Datasets:

librarian-bots

/

model_cards_with_metadata

like 11

Follow

Librarian Bots 57

dslim/bert-large-NER

dslim

transformers

token-classification

--- language: en datasets: - conll2003 license: mit model-index: - name: dslim/bert-large-NER results: - task: type: token-classification name: Token Classification dataset: name: conll2003 type: conll2003 config: conll2003 split: test metrics: - name: Accuracy type: accuracy value: 0.9031688753722759 verified: true - name: Precision type: precision value: 0.920025068328604 verified: true - name: Recall type: recall value: 0.9193688678588825 verified: true - name: F1 type: f1 value: 0.9196968510445761 verified: true - name: loss type: loss value: 0.5085050463676453 verified: true --- # bert-large-NER If my open source models have been useful to you, please consider supporting me in building small, useful AI models for everyone (and help me afford med school / help out my parents financially). Thanks! <a href="https://www.buymeacoffee.com/dslim" target="_blank"><img src="https://cdn.buymeacoffee.com/buttons/v2/arial-yellow.png" alt="Buy Me A Coffee" style="height: 60px !important;width: 217px !important;" ></a> ## Model description **bert-large-NER** is a fine-tuned BERT model that is ready to use for **Named Entity Recognition** and achieves **state-of-the-art performance** for the NER task. It has been trained to recognize four types of entities: location (LOC), organizations (ORG), person (PER) and Miscellaneous (MISC). Specifically, this model is a *bert-large-cased* model that was fine-tuned on the English version of the standard [CoNLL-2003 Named Entity Recognition](https://www.aclweb.org/anthology/W03-0419.pdf) dataset. If you'd like to use a smaller BERT model fine-tuned on the same dataset, a [**bert-base-NER**](https://huggingface.co/dslim/bert-base-NER/) version is also available. ## Intended uses & limitations #### How to use You can use this model with Transformers *pipeline* for NER. ```python from transformers import AutoTokenizer, AutoModelForTokenClassification from transformers import pipeline tokenizer = AutoTokenizer.from_pretrained("dslim/bert-large-NER") model = AutoModelForTokenClassification.from_pretrained("dslim/bert-large-NER") nlp = pipeline("ner", model=model, tokenizer=tokenizer) example = "My name is Wolfgang and I live in Berlin" ner_results = nlp(example) print(ner_results) ``` #### Limitations and bias This model is limited by its training dataset of entity-annotated news articles from a specific span of time. This may not generalize well for all use cases in different domains. Furthermore, the model occassionally tags subword tokens as entities and post-processing of results may be necessary to handle those cases. ## Training data This model was fine-tuned on English version of the standard [CoNLL-2003 Named Entity Recognition](https://www.aclweb.org/anthology/W03-0419.pdf) dataset. The training dataset distinguishes between the beginning and continuation of an entity so that if there are back-to-back entities of the same type, the model can output where the second entity begins. As in the dataset, each token will be classified as one of the following classes: Abbreviation|Description -|- O|Outside of a named entity B-MIS |Beginning of a miscellaneous entity right after another miscellaneous entity I-MIS | Miscellaneous entity B-PER |Beginning of a person’s name right after another person’s name I-PER |Person’s name B-ORG |Beginning of an organization right after another organization I-ORG |organization B-LOC |Beginning of a location right after another location I-LOC |Location ### CoNLL-2003 English Dataset Statistics This dataset was derived from the Reuters corpus which consists of Reuters news stories. You can read more about how this dataset was created in the CoNLL-2003 paper. #### # of training examples per entity type Dataset|LOC|MISC|ORG|PER -|-|-|-|- Train|7140|3438|6321|6600 Dev|1837|922|1341|1842 Test|1668|702|1661|1617 #### # of articles/sentences/tokens per dataset Dataset |Articles |Sentences |Tokens -|-|-|- Train |946 |14,987 |203,621 Dev |216 |3,466 |51,362 Test |231 |3,684 |46,435 ## Training procedure This model was trained on a single NVIDIA V100 GPU with recommended hyperparameters from the [original BERT paper](https://arxiv.org/pdf/1810.04805) which trained & evaluated the model on CoNLL-2003 NER task. ## Eval results metric|dev|test -|-|- f1 |95.7 |91.7 precision |95.3 |91.2 recall |96.1 |92.3 The test metrics are a little lower than the official Google BERT results which encoded document context & experimented with CRF. More on replicating the original results [here](https://github.com/google-research/bert/issues/223). ### BibTeX entry and citation info ``` @article{DBLP:journals/corr/abs-1810-04805, author = {Jacob Devlin and Ming{-}Wei Chang and Kenton Lee and Kristina Toutanova}, title = {{BERT:} Pre-training of Deep Bidirectional Transformers for Language Understanding}, journal = {CoRR}, volume = {abs/1810.04805}, year = {2018}, url = {http://arxiv.org/abs/1810.04805}, archivePrefix = {arXiv}, eprint = {1810.04805}, timestamp = {Tue, 30 Oct 2018 20:39:56 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1810-04805.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ``` ``` @inproceedings{tjong-kim-sang-de-meulder-2003-introduction, title = "Introduction to the {C}o{NLL}-2003 Shared Task: Language-Independent Named Entity Recognition", author = "Tjong Kim Sang, Erik F. and De Meulder, Fien", booktitle = "Proceedings of the Seventh Conference on Natural Language Learning at {HLT}-{NAACL} 2003", year = "2003", url = "https://www.aclweb.org/anthology/W03-0419", pages = "142--147", } ```

