argued that "members of the Al Sabah [have] interfered in and manipulated political and economic factions as a tool to weaken each other, with allegations of corruption a particularly common tactic." In August 2011, supporters of Sheikh Ahmed Al-Fahad Al-Ahmed Al-Sabah "discovered" documents that incriminated up to one-third of Kuwaiti politicians in what quickly became the largest political corruption scandal in Kuwaiti history. By October 2011, 16 Kuwaiti politicians were alleged to have received payments of $350m in return for their support of government policy. In December 2013, allies of Sheikh Ahmad Al-Fahad claimed to possess tapes purportedly showing that Sheikh Nasser Al-Mohammed Al-Sabah and Jassem Al-Kharafi were discussing plans to topple the Kuwaiti government. Sheikh Ahmad Al-Fahad appeared on local channel Al-Watan TV describing his claims. In April 2014 the Kuwaiti government imposed a total media blackout to ban any reporting or discussion on the issue. In March 2015, Kuwait's public prosecutor dropped all investigations into the alleged coup plot and Sheikh Ahmad Al-Fahad read a public apology on Kuwait state television renouncing the coup allegations. Since then, "numerous associates of his have been targeted and detained by the Kuwaiti authorities on various charges," most notably members of the so-called "Fintas Group" that had allegedly been the original circulators of the fake coup video. In December 2015, Sheikh Ahmad Al-Fahad was convicted of "disrespect to the public prosecutor and attributing a remark to the country's ruler without a special permission from the emir's court," issuing a suspended six-month prison sentence and a fine of 1,000 Kuwaiti Dinar. In January 2016, the Kuwaiti appeals court overturned the prior ruling and cleared Sheikh Ahmad Al-Fahad of all charges. In November 2018, Sheikh Ahmad Al-Fahad, along with four other defendants, were charged in Switzerland with forgery related to the fake coup video. Shortly thereafter, Sheikh Ahmad Al-Fahad temporarily stepped aside from his role at the International Olympic Committee, pending an ethics committee hearing into the allegations. In August 2021, Sheikh Ahmed attended court alongside three of the other four defendants. In September 2021, Sheikh Ahmed was convicted of forgery along with the four other defendants. He denied wrongdoing and plans to appeal. In November 2019, former deputy prime minister and minister of interior Sheikh Khaled Al Jarrah Al Sabah was dismissed from office after minister of defense Sheikh Nasser Sabah Al Ahmed Al Sabah filed a complaint with the Kuwaiti Attorney General alleging embezzlement of 240 million Kuwaiti dinars ($794.5 million) of Kuwait government funds had taken place during Khaled's tenure as minister of defense. In July 2020, the US Department of Justice filed an asset forfeiture claim against The Mountain Beverly Hills and other real property in the United States, alleging a group of three Kuwaiti officials, including Sheikh Khaled Al Jarrah, set up unauthorized accounts in the name of the country's Military Attache Office in London, known as the 'Army Fund.' They allegedly funded the accounts with over $100m of Kuwaiti public money and used it for their own purposes. In March 2021, the Kuwaiti ministerial court ordered the detention of Khaled Al Jarrah, who was arrested and imprisoned. On April 13, 2021, a Kuwaiti court ordered the detention of former prime minister Sheikh Jaber Al-Mubarak Al-Hamad Al-Sabah on corruption charges related to the 'Army Fund.' He is the first former Kuwaiti prime minister to face pre-trial detention over graft charges. The crimes allegedly took place during Jaber Al-Sabah's 2001–11 term as defense minister. Rulers 1st Ruler: Sheikh Sabah I bin Jaber: 1752–1762 2nd Ruler: Sheikh Abdullah I: 1762–1814 3rd Ruler: Sheikh Jaber I: 1814–1859 4th Ruler: Sheikh Sabah II: 1859–1866 5th Ruler: Sheikh Abdallah II: 1866–1892 6th Ruler: Sheikh Muhammad Al-Sabah: 1892–1896 7th Ruler: Sheikh Mubarak Al-Sabah: 1896–1915 8th Ruler: Sheikh Jaber II: 1915–1917 9th Ruler: Sheikh Salim Al-Mubarak Al-Sabah: 1917–1921 10th Ruler: Sheikh Ahmad Al-Jaber Al-Sabah: 1921–1950 11th Ruler 1st Emir Sheikh Abdullah Al-Salim Al-Sabah: 1950–1965 12th Ruler 2nd Emir Sheikh Sabah Al-Salim Al-Sabah: 1965–1977 13th Ruler 3rd Emir Sheikh Jaber Al-Ahmad Al-Sabah: 1977–2006 14th Ruler 4th Emir Sheikh Saad Al-Abdullah Al-Salim Al-Sabah: 15–29 January 2006 15th Ruler 5th Emir Sheikh Sabah Al-Ahmad Al-Jaber Al-Sabah: 2006–2020 16th Ruler 6th Emir Sheikh Nawaf Al-Ahmad Al-Jaber Al-Sabah: 2020–present Dean of the House Chieftain, Sheikh Salem Al-Ali Al-Sabah (b. 1926) Governing branches Chieftain Sheikhs of the House of Sabah have been leading the Military of Kuwait since the early establishment of defense infantry and cavalry forces. Since the forming of the first cabinet on 17 January 1962, all three of the defense ministry, interior ministry and ministry of foreign affairs of Kuwait have been led by members of the House of Sabah.<ref name=kuna11>{{cite news|title=Nine ministers headed Interior Ministry since Kuwaits independence|url=http://www.kuna.net.kw/ArticleDetails.aspx?id=2143274&language=en|access-date=15 September 2013|work=KUNA|date=7 February 2011}}</ref> Lineage See also Government of Kuwait Politics of Kuwait References External links kuwait-info.comAl Sabah: History and Genealogy of Kuwait’s Ruling Family 1752-1987 by Alan Rush (Ithaca Press, 1987)Burke’s Ruling Families of the World, Volume 2 (Burke’s Peerage, 1980), includes genealogies and essays on Al-Sabah (Kuwait)Records of Kuwait'' ed., Alan Rush (8 vols. Archive Editions, 1989) Arab dynasties S

47618233

https://en.wikipedia.org/wiki/Nehru%20Stadium%2C%20Kottayam

Nehru Stadium, Kottayam

Jawaharlal Nehru Stadium is a multi-purpose stadium in Kottayam, Kerala. The ground is mostly used for athletics and football. It is one of the Indian stadiums named after Jawaharlal Nehru. The ground has capacity of 18,000 person was established in 1972. The stadium has hosted cricket matches from 1972 to 1993 which in five first-class matches and two List A matches. The stadium went for renovation in 2014 with a swimming pool, synthetic track, basketball & tennis courts etc. External links Wikimapia Cricketarchive References Multi-purpose stadiums in India Football venues in Kerala Sports venues in Kerala Buildings and structures in Kottayam district Athletics (track and field) venues in India Monuments and memorials to Jawaharlal Nehru Sport in Kottayam 1972 establishments in Kerala

2195094

https://en.wikipedia.org/wiki/Kevin%20of%20the%20North

Kevin of the North

Kevin of the North is a 2001 American comedy film directed by Bob Spiers. It stars Skeet Ulrich, Natasha Henstridge, Leslie Nielsen, and Rik Mayall and is about an Alaskan Iditarod Trail Sled Dog Race in which Kevin Manley, whose grandfather has passed on and now must participate in the state's Iditarod Trail Sled Dog Race in order to prove he's worthy enough for his grandfather's estate. The film was released to DVD in the United States with the alternate title of Chilly Dogs on February 4, 2003. Plot Kevin Manley (Skeet Ulrich), a Los Angeles travel agent, receives the message that his grandpa has passed and left everything to him. However, he must go to Alaska in order to collect his inheritance. He leaves Canoga Park (Los Angeles), quits his job, despite his boss warning him that he will give up and decide to come back begging for his job back, and heads to Anchorage, Alaska. Upon arrival, Manley finds out that if he proves he is manly by participating in the yearly Iditarod Trail Sled Dog Race he can obtain the land that his grandfather left to him and if he doesn't participate, the land wouldn't be signed over. While in Alaska, he meets some other participants including: the beautiful Bonnie Livengood (Natasha Henstridge), the stupid English Carter (Rik Mayall), ex-sheriff Ned Parker (Lochlyn Munro) and the local attorney Clive Thornton (Leslie Nielsen) who initially informed him of conditions of the race. Manley eventually discovers a box of various items that had belonged to his grandfather that included a fur cap and coat, a sword, and a diary which informed Manley that his grandfather had found gold on the land with a relative of a participant he had met earlier, Bonnie Livengood. While preparing for the event, two other participants, Clive and Carter, attempt to sabotage Manley's chances at winning the race so they can get the land and the gold. Clive promises to pay Carter a thousand dollars if he could prevent Kevin from entering or even finishing the race. Carter succeeds in stealing Kevin's team of huskies and burning down the shed containing his sled, tent, and supplies. Despite his losses, Kevin uses some of his remaining savings to buy a new sled, a tent, some winter clothing, and food supplies for him and his dogs. He also buys a new team of dogs to replace the ones he lost: Farty, a Nova Scotia Duck Tolling Retriever, Trooper, a German Shepherd, Pierre, a black poodle, Barker, a large dark-brown wiry-haired mongrel, Gumly, a large St. Bernard, Snowflake, a white American bulldog, and a Jack Russell terrier named Riddles. After the Iditarod race begins and the teams head off into the wilderness, Kevin begins to learn how to survive on the trail and face the perils that seem to pull on him. He and his dogs begin to form a bond of friendship. Along the trail, Kevin rescues Bonnie from Parker, who was in the process of trying to rape her, and gives him the "Canoga Park Coffee Zap", in which he pours hot coffee on his private area. Shortly afterwards, Bonnie and Kevin form a deep relationship and fall in love with each other. Clive and Carter, who are both anxious to have Kevin lose, try several plans to stop Kevin from finishing the race. Carter cuts half of one of the lines attached to the sled, in which it snaps free as the team rush on down the trail and Kevin has an accident, but is rescued by an Indian tribe and nursed back to health. Another night, Clive and Carter scatter strips of meat around the camp, which attracts a grizzly bear that tears down Kevin's tent and scares him and his dogs off. After the duo blow up Kevin's grandfather's cabin with dynamite, Kevin soon finds out of Clive's and Carter's plan and warn them both to stay away from him and his team. While camping in a snow cave during a blizzard, Bonnie and Kevin discover a map inside Kevin's jacket that belonged to his grandfather. The map tells them of a place known as Wolf Mountain, where Kevin believes that his grandfather hid his gold. When the storm clears, they reach Wolf Mountain and recovered the chest full of gold nuggets underneath the snow. Unfortunately, Clive and Carter arrive, take the chest of gold, and take Bonnie hostage after burying Kevin in the spot where they uncovered the gold. However, Kevin orders his lead dog, Farty to dig him out and he follows Clive and Bonnie all the way to Nome, which is the finish line of the Iditarod Sled Dog race. He manages to beat Parker and Carter, wins the race, and races onward to cut off Thornton's escape. He rescues Bonnie and Clive draws out a gun and fires at them, but he misses. The bullet glances off several metal objects inside an abandoned garage and finally hits an oil barrel, which blows up the garage with Clive inside it. At the same moment, the gold survives the explosion and falls around Bonnie and Kevin, who are surprised and overjoyed. Clive, who had recently survived the explosion, and Carter are arrested for their actions against Kevin and Bonnie, and Kevin is rewarded with the prize money of the race, a gold cup, and a bouquet of flowers, which he gives to Bonnie. He asks Bonnie to marry him and she happily agrees. With some of the prize money and his grandfather's gold, Bonnie and Kevin get married, build a new cabin, and settle down with their dogs and their first child, a baby girl. Cast Skeet Ulrich as Kevin Manley: The main character sent up to Alaska to collect his grandfather's inheritance by competing in a dog race. Natasha Henstridge as Bonnie Livengood: A participant in the Iditarod Trail Sled Dog Race. Rik Mayall as Carter: A participant in the Iditarod Trail Sled Dog Race and an accomplice in attempting to stop Manley from winning the sled dog race. Lochlyn Munro as Ned Parker: The ex-sheriff of the town. Leslie Nielsen as Clive Thornton: A local attorney who's keen on the property Manley is in the area for. He attempts to gain the land due to the gold in it through sabotaging Manley in a variety of ways. Jay Brazeau as Mr. Riskind Production Filming for Kevin of the North took place in Vancouver. Reception The Toronto Star was critical of the film, criticizing Ulrich as a "Johnny Depp-wannabe" and calling it "deservedly obscure". Midland Reporter-Telegram gave Kevin of the North a grade of F, writing that " The one really amazing thing about this film comes from its writer, William Osborne. Who would ever think the guy who penned "Twins" and "Stop! Or My Mom Will Shoot" would still be working in Tinseltown?" References External links 2001 films 2001 comedy films American comedy films Mushing films Films set in Alaska Films shot in Alaska 2000s English-language films 2000s American films Screen Media films Films with screenplays by William Osborne (writer) Films about inheritances

4391731

https://en.wikipedia.org/wiki/Saccopharynx

Saccopharynx

Saccopharynx is a genus of deep-sea eels with large mouths, distensible stomachs and long, scaleless bodies. Commonly, these fish are called gulpers or gulper eels. It is the only genus in the family Saccopharyngidae, and is part of the derived lineage of the "saccopharyngiforms," which includes other mid-water eel species. The name is from Latin saccus meaning "sack" and Greek φάρυγξ, pharynx. They are generally black in color, and can grow to lengths of 2 m (6.5 feet). They have been found at depths of , and are known to inhabit the eastern and western Atlantic Ocean and the Gulf Stream. Their tails are tipped by a luminous, bulb-shaped organ. The exact purpose of this organ is unknown, although it is most likely used as a lure, similar to the esca of anglerfish. Species The genus has ten recognized species: Saccopharynx ampullaceus Harwood, 1827 (Gulper eel) Saccopharynx berteli Tighe & J. G. Nielsen, 2000 Saccopharynx harrisoni Beebe, 1932 Saccopharynx hjorti Bertin, 1938 Saccopharynx lavenbergi J. G. Nielsen & Bertelsen, 1985 Saccopharynx paucovertebratis J. G. Nielsen & Bertelsen, 1985 Saccopharynx ramosus J. G. Nielsen & Bertelsen, 1985 Saccopharynx schmidti Bertin, 1934 (Whiptail gulper) Saccopharynx thalassa J. G. Nielsen & Bertelsen, 1985 Saccopharynx trilobatus J. G. Nielsen & Bertelsen, 1985 References Saccopharyngidae Ray-finned fish genera Marine fish genera Deep sea fish Taxa named by Samuel L. Mitchill

37239305

https://en.wikipedia.org/wiki/Brick%20Mower

Brick Mower

Brick Mower (sometimes stylized brick mower) are a punk rock band formed in 2009 in New Brunswick, New Jersey. After self-releasing an album and two EPs on their own imprint Viking On Campus and touring with Black Wine, the band signed to Don Giovanni Records. Discography Full length records EPs References External links Don Giovanni Records Official Website Musical groups established in 2009 Pop punk groups from New Jersey Don Giovanni Records artists New Brunswick, New Jersey Musical groups from New Brunswick, New Jersey

68522104

https://en.wikipedia.org/wiki/John%20Hadfield%20%28musician%29

John Hadfield (musician)

John Hadfield is an American jazz drummer, composer, and percussionist. Hadfield was born and raised in Missouri. He studied music at University of Nevada, Las Vegas and the University of Missouri, Kansas City Conservatory, before moving to New York. He performs with a number of musicians and ensembles including Kinan Azmeh, Ron Blake, Petros Klampanis, Nguyên Lê, Yo-Yo Ma’s Silk Road Ensemble, Lenny Pickett, and Kenny Werner. Life and career Born in Missouri, Hadfield began to play the drums as a child. He studied music as an undergraduate student at University of Nevada, Las Vegas before earning a Master’s degree at the University of Missouri, Kansas City Conservatory. He then settled in New York where he has been performing and composing for a variety of genres, in particular Jazz, world music, and classical and contemporary music. Hadfield currently teaches at NYU’s Jazz studies department. Hadfield has performed with a number of musicians and ensembles around the world including Kinan Azmeh, Ron Blake, Petros Kampanis, Nguyên Lê, Yo-Yo Ma’s Silk Road Ensemble, Lenny Pickett, and Kenny Werner. Hadfield was described by Modern Drummer magazine in 2016 as having “created hybrid drumkit/percussion setups that ingeniously serve[] the music . . . His skillful sound-weaving choices create the illusion of a seamless multi-percussion section.” Hadfield released three albums of his own compositions, John Hadfield’s Paris Quartet (2022), The Eye of Gordon (2008), and Displaced (2010). His most recent album, Paris Quartet, was hailed by one of the leading Belgian daily newspapers, Le Soir, as "very successful, the musicians are in perfect osmosis, the Rhodes developing its atmospheres, the sax its volutes, the percussion its rhythms, the base its counterpoints. Everything lands exactly at the right place. And the listener is happy." Hadfield has composed for many projects, including Heard by Others, a duo with Lenny Pickett, For James, a collaboration with Ron Blake, Believers, a trio with Brad Shepik and Sam Minaie, the electronic group Earspeak with Boris Skalsky, as well as the feature-length documentary After Spring. In 2017, reviewing Petros Klampanis' Chroma, Downbeat wrote, "Drummer John Hadfield is an ideal purveyor of Klampanis’ vision. Using a hybrid kit of traditional drumkit pieces and mounted percussion, he spurs on the ensemble with sensitive, yet infectiously grooving layers." In 2021, reviewing the Believers’ album, All About Jazz wrote, “Hadfield's contributions belong among the more rhythmically engaging cuts of the spectrum. First ostinato-based, then loudly improvised, "Seven Crotales" unveils groovy bass lines and spacey guitar work which is elaborated on again later, throughout "Nomadic Days.” The same year, French Jazz website Citizen Jazz published a review of Hadfield’s single For James honoring James Baldwin, poetically noting that he “deployed a clever and joyful beat, . . . a dew of happiness.” Hadfield has also been heard playing drum and percussion on various TV shows and movies, including Saturday Night Live, P.O.V (TV Series documentary), The Light in Her Eyes, and Chuck Jones: Memories of Childhood. Discography As a leader or collectives: John Hadfield's Drum of Stories (2023) In A Circle Records John Hadfield’s Paris Quartet (2022) Outhere John Hadfield “For James”  with Ron Blake (2021) Palindrome 76 Records Lenny Pickett and John Hadfield “Heard by Others”  (2020) Orenda Records Believers with Brad Shepik, Sam Minaie and John Hadfield “Believers”  (2020) Orenda Records John Hadfield “Displaced” (2010) Palindrome 76  Records John Hadfield “The Eye of Gordon” (2008) Palindrome 76 Records Appears on: Brian Landrus "Red List" (2022) Palmetto David Wax Museum “Euphoric Ouroboric” (2021) Mark of the Leopard Kane Mathis "Geminus" feat. Sam Minaie and John Hadfield (2021) Nyaato Atlantico "A Stovepipe Hat Made From Silk" (2021) La Fabrica’son Maria Manousaki "Sole Voyage" (2020) PKmusic Nguyen Le Streams Quartet (2019) ACT Records Magic Moments 12 “One World of Music” (2019) ACT Records Joel Harrison “Free Country Volume 3” (2019)  HighNote Records Angel Gil-Ordóñez / Perspectives Ensemble “Falla: El amor brujo; El retablo de Maese Pedro” (2019) Naxos Petros Klampanis “Chroma” (2017) Motema Music David Lopato “Gending for a Spirit Rising” (2017) Petro Klampanis “Minor Dispute”  (2015)  Cristal Records Benjamin Koppel "Breaking Borders #4" featuring Uri Caine, John Hadfield and Kinan Azmeh (2015) Cowbell Fun Home (Broadway Cast Recording) (2015)  PS Classics Judy Kuhn “Rodgers, Rodgers & Guettel” (2015) PS Classics Duo Lev-Yulzari "Azafea"(with Frank London & John Hadfield) (2014) Editions De L'iemj Emilio Teubal “Musica Para Un Dragon Dormido” (2013) BJU Records Uri Sharlin & The Dogcat Ensemble “Back to the Woods” (2013) Folk Dune Cristina Pato “Migrations: Roots and Jazz in NYC” (2013) Sunnyside Suphala “Alien Ancestry” (2013) Tzadik Kinan Azmeh CityBand “Elastic City” (2012) Huda Asfour “Mars (Back and Forth)”  2012 Christmas from the Blue Note (2010) Half Note Records Yo Yo Ma and Friends Songs of Joy and Peace (2009) SONY (2010 GRAMMY Award Winner for Best Classical Crossover Album.) Dead Heart Bloom “Strange Waves” (2010) Dead Heart Bloom “Oh Mercy” (2008) Dead Heart Bloom “Fall In” (2008) Dead Heart Bloom “In Chains” (2008) Skye Steele “Later Bloomer” (2007) Harel Shachel  & Anistar “Esh” 2005 The Common Gene References External links John Hadfield’s official page Modern Drummer article The Rudimental Podcast featuring John Hadfield American jazz drummers American percussionists Year of birth missing (living people) Living people