prs-eth/marigold-depth-v1-0

prs-eth

diffusers

depth-estimation

--- license: apache-2.0 language: - en pipeline_tag: depth-estimation tags: - monocular depth estimation - single image depth estimation - depth - in-the-wild - zero-shot - depth --- # Marigold: Repurposing Diffusion-Based Image Generators for Monocular Depth Estimation This model represents the official checkpoint of the paper titled "Repurposing Diffusion-Based Image Generators for Monocular Depth Estimation". [](https://marigoldmonodepth.github.io) [](https://github.com/prs-eth/Marigold) [](https://arxiv.org/abs/2312.02145) [](https://colab.research.google.com/drive/12G8reD13DdpMie5ZQlaFNo2WCGeNUH-u?usp=sharing) [](https://huggingface.co/spaces/toshas/marigold) [](https://www.apache.org/licenses/LICENSE-2.0) <!-- []() --> <!-- []() --> <!-- []() --> <!-- ### [Repurposing Diffusion-Based Image Generators for Monocular Depth Estimation]() --> [Bingxin Ke](http://www.kebingxin.com/), [Anton Obukhov](https://www.obukhov.ai/), [Shengyu Huang](https://shengyuh.github.io/), [Nando Metzger](https://nandometzger.github.io/), [Rodrigo Caye Daudt](https://rcdaudt.github.io/), [Konrad Schindler](https://scholar.google.com/citations?user=FZuNgqIAAAAJ&hl=en ) We present Marigold, a diffusion model and associated fine-tuning protocol for monocular depth estimation. Its core principle is to leverage the rich visual knowledge stored in modern generative image models. Our model, derived from Stable Diffusion and fine-tuned with synthetic data, can zero-shot transfer to unseen data, offering state-of-the-art monocular depth estimation results.  ## 🎓 Citation ```bibtex @InProceedings{ke2023repurposing, title={Repurposing Diffusion-Based Image Generators for Monocular Depth Estimation}, author={Bingxin Ke and Anton Obukhov and Shengyu Huang and Nando Metzger and Rodrigo Caye Daudt and Konrad Schindler}, booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition (CVPR)}, year={2024} } ``` ## 🎫 License This work is licensed under the Apache License, Version 2.0 (as defined in the [LICENSE](LICENSE.txt)). By downloading and using the code and model you agree to the terms in the [LICENSE](LICENSE.txt). [](https://www.apache.org/licenses/LICENSE-2.0)