39658097

https://en.wikipedia.org/wiki/168th%20Aero%20Squadron

168th Aero Squadron

The 168th Aero Squadron was a United States Army Air Service unit that fought on the Western Front during World War I. The squadron was assigned as a Corps Observation Squadron, performing short-range, tactical reconnaissance over the IV Corps, United States Second Army sector of the Western Front in France, providing battlefield intelligence. The squadron saw limited combat, and with Second Army's planned offensive drive on Metz cancelled due to the 1918 Armistice with Germany, the squadron was assigned to the United States Third Army as part of the Occupation of the Rhineland in Germany. The squadron returned to the United States in July 1919 and was demobilized. The squadron was never reactivated and there is no current United States Air Force or Air National Guard successor unit. History Origins The 168th Aero Squadron was organized on 12 December 1917 at Kelly Field, Texas, with 154 recruits being assigned to the squadron on the 19th. The squadron began a program of drill and indoctrination into the Air Service. On 18 December, the squadron was ordered to report to the Aviation Concentration Center, Hazelhurst Field, Long Island, and arrived on 26 December for overseas duty. There, about 60 members of the squadron were placed in training schools for three weeks while the remainder performed guard duty and camp maintenance duty. On 31 January 1918, the squadron was ordered to report to the United States Port of Entry, Hoboken, New Jersey and boarded HMS Adriatic. The crossing of the Atlantic was uneventful, Adriatic being in a convoy of 14 ships, arriving at Liverpool, England on 16 Funerary. From Liverpool, the squadron traveled by train to the Ramsey Rest Camp, Winchester. Training in England After spending 11 days at Ramsey, the 168th was assigned to the Royal Flying Corps (RFC) for training. The squadron was divided into four flights, A, B, C, and D. A and B Flights were sent to RFC Tedcester in Yorkshire and C and D Flights were sent to RFC Doncester, also in Yorkshire to be trained by the British in aircraft assembly, engine repair, motor vehicles and other aspects of operating a combat squadron on the front. After five months of training, the squadron was re-assembled at Flower Down Rest Camp, Winchester on 7 August 1918. A final inspection there was made, and preparations were made for the squadron to be sent into combat in France. On 11 August, orders were received for the 168th to proceed to the Air Service Replacement Concentration Center, St. Maixent Replacement Barracks in France. The squadron first went to Southampton for the cross-channel trip to Le Havre, reaching St. Maixent on 14 August where the 168th was classified as a Corps Observation squadron. From there, the squadron proceeded to the Air Service Production Center No. 2., Romorantin Aerodrome, on 19 August where the squadron received Dayton-Wright DH-4 aircraft. The next stop on the journey to the front lines was to the 1st Air Depot at Colombey-les-Belles Airdrome on 26 August where the men of the squadron were fully equipped and given gas mask training. Next, on 2 September, a move was made to Autreville Airdrome where for the next five weeks, the squadron trained on the DH-4s and performed camp duties. Toul Sector Finally, on 5 October, the 168th moved to Croix de Metz Aerodrome, near Toul, where the squadron was assigned to the IV Corps Observation Group, Second Army and immediately began preparations for active combat service. Initially, the squadron flew patrols with the 8th Aero Squadron, acting as protection for their planes and also enabling the pilots to acquaint themselves with the Toul Sector. Beginning on 12 October, the 168th formally took over the observation area for the 7th Infantry Division and began flying combat observation missions. The squadron flew about ten sorties per day, with a few exceptions when weather limited operations. During the first few days of active flying, the squadron did not encounter any enemy aircraft. However, by 30 October, the sky was full of enemy Fokkers, generally found in groups of five to seven. On that day, Lieutenants Myers and McCollough with Lieutenants White and Bruett as protection were attacked by a group of five enemy aircraft. One of the enemy aircraft managed to get on the tail of one of the protection aircraft but Lt. Myers placed his aircraft in a position which enabled Lt. McCollough to shoot it down. On the same day, three other combats were reported. After that day, each mission was met and attacked by Enemy Aircraft. On 3 November, a squadron plane on a photo-reconnaissance mission passed near an enemy observation balloon and fired on it. As luck would have it, the squadron had just received a supply of incendiary bullets which had been loaded in the aircraft's machine guns. By good shooting the balloon was hit and set on fire. A shared credit of the downing of this ballon was with a 135th Aero Squadron plane {Observer John F. Curry} Up until the Armistice on 11 November, the squadron flew observation, artillery adjustment and photo-reconnaissance missions to support the 7th Division as they advanced. During the combat the squadron was engaged in, two Distinguished Service Crosses, were awarded to Lieutenant Pandell and Lieutenant Armstrong, both on 4 November for flying extremely hazardous missions over enemy territory. Third Army of Occupation With the end of hostilities, the squadron first moved to the 2d Air Instructional Center at Tours Aerodrome on 24 November, where the squadron was called upon to cover 45 sq. miles of the Hindenburg Line with aerial photography. The squadron photographed 8 of the 11 Metz forts & photographed everything on the surface of the ground. After the Hindenburg line was photographed, the 168th was then assigned to Weißenthurm Airdrome, Germany to serve as part of the occupation force of the Rhineland under the Third Army Air Service, III Corps Observation Group. There, the squadron was able to perform test flights on surrendered German aircraft. Flights of the Fokker D.VII, Pfalz D.XII, Halberstadts and Rumpler aircraft were made and evaluations were made. Demobilization On 18 June 1919, orders were received from Third Army for the squadron to report to the 1st Air Depot, Colombey-les-Belles Airdrome to turn in all of its supplies and equipment and was relieved from duty with the AEF. The squadron's planes were delivered to the Air Service Production Center No. 2. at Romorantin Aerodrome, and there, practically all of the pilots and observers were detached from the squadron. Personnel were subsequently assigned to the commanding general, services of supply, and ordered to report to one of several staging camps in France. There, personnel awaited scheduling to report to one of the base ports in France for transport to the United States. The squadron arrived at Camp Mills, New York in late July 1919. There most of the men returned to civilian life, being discharged from Army service. Lineage Organized as 168th Aero Squadron, on 12 December 1917 Re-designated: 168th Aero Squadron (Corps Observation), on 14 August 1918 Demobilized on 22 July 1919 Assignments Post Headquarters, Kelly Field, 12 December 1917 Aviation Concentration Center, 26 December 1917 Air Service Headquarters, AEF, British Isles Attached to the Royal Flying Corps for training, 16 February – 11 August 1918 Air Service Replacement Concentration Center, 14 August 1918 Air Service Production Center No. 2., 19 August 1918 1st Air Depot, 26 August 1918 IV Corps Observation Group, 12 October 1918 2d Air Instructional Center, 24 November 1918 III Corps Observation Group, 15 April 1919 1st Air Depot, 12 May 1919 Commanding General, Services of Supply, May–June 1919 Eastern Department, July 1919 Stations Kelly Field, Texas, 12 December 1917 Aviation Concentration Center, Garden City, New York, 26 December 1917 Port of Entry, Hoboken, New Jersey Overseas transport: RMS Adriatic, 31 January – 16 February 1918 Liverpool, England, 16 February Ramsey Rest Camp, Winchester, England, 17 February 1918 Squadron divided into flights for training: A&B Flight to RFC Tedcester; C&D Flight to RFC Doncester Flower Down Rest Camp, Winchester, England, 7 August 1918 St. Maixent Replacement Barracks, France, 14 August 1918 Romorantin Aerodrome, France, 19 August 1918 Colombey-les-Belles Airdrome, France, 26 August 1918 Autreville Airdrome, France, 2 September 1918 Croix de Metz Aerodrome, Toul, France, 5 October 1918 Tours Aerodrome, France, 24 November 1918 Weißenthurm Airdrome, Germany, 15 April 1919 Colombey-les-Belles Airdrome, France, 12 May 1919 France, May–July 1919 Camp Mills, New York, c 15–22 July 1919 Enemy aircraft flown for evaluation Evaluated Fokker D.VII, Pfalz D.XII, Halberstadt and Rumpler aircraft, 1919 Combat sectors and campaigns Notable personnel Lt. Rodney M. Armstrong, DSC Lt. Elmer Pendell, DSC 2nd Lt Barney M. Giles DSC: Distinguished Service Cross See also List of American aero squadrons Organization of the Air Service of the American Expeditionary Force References Squadrons of the United States Army Air Service Squadrons of the United States Army Air Service in World War I Military units and formations established in 1917 Military units and formations disestablished in 1919

70892866

https://en.wikipedia.org/wiki/Admiral%20Field

Admiral Field

Admiral Field may refer to: Arthur Mostyn Field (1855–1950), British Royal Navy admiral Edward Field (Royal Navy officer) (1828–1912), British Royal Navy admiral Frederick Field (Royal Navy officer) (1871–1945), British Royal Navy admiral See also Evelyn J. Fields (born 1949), National Oceanic and Atmospheric Administration Commissioned Officer Corps rear admiral