ncbi/MedCPT-Cross-Encoder

ncbi

transformers

text-classification

--- license: other license_name: public-domain license_link: LICENSE --- # Usage: Ranking articles for a given query ```python import torch from transformers import AutoTokenizer, AutoModelForSequenceClassification tokenizer = AutoTokenizer.from_pretrained("ncbi/MedCPT-Cross-Encoder") model = AutoModelForSequenceClassification.from_pretrained("ncbi/MedCPT-Cross-Encoder") query = "diabetes treatment" # 6 articles to be ranked for the input query articles = [ "Type 1 and 2 diabetes mellitus: A review on current treatment approach and gene therapy as potential intervention. Type 1 and type 2 diabetes mellitus is a serious and lifelong condition commonly characterised by abnormally elevated blood glucose levels due to a failure in insulin production or a decrease in insulin sensitivity and function. [...]", "Diabetes mellitus and its chronic complications. Diabetes mellitus is a major cause of morbidity and mortality, and it is a major risk factor for early onset of coronary heart disease. Complications of diabetes are retinopathy, nephropathy, and peripheral neuropathy. [...]", "Diagnosis and Management of Central Diabetes Insipidus in Adults. Central diabetes insipidus (CDI) is a clinical syndrome which results from loss or impaired function of vasopressinergic neurons in the hypothalamus/posterior pituitary, resulting in impaired synthesis and/or secretion of arginine vasopressin (AVP). [...]", "Adipsic diabetes insipidus. Adipsic diabetes insipidus (ADI) is a rare but devastating disorder of water balance with significant associated morbidity and mortality. Most patients develop the disease as a result of hypothalamic destruction from a variety of underlying etiologies. [...]", "Nephrogenic diabetes insipidus: a comprehensive overview. Nephrogenic diabetes insipidus (NDI) is characterized by the inability to concentrate urine that results in polyuria and polydipsia, despite having normal or elevated plasma concentrations of arginine vasopressin (AVP). [...]", "Impact of Salt Intake on the Pathogenesis and Treatment of Hypertension. Excessive dietary salt (sodium chloride) intake is associated with an increased risk for hypertension, which in turn is especially a major risk factor for stroke and other cardiovascular pathologies, but also kidney diseases. Besides, high salt intake or preference for salty food is discussed to be positive associated with stomach cancer, and according to recent studies probably also obesity risk. [...]" ] # combine query article into pairs pairs = [[query, article] for article in articles] with torch.no_grad(): encoded = tokenizer( pairs, truncation=True, padding=True, return_tensors="pt", max_length=512, ) logits = model(**encoded).logits.squeeze(dim=1) print(logits) ``` The output will be ```bash tensor([ 6.9363, -8.2063, -8.7692, -12.3450, -10.4416, -15.8475]) ``` Higher scores indicate higher relevance. # Acknowledgments This work was supported by the Intramural Research Programs of the National Institutes of Health, National Library of Medicine. # Disclaimer This tool shows the results of research conducted in the Computational Biology Branch, NCBI/NLM. The information produced on this website is not intended for direct diagnostic use or medical decision-making without review and oversight by a clinical professional. Individuals should not change their health behavior solely on the basis of information produced on this website. NIH does not independently verify the validity or utility of the information produced by this tool. If you have questions about the information produced on this website, please see a health care professional. More information about NCBI's disclaimer policy is available. # Citation If you find this repo helpful, please cite MedCPT by: ```bibtext @article{jin2023medcpt, title={MedCPT: Contrastive Pre-trained Transformers with large-scale PubMed search logs for zero-shot biomedical information retrieval}, author={Jin, Qiao and Kim, Won and Chen, Qingyu and Comeau, Donald C and Yeganova, Lana and Wilbur, W John and Lu, Zhiyong}, journal={Bioinformatics}, volume={39}, number={11}, pages={btad651}, year={2023}, publisher={Oxford University Press} } ```

Qwen/Qwen2.5-Math-7B-Instruct

Qwen

transformers

text-generation

--- base_model: Qwen/Qwen2.5-Math-7B language: - en pipeline_tag: text-generation tags: - chat library_name: transformers license: apache-2.0 license_link: https://huggingface.co/Qwen/Qwen2.5-Math-7B-Instruct/blob/main/LICENSE --- # Qwen2.5-Math-7B-Instruct > [!Warning] > <div align="center"> > <b> > 🚨 Qwen2.5-Math mainly supports solving English and Chinese math problems through CoT and TIR. We do not recommend using this series of models for other tasks. > </b> > </div> ## Introduction In August 2024, we released the first series of mathematical LLMs - [Qwen2-Math](https://qwenlm.github.io/blog/qwen2-math/) - of our Qwen family. A month later, we have upgraded it and open-sourced **Qwen2.5-Math** series, including base models **Qwen2.5-Math-1.5B/7B/72B**, instruction-tuned models **Qwen2.5-Math-1.5B/7B/72B-Instruct**, and mathematical reward model **Qwen2.5-Math-RM-72B**. Unlike Qwen2-Math series which only supports using Chain-of-Thught (CoT) to solve English math problems, Qwen2.5-Math series is expanded to support using both CoT and Tool-integrated Reasoning (TIR) to solve math problems in both Chinese and English. The Qwen2.5-Math series models have achieved significant performance improvements compared to the Qwen2-Math series models on the Chinese and English mathematics benchmarks with CoT.  While CoT plays a vital role in enhancing the reasoning capabilities of LLMs, it faces challenges in achieving computational accuracy and handling complex mathematical or algorithmic reasoning tasks, such as finding the roots of a quadratic equation or computing the eigenvalues of a matrix. TIR can further improve the model's proficiency in precise computation, symbolic manipulation, and algorithmic manipulation. Qwen2.5-Math-1.5B/7B/72B-Instruct achieve 79.7, 85.3, and 87.8 respectively on the MATH benchmark using TIR. ## Model Details For more details, please refer to our [blog post](https://qwenlm.github.io/blog/qwen2.5-math/) and [GitHub repo](https://github.com/QwenLM/Qwen2.5-Math). ## Requirements * `transformers>=4.37.0` for Qwen2.5-Math models. The latest version is recommended. > [!Warning] > <div align="center"> > <b> > 🚨 This is a must because <code>transformers</code> integrated Qwen2 codes since <code>4.37.0</code>. > </b> > </div> For requirements on GPU memory and the respective throughput, see similar results of Qwen2 [here](https://qwen.readthedocs.io/en/latest/benchmark/speed_benchmark.html). ## Quick Start > [!Important] > > **Qwen2.5-Math-7B-Instruct** is an instruction model for chatting; > > **Qwen2.5-Math-7B** is a base model typically used for completion and few-shot inference, serving as a better starting point for fine-tuning. > ### 🤗 Hugging Face Transformers Qwen2.5-Math can be deployed and infered in the same way as [Qwen2.5](https://github.com/QwenLM/Qwen2.5). Here we show a code snippet to show you how to use the chat model with `transformers`: ```python from transformers import AutoModelForCausalLM, AutoTokenizer model_name = "Qwen/Qwen2.5-Math-7B-Instruct" device = "cuda" # the device to load the model onto model = AutoModelForCausalLM.from_pretrained( model_name, torch_dtype="auto", device_map="auto" ) tokenizer = AutoTokenizer.from_pretrained(model_name) prompt = "Find the value of $x$ that satisfies the equation $4x+5 = 6x+7$." # CoT messages = [ {"role": "system", "content": "Please reason step by step, and put your final answer within \\boxed{}."}, {"role": "user", "content": prompt} ] # TIR messages = [ {"role": "system", "content": "Please integrate natural language reasoning with programs to solve the problem above, and put your final answer within \\boxed{}."}, {"role": "user", "content": prompt} ] text = tokenizer.apply_chat_template( messages, tokenize=False, add_generation_prompt=True ) model_inputs = tokenizer([text], return_tensors="pt").to(device) generated_ids = model.generate( **model_inputs, max_new_tokens=512 ) generated_ids = [ output_ids[len(input_ids):] for input_ids, output_ids in zip(model_inputs.input_ids, generated_ids) ] response = tokenizer.batch_decode(generated_ids, skip_special_tokens=True)[0] ``` ## Citation If you find our work helpful, feel free to give us a citation. ``` @article{yang2024qwen25mathtechnicalreportmathematical, title={Qwen2.5-Math Technical Report: Toward Mathematical Expert Model via Self-Improvement}, author={An Yang and Beichen Zhang and Binyuan Hui and Bofei Gao and Bowen Yu and Chengpeng Li and Dayiheng Liu and Jianhong Tu and Jingren Zhou and Junyang Lin and Keming Lu and Mingfeng Xue and Runji Lin and Tianyu Liu and Xingzhang Ren and Zhenru Zhang}, journal={arXiv preprint arXiv:2409.12122}, year={2024} } ```