10374780

https://en.wikipedia.org/wiki/Anbar%20Salvation%20Council

Anbar Salvation Council

Anbar Salvation Council ( ) is a collection of tribal militias in the Al Anbar province of Iraq, formed by former Ba'athists and nationalists to fight al-Qaeda in Iraq and other associated terrorist groups. In Arabic the council is known as Sahawa Al Anbar (Arabic: صحوة الأنبار), abbreviated SAA when referred to by the US Army. The council has become a model for awakening movements across Iraq, though the Iraqi Defense Ministry has said that it plans to disband the Awakening groups due to concerns about their origins and future intent. History Shortly after the invasion in 2003, Sunni tribal leaders and former Ba'athists, led by members of the Al-Kharbit (Khalifa) and Al-Gaoud (Nimr) families met to select former Ba'ath General Karim Burjis as their unofficial leader and new Governor of Anbar Province. Burjis was later recognized by the coalition, and remained in office until 2004, when he was forced to resign by AQI as a condition to their release of kidnapped family members. This meeting 2003 was the first attempt by Sunni tribal and nationalist leaders to self-organize and re-establish order in Al Anbar. Many of those who participated in this initial meeting fled the country for the safety of the growing ex-pat community in Amman, Jordan to include the paramount sheikhs of the Khalifa and Alwani. In 2005, tribal leaders again attempted to form a counter-AQI body, and organized the Anbar People's Committee. This should not be confused with the Anbar Peoples Congress - a coalition of tribal leaders residing in Amman, Jordan. The Anbar People's Committee was headed by the paramount sheikh of the Albu Fahad - Sheikh Walid Abd al Karim Mukhlif Fahadawi. He was kidnapped from his home by AQI terrorists dressed as Iraqi Police and murdered. After his murder, and the murder of several other APC leaders by AQI, the APC disbanded. This was the second official attempt at organizing an indigenous anit-AQI movement. After the murder of Sheikh Walid Fahadawi, an anti-AQI vigilante group known as Thwar-al-Anbar (the Anbar Revolutionaries) was formed by individuals across Anbar to include Hameed al-Haiys Thiyabi, Muhammad al-Haiys Thiyabi, Jabar Fteykhan Rishawi, Aifan Sadoon Issawi, Jassim Muhammad Suwaydawi, as well as others from the Albu Fahad and Albu Bali tribes. The group's core members most likely never exceeded 30 members, yet had a disproportionately high impact in the fight against AQI, and the birth of the Awakening. TAA conducted their own murder and intimidation campaign in an attempt to out-terrorize the terrorists. Their operations resulting in the killing of numerous AQI emirs, and further reinforced the growing hostility toward AQI in Ramadi and Fallujah. TAA never officially disbanded, and those who survived their anti-AQI campaign served as the nucleus of what was to become the Awakening - Sahwah al-Anbar (SAA). In August 2006, members of AQI operating in Al Ramadi, murdered a prominent member of the Albu Ali Jassim tribe, decapitated his dead body, and refused to allow the body to be returned per Muslim custom for burial within the traditional 3-day period. Following this incident, members of AQI next threatened to murder women affiliated with the Albu Ali Jassim in Ramadi. In response to the threat and murder of a prominent member, leaders within the Albu Ali Jassim, to include the murdered man's sons, sought assistance from other Anbar tribal leaders to include former members of TAA—Hameed al Haiys, Jassim Suwaydawi, and Jabar Rishawi—younger brother of Sheikh Abu Sattar Albu Risha. This is generally considered the beginning of SAA and the "Awakening." commonly considered the last straw and the spark that created the Al Anbar Salvation Council. To counter AQI, Sheikh Sattar, a former insurgent leader affiliated with the Numan Brigade in Ramadi, officially organized SAA—which included in its leadership Hameed al Haiys, Jassim Suwaydawi, Wissam Hardan Al Aithawi, Sheikh Ali Hatim al Sulayman, Abdullah Jallal al Faraji, Waleed Albu Ali Jassim, and Aifan Sadoon al Issawi. Sattar had himself been victimized by AQI—with his brother and father murdered. While Wissam Hardan, Ali Hatem, and Aifan Sadoon all represented elite families within the tribes of Anbar, the majority of individuals within the SAA leadership were from families considered second and third-tier within their tribal hierarchy. This would create significant problems for coalition forces in Al Anbar who were faced with the decision of supporting the traditional tribal elite (most of which had fled to Amman, Jordan during the worst AQI violence) upon their return, or the "new" leadership represented by those affiliated with SAA. In November 2006, a force of approximately 70 AQI fighters attacked the compound of Jassim Suwaydawi. Aided by coalition forces, Jassim's small force of 17 family members held-off the attacking force, killing and wounding the vast majority. This is commonly referred to as the Battle of Sofia, and marks another turning point in the power of AQI over the tribes of Al Anbar. As retribution for his defiance, Jassim's sister was abducted by members of AQI, and murdered by being dragged behind a vehicle. Her body was then decapitated, and head placed upon a pike in the middle of Sofia in an attempt to cause Jassim to come fight to retrieve it. Over the next several months, Sattar encouraged members of the tribes affiliated with SAA to join the Iraqi Police. Elements of the Army Brigade stationed aboard traditional Albu Risha land now called Camp Ramadi, were instrumental in getting these recruits organized, trained, and equipped. In addition to their decision to support the Iraqi Police, tribal militias were organized across Anbar into what became known as PSFs (Provincial Security Forces), and were ultimately accepted by the Ministry of Interior. These forces later were attacked by the first chlorine gas suicide vehicle-born improvised explosive device (SVBIED) in late January, 2007, killing over 17 of their forces and demonstrating the threat Al Qaeda in Iraq considered these local security forces. Fighting against the Americans in the earlier phases of the war, elements of this group have since allied themselves with the U.S. to rid their country of foreign extremist composing mainly of al-Qaeda in Iraq. It has been reported that they have received cars, guns, and ammunition by the Iraqi and U.S. forces to counter the radical Islamists in Al-Anbar province. In recent months elderly sheiks and tribal leaders have turned away from the Islamic State of Iraq, a radical Sunni extremist terrorist organization who specializes in car bombs and suicide attacks. On May 1, 2007 the Anbar Salvation Council announced that it had killed Abu Ayyub al-Masri, the war minister of the Islamic State of Iraq and the leader of al-Qaeda in Iraq. However, the U.S. military has refuted this claim and the status of al-Masri is still uncertain. While it is unknown if the Al Anbar Salvation council killed Abu Ayyub Al Masri, during the first few months of the council's existence, it is said that they killed more high level insurgents than US forces in the area. Founding Sheik Abdul Sattar Buzaigh al-Rishawi was a Sunni leader in the Al-Anbar province leading a growing movement of Sunni tribesmen who have turned against al-Qaida-linked insurgents. Al-Rishawi, whose father and three brothers were killed by al-Qaida assassins, said insurgents were "killing innocent people, anyone suspected of opposing them. They brought us nothing but destruction and we finally said, enough is enough." Al-Rishawi founded the Anbar Salvation Council in September 2006 with dozens of Sunni tribes. Many of the new newly friendly leaders are believed to have at least tacitly supported the insurgency in the past, though al-Rishawi said he never did. His movement, also known as the Anbar Awakening, now counts 41 tribes or sub-tribes from Anbar, though al-Rishawi acknowledges that some groups in the province have yet to join. It's unclear how many that is, or much support the movement really has. On September 13, 2007, al-Rishawi was killed along with two of his bodyguards by a roadside bomb near his home in Ramadi, Anbar, Iraq. Membership and organization Sheikh Ahmed Abu Risha is the current head. Assassinated members Abdul Sattar Buzaigh al-Rishawi – former leader of the Anbar Salvation Council Fasal al Gaood – former governor of al Anbar province See also 2005 in Iraq 2006 in Iraq 2007 in Iraq Al Qaeda in Iraq Civil war in Iraq Iraq War troop surge of 2007 Sons of Iraq References External links 'Anbar model' under fire The Christian Science Monitor Indigenous counterinsurgency forces Non-military counterterrorist organizations Non-military counterinsurgency organizations Iraq–United States relations Military of Iraq Occupation of Iraq Politics of Iraq War on terror

30726763

https://en.wikipedia.org/wiki/The%20Morning%20Passengers%20EP

The Morning Passengers EP

The Morning Passengers EP is the acoustic sessions album recorded and produced by Green River Ordinance. GRO returns to their Texas roots by opening with folky strumming and picking on this brand new acoustic soundtrack. This in combination with rootsy gear like harmonica, banjo, mandolin and warm tones from an old Hammond organ allow GRO to create some raw, acoustic tones that customers have loved. Track list "Dancing Shoes" "Uncertainly Uncertain" "Undertow" "Inward Tide" "Out of the Storm" "Where the West Wind Blows" Charts References 2010 albums Green River Ordinance (band) albums

14032302

https://en.wikipedia.org/wiki/NSP2%20%28rotavirus%29

NSP2 (rotavirus)

NSP2 (NS35), is a rotavirus nonstructural RNA-binding protein that accumulates in cytoplasmic inclusions (viroplasms) and is required for genome replication. NSP2 is closely associated in vivo with the viral replicase. The non-structural protein NSP5 plays a role in the structure of viroplasms mediated by its interaction with NSP2. References Rotaviruses Viral nonstructural proteins

7741838

https://en.wikipedia.org/wiki/Second%20League%20of%20the%20Republika%20Srpska

Second League of the Republika Srpska

The Second League of the Republika Srpska () is a third level football league competition in Bosnia and Herzegovina. It is divided into two leagues, based on geographical areas. The winner of each league is promoted to the First League of the Republika Srpska. Clubs at the bottom of the table are relegated to the respective regional leagues. Member clubs for 2020–21 East (Istok) FK Bratstvo Bratunac FK Budućnost Pilica FK Drina HE Višegrad FK Famos Vojkovići FK Glasinac 2011 FK Guber Srebrenica FK Ilićka 01 Brčko FK Jedinstvo Brodac FK Milići FK Mladost Gacko FK Mladost Rogatica FK Proleter Dvorovi FK Romanija Pale FK Stakorina Čajniče FK Velež Nevesinje FK Vlasenica West (Zapad) FK Borac Šamac OFK Brdo Hambarine FK Čelinac FK Dubrave FK Jedinstvo Žeravica FK Laktaši FK Mladost Donja Slatina FK Omarska FK Polet 1926 FK Progres Kneževo FK Proleter Teslić FK Sloboda Mrkonjić Grad FK Sloga Srbac FK Sloga Trn External links Football Association of Republika Srpska 3 2

52943807

https://en.wikipedia.org/wiki/American%20Outdoor%20Brands

American Outdoor Brands

American Outdoor Brands, Inc., formerly known as Smith & Wesson Holding Corporation until 2016, is an American manufacturer of outdoor sports and recreation products, with a current 18 brands of outdoor equipment. Until 2020, it owned Smith & Wesson firearms, when American Outdoor Brands was spun out, partly due a changing political climate. Its headquarters is located in Columbia, Missouri. History On May 11, 2001, Saf-T-Hammer Corporation acquired Smith & Wesson Corporation from Tomkins plc for US$15 million. Saf-T-Hammer assumed US$30 million in debt, bringing the total purchase price to US$45 million. Saf-T-Hammer, a manufacturer of firearms locks and other safety products, purchased the company with the intention of incorporating its line of security products into all Smith & Wesson firearms in compliance with the 2000 agreement. On February 15, 2002, the name of the newly formed entity was changed to Smith & Wesson Holding Corporation. Smith & Wesson Holding Corporation announced in December 2014 that it was paying $130.5 million for Battenfeld Technologies, a Columbia, Missouri-based designer and distributor of hunting and shooting accessories. The company made the acquisition with the eventual intent to merge all its existing Smith & Wesson, M&P and Thompson Center Arms accessories into a single division. In August 2016, Smith & Wesson Holding Corporation bought Crimson Trace, a laser-sight manufacturer, for $95 million and Taylor Brands, a tool and knife maker, for $85 million. In November of that same year, the company bought UST Brands, a survival equipment maker, for $32.3 million. The company had diversified from firearms into sporting goods and outdoor gear, the rugged outdoors business being a larger market than firearms, in hopes of insulating Smith & Wesson from the stock price volatility caused by the unpredictability of the gun business. This culminated in the decision to change the company's name, and on November 7, 2016, Smith & Wesson Holding Corporation announced that it would change its name to American Outdoor Brands Corporation. The name change took effect on the first business day of 2017. The change occurred at a time when the firearms industry was receiving backlash over gun violence in America, and so was also seen as an attempt to disassociate itself from the negative repercussions surrounding the issue. In 2017, firearms accounted for 86% of American Outdoor Brands's revenues, and the company shipped 420,000 long guns. American Outdoor Brands also owns Battenfeld Technologies, Taylor Brands (a knife and tool maker bought in August 2016 for $95 million), and Crimson Trace (an electro-optics business which it bought in August 2016 for $85 million). On November 13, 2019, American Outdoor Brands Corp. said it would split into two companies: Smith & Wesson Brands, Inc., which would retain gun sales, and American Outdoor Brands, Inc. The transaction was expected to be finalized in the second half of 2020. The company cited changes in political climate and economic, investing and insurance markets. In January 2020, American Outdoor Brands replaced CEO P. James Debney following allegations of misconduct. The company named Mark Smith and Brian Murphy as joint CEOs. On 24 August 2020, the company was spun-off from Smith & Wesson, with S&W retaining the original stock ticker SWBI and American Outdoor Brands becoming a new publicly-traded company on the NASDAQ as American Outdoor Brands, Inc. On March 11, 2022, American Outdoor Brands announced that it entered into an agreement to purchase grill brand Grilla Grills. References External links American companies established in 1992 Companies listed on the Nasdaq Electronics companies of the United States Holding companies of the United States Manufacturing companies established in 1992 Outdoor recreation in the United States Weapons manufacturing companies Companies based in Columbia, Missouri