BAAI/llm-embedder

BAAI

transformers

feature-extraction

--- license: mit --- <h1 align="center">FlagEmbedding</h1> <h4 align="center"> <p> <a href=#model-list>Model List</a> | <a href=#frequently-asked-questions>FAQ</a> | <a href=#usage>Usage</a> | <a href="#evaluation">Evaluation</a> | <a href="#train">Train</a> | <a href="#contact">Contact</a> | <a href="#citation">Citation</a> | <a href="#license">License</a> <p> </h4> More details please refer to our Github: [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding). [English](README.md) | [中文](https://github.com/FlagOpen/FlagEmbedding/blob/master/README_zh.md) <span style="#FF69B4;"> **Hiring:** We're seeking experienced NLP researchers and intern students focusing on dense retrieval and retrieval-augmented LLMs. If you're interested, please feel free to reach out to us via email at zhengliu1026@gmail.com.</span> FlagEmbedding can map any text to a low-dimensional dense vector, which can be used for tasks like retrieval, classification, clustering, and semantic search. And it can also be used in vector databases for LLMs. ************* 🌟**Updates**🌟 ************* - 10/12/2023: Release [LLM-Embedder](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder), a unified embedding model to support diverse retrieval augmentation needs for LLMs. [Paper](https://arxiv.org/pdf/2310.07554.pdf) :fire: - 09/15/2023: The [technical report](https://arxiv.org/pdf/2309.07597.pdf) of BGE has been released - 09/15/2023: The [massive training data](https://data.baai.ac.cn/details/BAAI-MTP) of BGE has been released - 09/12/2023: New models: - **New reranker model**: release cross-encoder models `BAAI/bge-reranker-base` and `BAAI/bge-reranker-large`, which are more powerful than embedding model. We recommend to use/fine-tune them to re-rank top-k documents returned by embedding models. - **update embedding model**: release `bge-*-v1.5` embedding model to alleviate the issue of the similarity distribution, and enhance its retrieval ability without instruction. <details> <summary>More</summary> <!-- ### More --> - 09/07/2023: Update [fine-tune code](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md): Add script to mine hard negatives and support adding instruction during fine-tuning. - 08/09/2023: BGE Models are integrated into **Langchain**, you can use it like [this](#using-langchain); C-MTEB **leaderboard** is [available](https://huggingface.co/spaces/mteb/leaderboard). - 08/05/2023: Release base-scale and small-scale models, **best performance among the models of the same size 🤗** - 08/02/2023: Release `bge-large-*`(short for BAAI General Embedding) Models, **rank 1st on MTEB and C-MTEB benchmark!** :tada: :tada: - 08/01/2023: We release the [Chinese Massive Text Embedding Benchmark](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB) (**C-MTEB**), consisting of 31 test dataset. </details> ## Model List `bge` is short for `BAAI general embedding`. | Model | Language | | Description | query instruction for retrieval [1] | |:-------------------------------|:--------:| :--------:| :--------:|:--------:| | [BAAI/llm-embedder](https://huggingface.co/BAAI/llm-embedder) | English | [Inference](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder) | a unified embedding model to support diverse retrieval augmentation needs for LLMs | See [README](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/llm_embedder) | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | Chinese and English | [Inference](#usage-for-reranker) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker) | a cross-encoder model which is more accurate but less efficient [2] | | | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh-v1.5](https://huggingface.co/BAAI/bge-large-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | version 1.5 with more reasonable similarity distribution | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-large-en](https://huggingface.co/BAAI/bge-large-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [MTEB](https://huggingface.co/spaces/mteb/leaderboard) leaderboard | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-base-en](https://huggingface.co/BAAI/bge-base-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-en` | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-small-en](https://huggingface.co/BAAI/bge-small-en) | English | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) |a small-scale model but with competitive performance | `Represent this sentence for searching relevant passages: ` | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | :trophy: rank **1st** in [C-MTEB](https://github.com/FlagOpen/FlagEmbedding/tree/master/C_MTEB) benchmark | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a base-scale model but with similar ability to `bge-large-zh` | `为这个句子生成表示以用于检索相关文章：` | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | Chinese | [Inference](#usage-for-embedding-model) [Fine-tune](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) | a small-scale model but with competitive performance | `为这个句子生成表示以用于检索相关文章：` | [1\]: If you need to search the relevant passages in a query, we suggest to add the instruction to the query; in other cases, no instruction is needed, just use the original query directly. In all cases, **no instruction** needs to be added to passages. [2\]: Different from the embedding model, reranker uses question and document as input and directly output similarity instead of embedding. To balance the accuracy and time cost, cross-encoder is widely used to re-rank top-k documents retrieved by other simple models. For example, use bge embedding model to retrieve top 100 relevant documents, and then use bge reranker to re-rank the top 100 documents to get the final top-3 results. All models have been uploaded to Huggingface Hub, and you can see them at https://huggingface.co/BAAI. If you cannot open the Huggingface Hub, you can also download the models at https://model.baai.ac.cn/models . ## Frequently asked questions **1. How to fine-tune bge embedding model?** Following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune) to prepare data and fine-tune your model. Some suggestions: - Mine hard negatives following this [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune#hard-negatives), which can improve the retrieval performance. - In general, larger hyper-parameter `per_device_train_batch_size` brings better performance. You can expand it by enabling `--fp16`, `--deepspeed df_config.json` (df_config.json can refer to [ds_config.json](https://github.com/FlagOpen/FlagEmbedding/blob/master/examples/finetune/ds_config.json), `--gradient_checkpointing`, etc. - If you pre-train bge on your data, the pre-trained model cannot be directly used to calculate similarity, and it must be fine-tuned with contrastive learning before computing similarity. - If the accuracy of the fine-tuned model is still not high, it is recommended to use/fine-tune the cross-encoder model (bge-reranker) to re-rank top-k results. Hard negatives also are needed to fine-tune reranker. <details> <summary>2. The similarity score between two dissimilar sentences is higher than 0.5</summary> <!-- ### The similarity score between two dissimilar sentences is higher than 0.5 --> **Suggest to use bge v1.5, which alleviates the issue of the similarity distribution.** Since we finetune the models by contrastive learning with a temperature of 0.01, the similarity distribution of the current BGE model is about in the interval \[0.6, 1\]. So a similarity score greater than 0.5 does not indicate that the two sentences are similar. For downstream tasks, such as passage retrieval or semantic similarity, **what matters is the relative order of the scores, not the absolute value.** If you need to filter similar sentences based on a similarity threshold, please select an appropriate similarity threshold based on the similarity distribution on your data (such as 0.8, 0.85, or even 0.9). </details> <details> <summary>3. When does the query instruction need to be used</summary> <!-- ### When does the query instruction need to be used --> For the `bge-*-v1.5`, we improve its retrieval ability when not using instruction. No instruction only has a slight degradation in retrieval performance compared with using instruction. So you can generate embedding without instruction in all cases for convenience. For a retrieval task that uses short queries to find long related documents, it is recommended to add instructions for these short queries. **The best method to decide whether to add instructions for queries is choosing the setting that achieves better performance on your task.** In all cases, the documents/passages do not need to add the instruction. </details> ## Usage ### Usage for Embedding Model Here are some examples of using `bge` models with [FlagEmbedding](#using-flagembedding), [Sentence-Transformers](#using-sentence-transformers), [Langchain](#using-langchain), or [Huggingface Transformers](#using-huggingface-transformers). #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` If it doesn't work for you, you can see [FlagEmbedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md) for more methods to install FlagEmbedding. ```python from FlagEmbedding import FlagModel sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = FlagModel('BAAI/bge-large-zh-v1.5', query_instruction_for_retrieval="为这个句子生成表示以用于检索相关文章：", use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation embeddings_1 = model.encode(sentences_1) embeddings_2 = model.encode(sentences_2) similarity = embeddings_1 @ embeddings_2.T print(similarity) # for s2p(short query to long passage) retrieval task, suggest to use encode_queries() which will automatically add the instruction to each query # corpus in retrieval task can still use encode() or encode_corpus(), since they don't need instruction queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] q_embeddings = model.encode_queries(queries) p_embeddings = model.encode(passages) scores = q_embeddings @ p_embeddings.T ``` For the value of the argument `query_instruction_for_retrieval`, see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list). By default, FlagModel will use all available GPUs when encoding. Please set `os.environ["CUDA_VISIBLE_DEVICES"]` to select specific GPUs. You also can set `os.environ["CUDA_VISIBLE_DEVICES"]=""` to make all GPUs unavailable. #### Using Sentence-Transformers You can also use the `bge` models with [sentence-transformers](https://www.SBERT.net): ``` pip install -U sentence-transformers ``` ```python from sentence_transformers import SentenceTransformer sentences_1 = ["样例数据-1", "样例数据-2"] sentences_2 = ["样例数据-3", "样例数据-4"] model = SentenceTransformer('BAAI/bge-large-zh-v1.5') embeddings_1 = model.encode(sentences_1, normalize_embeddings=True) embeddings_2 = model.encode(sentences_2, normalize_embeddings=True) similarity = embeddings_1 @ embeddings_2.T print(similarity) ``` For s2p(short query to long passage) retrieval task, each short query should start with an instruction (instructions see [Model List](https://github.com/FlagOpen/FlagEmbedding/tree/master#model-list)). But the instruction is not needed for passages. ```python from sentence_transformers import SentenceTransformer queries = ['query_1', 'query_2'] passages = ["样例文档-1", "样例文档-2"] instruction = "为这个句子生成表示以用于检索相关文章：" model = SentenceTransformer('BAAI/bge-large-zh-v1.5') q_embeddings = model.encode([instruction+q for q in queries], normalize_embeddings=True) p_embeddings = model.encode(passages, normalize_embeddings=True) scores = q_embeddings @ p_embeddings.T ``` #### Using Langchain You can use `bge` in langchain like this: ```python from langchain.embeddings import HuggingFaceBgeEmbeddings model_name = "BAAI/bge-large-en-v1.5" model_kwargs = {'device': 'cuda'} encode_kwargs = {'normalize_embeddings': True} # set True to compute cosine similarity model = HuggingFaceBgeEmbeddings( model_name=model_name, model_kwargs=model_kwargs, encode_kwargs=encode_kwargs, query_instruction="为这个句子生成表示以用于检索相关文章：" ) model.query_instruction = "为这个句子生成表示以用于检索相关文章：" ``` #### Using HuggingFace Transformers With the transformers package, you can use the model like this: First, you pass your input through the transformer model, then you select the last hidden