50694748

https://en.wikipedia.org/wiki/Luis%20Maldonado%20%28bishop%29

Luis Maldonado (bishop)

Luis Maldonado (died 1596) was a Roman Catholic prelate who was appointed as the first Bishop of Nueva Caceres (1595–1596). Biography Luis Maldonado was ordained a priest in the Order of Friars Minor. On 30 August 1595, he was appointed during the papacy of Pope Clement VIII as the first Bishop of Nueva Caceres. He died before he was consecrated in 1596. References External links and additional sources (for Chronology of Bishops) (for Chronology of Bishops) 16th-century Roman Catholic bishops in the Philippines Bishops appointed by Pope Clement VIII 1596 deaths Franciscan bishops

37873208

https://en.wikipedia.org/wiki/Eileen%20Moran

Eileen Moran

Eileen Moran (January 23, 1952 – December 3, 2012) was an American visual effects producer and former executive producer at Weta Digital. Moran was born in Queens, New York, on January 23, 1952, was raised Lindenhurst, New York, on Long Island. She attended the State University of New York at New Paltz with the initial goal of becoming an actor. Her classmates at SUNY New Paltz included actor John Turturro. After graduating from SUNY New Paltz, Moran appeared in off-Broadway productions while living in New York City. Her career path changed when she was hired as a television commercial production assistant, which eventually led to her promotion to production manager. Moran moved from New York City to Los Angeles, California where pursued an interest in music and worked for film director, Tony Scott. She was hired by Digital Domain, a special effects firm founded and owned by film director, James Cameron. Moran received industry buzz for her digital effects work on two Budweiser television commercials featuring ants, the Budweiser Frogs, and lizards. In 2001, Moran left Digital Domain and took a position at Weta Digital, the digital effects company based in Wellington, New Zealand, which had been founded by Peter Jackson. In 2005, Moran won her first Visual Effects Society Award for Outstanding Visual Effects in an Effects Driven Feature Motion Picture from the Visual Effects Society for her work on Peter Jackson's King Kong. Moran led the Weta Digital effects team which worked on James Cameron's Avatar, released in 2009. Moran and her team won the Visual Effects Society Award for Outstanding Visual Effects in an Effects Driven Feature Motion Picture for their work on Avatar in 2009. She also received a Visual Effects Society Award nomination for her work on Steven Spielberg's The Adventures of Tintin: The Secret of the Unicorn. Her film credits included work on Fight Club, Lake Placid, and EDtv, all released in 1999; I, Robot in 2004; X-Men: The Last Stand in 2006; Eragon in 2006; Bridge to Terabithia, Fantastic 4: Rise of the Silver Surfer, 30 Days of Night, and The Water Horse all released in 2007; Jumper, The Chronicles of Narnia: Prince Caspian and The Day the Earth Stood Still, all released in 2008; District 9 and The Lovely Bones in 2009; The A-Team in 2010; Rise of the Planet of the Apes in 2011; and Prometheus in 2012. Moran served as a co-producer for the 2012 Peter Jackson film, The Hobbit: An Unexpected Journey. She was unable to attend the film's premiere on November 28, 2012, in New Zealand due to poor health. Eileen Moran died from cancer in Wellington, New Zealand on December 3, 2012, at the age of 60. She was survived by her children, Jack and Ava; her father, John G. Moran; and her three sisters - Janet Hamill, Patty Matthes and Jackie Meyer. References External links 1952 births 2012 deaths Visual effects supervisors Visual effects artists State University of New York at New Paltz alumni American expatriates in New Zealand People from Lindenhurst, New York Businesspeople from New York City People from Los Angeles 20th-century American businesspeople

45108554

https://en.wikipedia.org/wiki/Cambridge%20Ring

Cambridge Ring

The term Cambridge Ring could refer to: The Cambridge Ring (computer network) technology developed at the university of Cambridge, England The Cambridge Five espionage ring. The inner ring-road of Cambridge, England. Made up of A1134, Gonville Place, and East Road.

13067409

https://en.wikipedia.org/wiki/The%20Lakes%20of%20Canada

The Lakes of Canada

The Lakes of Canada is a rare promotional item self-released by the Innocence Mission in 1999. The title track is taken from the album Birds of My Neighborhood. Sufjan Stevens covered "The Lakes of Canada" on a May 2007 broadcast of The Take-Away Show. It has also been covered by Stephanie Dosen on her 2007 album A Lily for the Spectre. Track listing The Lakes Of Canada (Album Version) - 4:33 Snow (Album Version) - 3:45 Moon River - 2:44 Prayer Of St. Francis - 2:36 Snow (Gus Gus Remix) - 6:44 References The Innocence Mission albums 1999 EPs

68173215

https://en.wikipedia.org/wiki/Sciadonus%20galatheae

Sciadonus galatheae

Sciadonus galatheae is a species of fish in the family Aphyonidae. Description Sciadonus galatheae is transparent or white in colour (hence the specific name, from Greek γαλάτεια, galateia, "milk-white"), with a maximum length of . It has 88–104 dorsal fin rays and 47–58 anal fin rays. It has 48 precaudal vertebrae. Habitat Sciadonus galatheae is abyssopelagic and bathypelagic, living at depths of up to . It has been found in the Celtic Sea, the Solomon Sea and in the waters off New Zealand. Behaviour Sciadonus galatheae reproduces viviparously. References Aphyonidae Taxa named by Jørgen G. Nielsen Fish described in 1969

71188723

https://en.wikipedia.org/wiki/The%20Ed%20Wynn%20Show%20%281958%20TV%20series%29

The Ed Wynn Show (1958 TV series)

The Ed Wynn Show is a filmed sitcom that aired Thursday evenings on NBC from September 25, 1958 to January 1, 1959. It was the second TV show of the same name for the veteran comedian Ed Wynn, and his third television series overall. The Thalia-Keethwyn production company, of which he and his son Keenan Wynn were part-owners, worked with Screen Gems to make the show. Premise John Beamer (Ed Wynn) is a retired taxidermist in a small college town. He is a widower who lives in a big old house with his two granddaughters. The elder, Laurie (Jacklyn O'Donnell), attends the local college, while Midge (Sherry Alberoni) is a school girl. Their mother is dead, their father is mentioned as working overseas. Advance publicity described Beamer as a "wily old widower with a genius for solving other people's problems". Beamer's attorney and friend, Ernest Hinshaw (Herb Vigran), is the only other regular character. Recurring characters include Pauline (Myrna Fahey), a college friend of Laurie, and Mrs. Creavy (Jesslyn Fax), a gossipy neighbor. Production The first public notice of the new series came in May 1958, when a Los Angeles County Superior Court judge approved the contracts between the Thalia-Keethwyn production company and the two minor actors, Jacklyn O'Donnell and Sherri Alberoni. From a later story about the sale of the pilot episode, it must have been made just after the contract approvals. While showing the pilot to prospective buyers, the representatives for the production companies were asked the same question each time: "Isn't he a bit old to risk in the lead?" A previously secured affidavit of 72-year-old Ed Wynn's insurability answered that concern. Newspapers reported the next month that NBC had picked up The Ed Wynn Show for broadcast on Thursday evenings. By mid-July, the premise of the show was released to the press, along with the starting date. The primary sponsor was Liggett & Myers Tobacco Company for its Chesterfield cigarette brand, with the commercials handled by McCann Erickson. Co-sponsor Bulova Watch Company bought up the remaining commercial time for the fall season. The producer for Screen Gems was Ben Feiner, Jr. Actual filming, aside from the pilot episode, began August 4, 1958. The film used was 35 mm, with Westrex magnetic sound recording. IMDb reports this show as having 16 episodes, but lists only 15. It is not known if the discrepancy is due to the pilot episode, the title of which is also not known. From contemporary newspaper accounts, only 14 episodes were listed in television schedules. Reaction Reviews after the debut broadcast agreed that the show's concept precluded Ed Wynn from displaying much of his talent, with the writing an even bigger problem. Barbara Delatiner in Newsday said: "...the opener gave the venerable star little opportunity to act and certainly very little in the way of comedy". William Ewald in his UPI syndicated column praised Wynn's performance as "warm and professional" but was blunt about the show itself: "It is a formula comedy complete with contrived situations and ha-ha-ha soundtrack". Harry Harris in The Philadelphia Inquirer felt the same way about Wynn versus the show's writing: "He's an ingratiating fellow, but some of the dialogue and plot assigned to him are almost indigestibly 'folksy'." After seeing two episodes, Canadian reviewer Les Wedman wrote in The Province: "Mr. Wynn is fun to watch but the storyline appears likely to be a continued thin one. And the dialogue isn't half as funny as the canned laughter would try to convince us it is". When interviewed by Steven H. Scheuer about the critical reception, Ed Wynn defended the show. "People call the show corny... I admit I don't expect Brooks Atkinson to like my little show, but this isn't for sophisticated New York or Hollywood. It's a clean show and it has heart." Broadcast history The first episode broadcast was on Thursday, September 25, 1958, at 8 pm. It replaced You Bet Your Life in that time slot, which moved to the later time of 10 pm Thursday. It was initially bracketed by two game shows on NBC Thursday evenings: Tic-Tac-Dough preceded it at 7:30 pm and Twenty-One followed it at 8:30 pm. The latter show had been moved from Mondays. The show was pre-empted by an hour long Bell Telephone Science Series special on Oct 23rd, 1958. The episode originally scheduled for that date, "Laurie's Career", may not have ever been broadcast. By early November, a columnist reported that a cigarette sponsor was considering dropping The Ed Wynn Show for a new Jack Webb series. The last episode broadcast was on January 1, 1959. A week later Steve Canyon was moved from Saturdays to replace The Ed Wynn Show in that Thursday 8pm time slot. Episodes Notes References NBC original programming 1950s American sitcoms 1958 American television series debuts 1959 American television series endings

63808900

https://en.wikipedia.org/wiki/C7orf50

C7orf50

C7orf50 (Chromosome 7, Open Reading Frame 50) is a gene in humans (Homo sapiens) that encodes a protein known as C7orf50 (uncharacterized protein C7orf50). This gene is ubiquitously expressed in the kidneys, brain, fat, prostate, spleen, among 22 other tissues and demonstrates low tissue specificity. C7orf50 is conserved in chimpanzees, Rhesus monkeys, dogs, cows, mice, rats, and chickens, along with 307 other organisms from mammals to fungi. This protein is predicted to be involved with the import of ribosomal proteins into the nucleus to be assembled into ribosomal subunits as a part of rRNA processing. Additionally, this gene is predicted to be a microRNA (miRNA) protein coding host gene, meaning that it may contain miRNA genes in its introns and/or exons. Gene Background C7orf50, also known as YCR016W, MGC11257, and LOC84310, is a protein coding gene of poor characterization in need of further research. This gene can be accessed on NCBI at the accession number NC_000007.14, on HGNC at the ID number 22421, on ENSEMBL at the ID ENSG00000146540, on GeneCards at GCID:GC07M000996, and on UniProtKB at the ID Q9BRJ6. Location C7orf50 is located on the short arm of chromosome 7 (7p22.3), starting at base pair (bp) 977,964 and ending at bp 1,138,325. This gene spans 160,361 bps on the minus (-) strand and contains a total of 13 exons. Gene Neighborhood Genes within the neighborhood of C7orf50 are the following: LOC105375120, GPR146, LOC114004405, LOC107986755, ZFAND2A, LOC102723758, LOC106799841, COX19, ADAP1, CYP2W1, MIR339, GPER1, and LOC101927021. This neighborhood extends from bp 89700 to bp 1165958 on chromosome 7. mRNA Alternative Splicing C7orf50 has a total of 7 experimentally curated mRNA transcripts. These transcripts are maintained independently of annotated genomes and were not generated computationally from a specific genome build such as the GRCh38.p13 primary assembly; therefore, they are typically more reliable. The longest and most complete of these transcripts (transcript 4) being 2138bp, producing a 194 amino acid-long (aa) protein, and consisting of 5 exons. Of these transcripts, four of them encode for the same 194aa protein (isoform a), only differing in their 5' and 3' untranslated regions (UTRs). The three other transcripts encode isoform b, c, and d, respectively. The table below is representative of these transcripts. Alternatively, when the primary genomic assembly, GRCh38.p13, is used for annotation (NCBI: NC_000007.14), there are 10 computationally predicted mRNA transcripts. The most complete and supported of these transcripts (transcript variant X6) is 1896bp, producing a 225aa-long protein. In total, there are 6 different isoforms predicted for C7orf50. Of these transcripts, 5 of them encode for the same isoform (X3). The remaining transcripts encode isoforms X2, X4, X5, X6, and X7 as represented below. 5' and 3' UTR Based on the experimentally determined C7orf50 mRNA transcript variant 4, the 5' UTR of C7orf50 is 934 nucleotides (nt) long, while the 3' UTR is 619nt. The coding sequence (CDS) of this transcript spans nt 935..1519 for a total length of 584nt and is encoded in reading frame 2. Interestingly, the 5'UTR of C7orf50 contains a uORF in need of further study, ranging from nt 599 to nt 871 also in the second reading frame. Protein General Properties The C7orf50 Isoform a's 194aa protein sequence from NCBI is as follows: >NP_001127867.1 uncharacterized protein C7orf50 isoform a [Homo sapiens] MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKGEAVLRPGLDAEPELSPEEQRVLERKL 70 KKERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYDSDKVPDEH 140 FSTLLAYLEGLQGRARELTVQKAEALMRELDEEGSDPPLPGRAQRIRQVLQLLS 194 The underlined region within the sequence is indicative of a domain known as DUF2373 ("domain of unknown function 2373"), found in isoforms a, b, and c. C7orf50 has a predicted molecular weight (Mw) of 22 kDa, making C7orf50 smaller than the average protein (52 kDa). The isoelectric point (theoretical pI) for this isoform is 9.7, meaning that C7orf50 is slightly basic. As for charge runs and patterns within isoform a, there is a significant mixed charge (*) run (-++0++-+++--+) from aa67 to aa79 and an acidic (-) run from aa171 – aa173. It is likely that this mixed charge run encodes the protein-protein interaction (PPI) site of C7orf50. Domains and Motifs DUF2373 is a domain of unknown function found in the C7orf50 protein. This is a highly conserved c-terminal region found from fungi to humans. As for motifs, a bipartite nuclear localization signal (NLS) was predicted from aa6 to aa21, meaning that C7orf50 is likely localized in the nucleus. Interestingly, a nuclear export signal (NES) is also found within the C7orf50 protein at the following amino acids: 150, and 153 - 155, suggesting that C7orf50 has function both inside and outside the nucleus. Structure Secondary Structure The majority of C7orf50 (isoform a) secondary structure is made up of alpha helices, with the remainder being small portions of random coils, beta turns, or extended strands. Tertiary Structure The tertiary structure of C7orf50 consists primarily of alpha helices as determined I-TASSER. Quaternary Structure The interaction network (quaternary structure) involving the C7orf50 protein has significantly more (p < 1.0e-16) interactions than a randomly selected set of proteins. This indicates that these proteins are partially connected biologically as a group; therefore, they intrinsically depend on each other within their biological pathway. This means that although the function of C7orf50 is uncharacterized, it is most likely to be associated with the same processes and functions as the proteins within its network. The closest predicted functional partners of C7orf50 are the following proteins: DDX24, DDX52, PES1, EBNA1BP2, RSLD1, NOP14, FTSJ3, KRR1, LYAR, and PWP1. These proteins are predicted to co-express rather than bind directly C7orf50 and each other. Regulation Gene Regulation Promoter C7orf50 has 6 predicted promoter regions. The promoter with the greatest number of transcripts and CAGE tags overall is promoter set 6 (GXP_6755694) on ElDorado by Genomatix. This promoter region is on the minus (-) strand and has a start position of 1,137,965 and an end position of 1,139,325, making this promoter 1,361bp long. It has 16 coding transcripts and the transcript with the greatest identity to C7orf50 transcript 4 is transcript GXT_27788039 with 98746 CAGE tags. The CpG island associated with this promoter has 75 CpGs (22% of island), and is 676bp long. The C count plus G count is 471, the percentage C or G is 70% within this island, and the ratio of observed to expected CpG is 0.91. Transcription Factor Binding Sites As determined by MatInspector at Genomatix, the following transcription factor (TFs) families are most highly predicted to bind to C7orf50 in the promoter region. Expression Pattern C7orf50 shows ubiquitous expression in the kidneys, brain, fat, prostrate, spleen and 22 other tissues and low tissue and immune cell specificity . This expression is very high, 4 times above the average gene; therefore, there is a higher abundance of C7orf50 mRNA than the average gene within a cell. There does not appear to be a definitive cell type in which this gene is not expressed. Transcription Regulation Splice Enhancers The mRNA of C7orf50 is predicted to have exonic splicing enhancers, in which SR proteins can bind, at bp positions 45 (SRSF1 (IgM-BRCA1)), 246 (SRSF6), 703 (SRSF5), 1301 (SRSF1), and 1308 (SRSF2) Stem Loop Prediction Both the 5' and 3' UTRs of the mRNA of C7orf50 are predicted to fold into structures such as bulge loops, internal loops, multibranch loops, hairpin loops, and double helices. The 5'UTR has a predicted free energy of -416 kcal/mol with an ensemble diversity of 238. The 3' UTR has a predicted free energy of -279 kcal/mol with an ensemble diversity of 121. miRNA Targeting There are many poorly conserved miRNA binding sites predicted within the 3’UTR of C7orf50 mRNA. The notable miRNA families that are predicted to bind to C7orf50 mRNA and regulate/repress transcription are the following: miR-138-5p, miR-18-5p, miR-129-3p, miR-124-3p.1, miR-10-5p, and miR-338-3p. Protein Regulation Subcellular Localization The C7orf50 protein is predicted to localize intercellularly in both the nucleus and cytoplasm, but primarily within the nucleoplasm and nucleoli. Post-Translational Modification The C7orf50 protein is predicted to be mucin-type GalNAc o-glycosylated at the following amino acid sites: 12, 23, 36, 42, 59, and 97. Additionally, this protein is predicted to be SUMOylated at aa71 with the SUMO protein binding from aa189 through aa193. C7orf50 is also predicted to be kinase-specific phosphorylated at the following amino acids: 12, 23, 36, 42, 59, 97, 124, 133, 159, and 175. Interestingly, many of these sites overlap with the o-glycosylation sites. Of these phosphorylation sites, the majority are serines (53%) with the remainder being either tyrosines or threonines. The most associated kinases with these sites are the following kinase groups: AGC, CAMK, TKL, and STE. Finally, this protein is predicted to have 8 glycations of the ε amino groups of lysines at the following sites: aa3, 5, 14, 15, 17, 21, 76, and 120. Homology Paralogs No paralogs of C7orf50 have been detected in the human genome; however, there is slight evidence (58% similarity) of a paralogous DUF2373 domain in the protein of KIDINS220. Orthologs Below is a table of a variety of orthologs of the human C7orf50 gene. The table includes closely, moderately, and distantly related orthologs. C7orf50 is highly evolutionary conserved from mammals to fungi. When these ortholog sequences are compared, the most conserved portions are those of DUF2373, highlighting this domain's importance in the functioning of C7orf50. C7orf50 has evolved moderately and evenly over time with a divergence rate greater than Hemoglobin but less than Cytochrome C. Function The consensus prediction of C7orf50 function (GO terms), as determined by I-TASSER, predicts the molecular function to be protein binding, the biological process to be protein import (specifically into the nucleus), and the associated cellular component to be a pore complex (specifically of the nuclear envelope). It can be predicted that the function of C7orf50 is one in which C7orf50 imports ribosomal proteins into the nucleus in order to be made into ribosomes, but further research is needed to solidify this function. Interacting Proteins Clinical Significance C7orf50 has been noted in a variety of genome-wide association studies (GWAS) and has been shown to be associated with type 2 diabetes among sub-Saharan Africans, daytime sleepiness in African-Americans, prenatal exposure to particulate matter, heritable DNA methylation marks associated with breast cancer, DNA methylation in relation to plasma carotenoids and lipid profile, and has significant interactions with prion proteins. References Genes on human chromosome 7

52125957

https://en.wikipedia.org/wiki/Jamboard

Jamboard

Jamboard is a digital interactive whiteboard developed by Google to work with Google Workspace, formerly known as G Suite. It was officially announced on 25 October 2016. It has a 55" 4K touchscreen display and can be used for online collaboration using Google Workspace. The display can also be mounted onto a wall or be configured into a stand. History After Google Apps for Work was launched in 2006, the subscription-based service was announced to be re-branded as G Suite on 29 September 2016, alongside announcements of machine learning integration into Drive's programs, a redesign of Hangouts and the announcement of Team Drive. On 25 October, Product Manager of G Suite TJ Varghese announced Jamboard on Google's official blog. The announcement trailer for the product was released the same day onto YouTube. The website was also launched on the same day simultaneously, as well as a rumored version of an "Early Adopter Program" for the device. Jamboard was officially released in May 2017. Hardware Operating system Jamboard has an operating system that coincides with the Google Workspace ecosystem. Any service compatible with Google Workspace can also be performed on the device. Online service Jamboard, more commonly known as Google Jamboard in this use case, is also available as a service to anyone with a Google account. Once on the landing page, a user is able to create a 'Jam' where they are able to draw, create shapes, lines, and add text. The user can also choose between four pen types and six colors. There are also tools provided to erase and move objects, as well as create digital sticky notes, and turn their touchpoint into a digital laser pointer. References Google software Google hardware Products introduced in 2017 Android (operating system) software

29249632

https://en.wikipedia.org/wiki/Rock%20%26%20Roll%20%28EP%29

Rock & Roll (EP)

Rock & Roll is an EP by Frank Turner, released on 6 December 2010 on Xtra Mile Recordings. Describing the release as "a taster" for his subsequent studio album, England Keep My Bones, the EP was preceded by the single, "I Still Believe". Writing and composition Regarding the EP's overall aesthetic, Turner noted, "If the music I make is a spectrum that has acoustic folk stuff at one end, and rock music at the other, with Poetry of the Deed the needle was over towards the rock end. That's fine to do on occasion, but I think that as a general thing I’d rather be somewhere a bit more in the middle. So that’s the idea with Rock and Roll, and with the new album as well; the idea is to pull things back a little bit." Track listing Personnel Frank Turner - lead vocals, lead Guitar, mandolin Ben Lloyd - electric guitar Matt Nasir - piano, keyboards, vocals Tarrant Anderson - bass Nigel Powell - drums, percussion, vocals Additional personnel Tristan Ivemy - recording, mixing Frank Arkwright - mastering Artwork Chris Bourke - woodcuts Matt Nasir - photographs Andy Black - photographs Casey Cress - photographs References 2010 EPs Frank Turner albums Xtra Mile Recordings EPs

60974204

https://en.wikipedia.org/wiki/Caroline%20Baldin

Caroline Baldin

Caroline Baldin (born 14 March 1993) is a French ice hockey player for the ZSC Lions and the French national team. She represented France at the 2019 IIHF Women's World Championship. References External links 1993 births Living people French expatriate ice hockey people French expatriate sportspeople in Switzerland French women's ice hockey goaltenders People from Saint-Martin-d'Hères Montreal Carabins women's ice hockey players Sportspeople from Isère

52885375

https://en.wikipedia.org/wiki/Ji%C5%99%C3%AD%20Bro%C5%BEek

Jiří Brožek

Jiří Brožek (born March 11, 1947) is a Czech film editor. Biography During 1967‒1973 he attended Editing and Directing at FAMU. Then he started to work in Barrandov Movie Studios, from 1976 Brožek is self-employed. During the career he edited more than 100 feature films, variety of the TV production and many TV series. He cooperated with Ladislav Smoljak (Ball Lightning, Waiter, Scarper!, Jára Cimrman Lying, Sleeping) Karel Kachyňa (Love Between the Raindrops, Forbidden Dreams), Jiří Menzel (Cutting It Short, The Snowdrop Festival, My Sweet Little Village), Věra Chytilová (Calamity, Wolf's Hole) or Václav Havel (Leaving). Jiří Brožek was awarded nine Czech Lions for films Krvavý román (1993), Sekal Has to Die (1998), Anděl Exit (2000), Boredom in Brno (2003), The City of the Sun (2005), Pleasant Moments (2006), ...a bude hůř (2007), Leaving (2011) and Filthy (2017), twice he gained Slovak film award Slnko v sieti for The City of the Sun (2006) and Gypsy (2012). He is a member of Czech Film and Television Academy (ČFTA) and honourable member of Slovak Film and Television Academy (SFTA). He is married and has three children. Filmography Editor Actor Cooperation References External links Jiří Brožek on FDb.cz (czech) Jiří Brožek on ČSFD.cz (czech) Jiří Brožek on Kinobox.cz (czech) 1947 births Living people Academy of Performing Arts in Prague alumni Czech film editors People from Roudnice nad Labem Sun in a Net Awards winners

11757414

https://en.wikipedia.org/wiki/Lindsay%20Middlebrook

Lindsay Middlebrook

Lindsay Middlebrook (born September 7, 1955) is a Canadian former professional ice hockey goaltender. He played in the National Hockey League (NHL) with the Winnipeg Jets, Minnesota North Stars, New Jersey Devils and Edmonton Oilers between 1979 and 1983. As a youth, he played in the 1968 Quebec International Pee-Wee Hockey Tournament with a minor ice hockey team from Toronto. Career statistics Regular season and playoffs Awards and honours References External links 1955 births Living people Canadian ice hockey goaltenders Edmonton Oilers players Ice hockey people from Simcoe County Milwaukee Admirals (IHL) players Minnesota North Stars players Moncton Alpines (AHL) players Montana Magic players Nashville South Stars players New Haven Nighthawks players New Jersey Devils players Sportspeople from Collingwood, Ontario Saint Louis Billikens men's ice hockey players Toledo Goaldiggers players Tulsa Oilers (1964–1984) players Undrafted National Hockey League players Wichita Wind players Winnipeg Jets (1979–1996) players Canadian expatriate ice hockey players in the United States

36656431

https://en.wikipedia.org/wiki/Van%20Hoyweghen

Van Hoyweghen

Van Hoyweghen is a surname. Notable people with the surname include: David Van Hoyweghen (born 1976), Belgian footballer Luc Van Hoyweghen (1929–2013), Belgian footballer Surnames of Dutch origin

4811261

https://en.wikipedia.org/wiki/BD%2B17%C2%B03248

BD+17°3248

BD+17°3248 is an old Population II star located at a distance of roughly in the Galactic Halo. It belongs to the class of ultra-metal-poor stars, especially the very rare subclass of neutron-capture (r-process) enhanced stars. Since about 2000, this star had been studied with 3 telescopes: a) the Hubble Space Telescope, b) the Keck I telescope and c) the Harlan J. Smith Telescope at the McDonald Observatory of the University of Texas. Elemental abundances in the range from germanium (Z=32) up to uranium (Z=92) were determined. The Hubble Space Telescope was used to observe the ultraviolet part of the stellar spectra. This allowed the measurement of platinum, osmium and, for the first time outside of the Solar System, gold. From barium (Z=56) onward, all elements show a pattern of r-process contribution to the abundances of the elements in the Solar system. The University of Mainz and University of Basel groups of Karl-Ludwig Kratz and Friedrich-Karl Thielemann performed a comparison between the observed abundances for the stable element europium (Z=63) and the radioactive elements thorium (Z=90) and uranium (Z=92) to the calculated abundances of an r-process in a Type II supernova explosion. This allowed the age of this star to be estimated as about 13.8 billion years with an uncertainty of 4 billion years. A similar age was derived for another ultra-metal-poor star (CS31082-001) from thorium to uranium ratios. These stars were born several hundred million years after the Big Bang. References External links R-Process Cosmo-Chronometers Discovery of Gold Population II stars Hercules (constellation) Durchmusterung objects K-type bright giants 085487

16054983

https://en.wikipedia.org/wiki/Vontae%20Davis

Vontae Davis

Vontae Ottis Davis (born May 27, 1988) is an American former professional football player who was a cornerback for the Miami Dolphins, Indianapolis Colts, and Buffalo Bills of the National Football League (NFL). He played college football for the Illinois Fighting Illini, and was selected by the Dolphins in the first round of the 2009 NFL Draft. He made two Pro Bowls in his career. Davis retired from the NFL in the middle of the Bills' second game of the 2018 season, removing himself from the game at halftime. Early years Davis attended Dunbar High School in Washington, D.C., where he was a letterman in football and track. He played football as a cornerback and wide receiver. During his senior season, he recorded 38 tackles and eight interceptions and achieved many awards and honors including Washington Post first-team All-Metro, PrepStar All-American, DCIAA West first-team All-Conference, and D.C. Gatorade Player of the Year. In track & field, Davis was one of the district's top sprinters. As a senior in 2006, he recorded personal-best times of 10.97 seconds in the 100-meter dash and 22.78 seconds in the 200-meter dash at the DCIAA East/West Championships, placing first in both events. He also recorded a 4.40-second 40-yard dash and a 33-inch vertical jump. Considered a three-star recruit by Rivals.com, Davis was ranked as the No. 33 cornerback prospect in the nation. College career Davis chose Illinois over Maryland, Michigan State, and Virginia. Davis had a great freshman season for the Fighting Illini recording 30 tackles and intercepting one pass. He was named to the Freshman All-America first teams by The Sporting News, Scout.com, and Rivals.com and was also the Fighting Illini's Rookie of the Year. In 2007, he started all 12 games he played recording 56 tackles, including 13 in the Rose Bowl against USC, and was tied for third in the Big Ten with four interceptions. After his junior season, he declared that he would forgo his senior season and become eligible for the 2009 NFL Draft. College statistics Professional career Davis attended the NFL Scouting Combine in Indianapolis, Indiana and completed all of the combine and positional drills. On March 18, 2009, Davis attended Illinois' pro day and opted to perform the majority of combine drills. He posted better times in the 40-yard dash (4.40s), 20-yard dash (2.52s), and 10-yard dash (1.48s) while also adding height to his vertical jump (37.5"). At the conclusion of the pre-draft process, Davis was projected to be first or second round selection by NFL draft experts and scouts. He was ranked the third best cornerback prospect in the draft by DraftScout.com. Miami Dolphins The Miami Dolphins selected Davis in the first round (25th overall) of the 2009 NFL Draft. Davis was the second cornerback drafted behind Ohio State's Malcolm Jenkins and was the first of two cornerbacks the Dolphins selected in the first two rounds, along with Utah's Sean Smith who they drafted in the second round (61st overall). 2009 On July 31, 2009, the Miami Dolphins signed Davis to a five-year, $10.25 million contract that includes $7.43 million guaranteed and a signing bonus of $500,000. Throughout training camp, Davis competed for a job as a starting cornerback against Eric Green and Sean Smith. Head coach Tony Sparano named Davis the fourth cornerback on the Dolphins' depth chart to begin the regular season, behind Will Allen, Sean Smith, and Nathan Jones. He made his professional regular season debut in the Miami Dolphins' season-opener at the Atlanta Falcons and made a solo tackle during their 10–7 loss. Davis recorded his first career regular season tackle on wide receiver Michael Jenkins for a three-yard loss in the fourth quarter. Davis surpassed Nathan Jones on the depth chart after the Miami Dolphins' Week 3 loss at the San Diego Chargers. On October 4, 2009, Davis recorded three solo tackles, a pass deflection, and returned his first career interception for a touchdown during a 38–10 victory against the Buffalo Bills in Week 4. He intercepted a pass attempt by quarterback Trent Edwards that was originally intended for Josh Reed and returned it for a 23-yard touchdown at the end of the second quarter. On November 1, 2009, Davis earned his first career start in place of Will Allen who was placed on injured reserve after tearing his ACL the previous week. He recorded a season-high seven combined tackles and two pass deflections during their 39–25 victory at the New York Jets in Week 8. The following week, he collected a season-high six solo tackles, broke up two passes, and intercepted a pass by Tom Brady during a 27–17 loss at the New England Patriots in Week 9. He finished his rookie season in with 51 combined tackles (47 solo), 11 pass deflections, and four interceptions in 16 games and nine starts. Davis led the team in interceptions as a rookie and led all defensive backs on the team in tackles. Pro Football Weekly selected Davis on its annual All-Rookie team. 2010 Davis entered training camp slated as the No. 1 starting cornerback on the depth chart. Head coach Tony Sparano officially named Davis the starting cornerback to start the regular season, alongside Jason Allen and nickelback Nolan Carroll. He started in the Miami Dolphins' season-opener at the Buffalo Bills and made two solo tackles and deflected a pass in their 15–10 victory. In Week 2, Davis collected six solo tackles, two pass deflections, and intercepted a pass by Brett Favre during a 14–10 victory at the Minnesota Vikings. After the game, Vikings' quarterback Brett Favre stated, "Number 21, I felt like, was one of the best corners in this league, especially that no one knows about." On November 7, 2010, Davis collected a season-high seven combined tackles and a pass deflection in the Dolphins' 27–10 loss at the Baltimore Ravens in Week 9. Davis completed the season with 54 combined tackles (46 solo), 12 pass deflections, and an interception in 16 games and 15 starts. 2011 Defensive coordinator Mike Nolan retained Davis as a starting cornerback, along with Sean Smith, to start the season. Davis started in the Miami Dolphins' season-opener against the New England Patriots and recorded four combined tackles before exiting the 38–24 loss due to cramps. The following week, he collected six solo tackles in the Dolphins' 23–13 loss to the Houston Texans in Week 2. He exited in the third quarter due to a hamstring injury and was inactive for the next two games (Weeks 3–4) In Week 14, he made four solo tackles, broke up a pass, and made his first career sack on quarterback Carson Palmer as the Dolphins defeated Oakland 34–14. On December 13, 2011, the Miami Dolphins fired head coach Tony Sparano after falling to a 4–9 record. Defensive backs coach Todd Bowles was named the interim head coach for the last three games. On December 18, 2011, Davis recorded five combined tackles, two pass deflections, and intercepted two passes by Ryan Fitzpatrick in the Dolphins' 30–23 win at the Buffalo Bills in Week 15. The interceptions marked his first career multi-interception game. He finished the season with 43 combined tackles (39 solo), nine pass deflections, four interceptions, and a sack in 12 games and 12 starts. 2012 Davis entered training camp slated as a starting cornerback, along with Sean Smith, but saw competition from Richard Marshall and Nolan Carroll. During camp, he was surpassed on the depth chart by Marshall and was demoted to being the third cornerback on the depth chart. Following his demotion, he competed to be the first-team nickelback against Nolan Carroll. Indianapolis Colts On August 26, 2012, the Miami Dolphins traded Davis to the Indianapolis Colts in exchange for their second round pick (54th overall) and a conditional sixth round pick in the 2013 NFL Draft. The Miami Dolphins used the second round pick they received in the trade to draft cornerback Jamar Taylor, but did not receive a conditional sixth round pick after Davis did not exceed more than 65% of the Colts' defensive snaps in 2012. Head coach Chuck Pagano named Davis a starting cornerback to begin the regular season, along with Jerraud Powers. He made his Indianapolis Colts regular season debut in their season-opener at the Chicago Bears and recorded five solo tackles in their 41–22 loss. Davis was inactive for two games (Weeks 5–6) due to an ankle injury he sustained in Week 3. On October 28, 2012, Davis made one tackle before exiting the Colts' 19–13 victory at the Tennessee Titans in the first quarter after injuring his knee. His injury sidelined him for the next four games (Weeks 9–12). In Week 14, he collected eight combined tackles, broke up a pass, and sacked quarterback Jake Locker during a 27–23 win at the Tennessee Titans. The following week, Davis collected a season-high nine solo tackles during a 29–17 loss at the Houston Texans in Week 15. On December 30, 2012, Davis recorded five solo tackles, three pass deflections, and intercepted two passes by Matt Schaub during a 28–16 win in Week 17. He finished the season with 51 combined tackles (46 solo), seven passes defensed, three interceptions, and a sack in ten games and ten starts. The Indianapolis Colts finished second in the AFC South with an 11–5 record and clinched a wildcard berth. On January 6, 2013, Davis started his first career playoff game as the Colts lost 24–9 to the eventual Super Bowl champions, Baltimore Ravens, in the AFC Wildcard Game. 2013 Defensive coordinator Greg Manusky retained Davis as the No. 1 starting cornerback to begin the season, along with Greg Toler and nickelback Darius Butler. In Week 4, Davis had a season-high two pass deflections, three solo tackles, and made an interception during their 37–3 victory at the Jacksonville Jaguars. On October 14, 2013, he collected a season-high seven combined tackles in the Colts' 19–9 loss at the San Diego Chargers in Week 6. He finished the season with 46 combined tackles (41 solo), 12 pass deflections, and an interception in 16 games and 16 starts. The Indianapolis Colts finished atop their division with an 11–5 record. On January 4, 2014, Davis started in the AFC Wildcard Game and recorded three combined tackles during a 45–44 victory against the Kansas City Chiefs. The following week, he made one tackle in the Colts' 43–22 loss at the New England Patriots in the AFC Divisional Round. Davis earned an overall grade of 86.0 from Pro Football Focus, which was the sixth highest grade among all qualifying cornerbacks in 2013. 2014 On March 11, 2014, the Indianapolis Colts signed Davis to a four-year, $39 million contract with $20 million guaranteed. Davis and Greg Toler returned as the Colts' starting cornerback duo to begin the 2014 regular season. On October 9, 2014, Davis collected a season-high five combined tackles and a pass deflection during a 33–28 victory at the Houston Texans in Week 6. In Week 12, he made two solo tackles, two pass deflections, and returned an interception for 42-yards in the Colts' 23–3 win against the Jacksonville Jaguars. The following week, Davis recorded two combined tackles and two pass deflections before leaving the Colts' 49–27 victory against the Washington Redskins in the second quarter after sustaining a concussion. He received the concussion while attempting to tackle running back Roy Helu and remained on the ground for several minutes before walking off the field on his own will. He remained in the Colts' concussion protocol and was inactive for their Week 14 victory at the Cleveland Browns. On December 23, 2014, it was announced that Davis was selected to the 2015 Pro Bowl. Davis completed the season with 42 combined tackles (35 solo), a career-high 18 pass deflections, and four interceptions in 15 games and 15 starts. He also led the NFL in lowest opposing passer rating (38.8) and earned an overall grade of 95.1, which was the second highest overall grade among all qualifying cornerbacks in 2014. The Indianapolis Colts finished first in the AFC South with an 11–5 record and reached the AFC Championship before being defeated 45–7 by the New England Patriots who eventually won Super Bowl XLIX. During the AFC Divisional Round, Davis recorded eight combined tackles and a career-high five pass deflections in the Colts' 24–13 victory at the Denver Broncos. 2015 On October 25, 2015, Davis collected a season-high six combined tackles, two pass deflections, and an interception during a 27–21 loss to the New Orleans Saints in Week 7. The following week, Davis collected two solo tackles, two pass deflections, and intercepted a pass by Cam Newton in the Colts' 29–26 loss at the Carolina Panthers in Week 8. He finished the season with 48 combined tackles (38 solo), 16 pass deflections, and four interceptions in 16 games and 16 starts. On January 25, 2016, Davis was selected to the 2016 Pro Bowl as a replacement for Chris Harris Jr. who was playing in Super Bowl 50 as a member of the Denver Broncos. He received an overall grade of 86.9 from Pro Football Focus and ranked third among all qualifying cornerbacks in 2015. 2016 On January 5, 2016, the Indianapolis Colts fired defensive coordinator Greg Manusky after they finished with an 8–8 record in . Defensive coordinator Ted Monachino retained Davis as the No. 1 starting cornerback to start the season, along with Patrick Robinson. Davis was sidelined for the first two games of the regular season after spraining his ankle in the Colts' first preseason game. On October 16, 2016, Davis recorded a season-high five combined tackles, two pass deflections, and an interception during a 26–23 loss at the Houston Texans in Week 6. In Week 16, he made a season-high five solo tackles and broke up a pass in the Colts' 33–25 loss at the Oakland Raiders. He finished the season with 37 combined tackles (34 solo), ten pass deflections, and an interception in 14 games and 14 starts. Pro Football Focus gave Davis an overall grade of 47.3 in 2016. 2017 Davis entered training camp slated as a starting cornerback along with Rashaan Melvin. He sustained a groin injury during the preseason and was sidelined for the first three games of the regular season (Weeks 1–3). On October 1, 2017, he started in his first game of the season and collected a season-high six solo tackles in the Colts' 46–18 loss at the Seattle Seahawks in Week 4. On October 29, 2017, Davis collected four combined tackles and a pass deflection during a 24–23 loss at the Cincinnati Bengals in Week 8. Prior to the game, it was reported that the Indianapolis Colts received inquiries from two teams about possibly trading for Davis. Head coach Chuck Pagano benched Davis in favor of rookie Quincy Wilson during the Colts' Week 9 victory against the Houston Texans in what he called a non-injury related coaching decision. Davis voiced his displeasure and stated he felt disrespected after the Colts did not allow him to travel with the team to Houston. On November 8, 2017, it was reported that Davis decided to have surgery to repair a lingering groin injury he sustained during the preseason, which would take him out of play for the remainder of the season On November 9, 2017, the Indianapolis Colts released Davis, ending a six-year tenure with the team. Davis finished his truncated season with 21 combined tackles (16 solo) and two pass deflections in five games and five starts. Pro Football Focus gave Davis an overall grade of 45.2, which ranked 103rd among all qualifying cornerbacks in 2017. Buffalo Bills On February 26, 2018, Davis signed a one-year deal with the Buffalo Bills worth up to $5 million, with $3.5 million guaranteed. During the September 16, 2018, game against the Los Angeles Chargers, Davis removed himself from play during the first half, stating he was "done". According to a statement made by head coach Sean McDermott, it was not immediately clear whether he meant to retire or simply leave that particular game. Following the game, Davis released a statement confirming his retirement. Davis' decision was initially not taken well by his teammates and later lampooned in the media. Davis later commented that his abrupt retirement was due to an abrupt realization that football was no longer what he was meant to be doing, and that "leaving was therapeutic". NFL career statistics Regular season Personal life Vontae is the younger brother of former San Francisco 49ers, Denver Broncos, and Washington Redskins' tight end Vernon Davis. In June 2009, several media outlets incorrectly reported that Davis was stopped and arrested for traffic infractions in Champaign, Illinois. The incident turned out to be the result of identity theft after Davis's wallet was stolen. In June 2015, Davis married his girlfriend Megan Harpe. , Davis is CEO of a holistic wellness spa that opened in October 2019 in Fort Lauderdale, Florida. References External links Sports Reference (college) 1988 births Living people American football cornerbacks Buffalo Bills players Illinois Fighting Illini football players Indianapolis Colts players Miami Dolphins players Unconferenced Pro Bowl players Players of American football from Washington, D.C. Dunbar High School (Washington, D.C.) alumni American chief executives