state of the first token (i.e., [CLS]) as the sentence embedding. ```python from transformers import AutoTokenizer, AutoModel import torch # Sentences we want sentence embeddings for sentences = ["样例数据-1", "样例数据-2"] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-large-zh-v1.5') model = AutoModel.from_pretrained('BAAI/bge-large-zh-v1.5') model.eval() # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # for s2p(short query to long passage) retrieval task, add an instruction to query (not add instruction for passages) # encoded_input = tokenizer([instruction + q for q in queries], padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, cls pooling. sentence_embeddings = model_output[0][:, 0] # normalize embeddings sentence_embeddings = torch.nn.functional.normalize(sentence_embeddings, p=2, dim=1) print("Sentence embeddings:", sentence_embeddings) ``` ### Usage for Reranker Different from embedding model, reranker uses question and document as input and directly output similarity instead of embedding. You can get a relevance score by inputting query and passage to the reranker. The reranker is optimized based cross-entropy loss, so the relevance score is not bounded to a specific range. #### Using FlagEmbedding ``` pip install -U FlagEmbedding ``` Get relevance scores (higher scores indicate more relevance): ```python from FlagEmbedding import FlagReranker reranker = FlagReranker('BAAI/bge-reranker-large', use_fp16=True) # Setting use_fp16 to True speeds up computation with a slight performance degradation score = reranker.compute_score(['query', 'passage']) print(score) scores = reranker.compute_score([['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']]) print(scores) ``` #### Using Huggingface transformers ```python import torch from transformers import AutoModelForSequenceClassification, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained('BAAI/bge-reranker-large') model = AutoModelForSequenceClassification.from_pretrained('BAAI/bge-reranker-large') model.eval() pairs = [['what is panda?', 'hi'], ['what is panda?', 'The giant panda (Ailuropoda melanoleuca), sometimes called a panda bear or simply panda, is a bear species endemic to China.']] with torch.no_grad(): inputs = tokenizer(pairs, padding=True, truncation=True, return_tensors='pt', max_length=512) scores = model(**inputs, return_dict=True).logits.view(-1, ).float() print(scores) ``` ## Evaluation `baai-general-embedding` models achieve **state-of-the-art performance on both MTEB and C-MTEB leaderboard!** For more details and evaluation tools see our [scripts](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md). - **MTEB**: | Model Name | Dimension | Sequence Length | Average (56) | Retrieval (15) |Clustering (11) | Pair Classification (3) | Reranking (4) | STS (10) | Summarization (1) | Classification (12) | |:----:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:|:---:| | [BAAI/bge-large-en-v1.5](https://huggingface.co/BAAI/bge-large-en-v1.5) | 1024 | 512 | **64.23** | **54.29** | 46.08 | 87.12 | 60.03 | 83.11 | 31.61 | 75.97 | | [BAAI/bge-base-en-v1.5](https://huggingface.co/BAAI/bge-base-en-v1.5) | 768 | 512 | 63.55 | 53.25 | 45.77 | 86.55 | 58.86 | 82.4 | 31.07 | 75.53 | | [BAAI/bge-small-en-v1.5](https://huggingface.co/BAAI/bge-small-en-v1.5) | 384 | 512 | 62.17 |51.68 | 43.82 | 84.92 | 58.36 | 81.59 | 30.12 | 74.14 | | [bge-large-en](https://huggingface.co/BAAI/bge-large-en) | 1024 | 512 | 63.98 | 53.9 | 46.98 | 85.8 | 59.48 | 81.56 | 32.06 | 76.21 | | [bge-base-en](https://huggingface.co/BAAI/bge-base-en) | 768 | 512 | 63.36 | 53.0 | 46.32 | 85.86 | 58.7 | 81.84 | 29.27 | 75.27 | | [gte-large](https://huggingface.co/thenlper/gte-large) | 1024 | 512 | 63.13 | 52.22 | 46.84 | 85.00 | 59.13 | 83.35 | 31.66 | 73.33 | | [gte-base](https://huggingface.co/thenlper/gte-base) | 768 | 512 | 62.39 | 51.14 | 46.2 | 84.57 | 58.61 | 82.3 | 31.17 | 73.01 | | [e5-large-v2](https://huggingface.co/intfloat/e5-large-v2) | 1024| 512 | 62.25 | 50.56 | 44.49 | 86.03 | 56.61 | 82.05 | 30.19 | 75.24 | | [bge-small-en](https://huggingface.co/BAAI/bge-small-en) | 384 | 512 | 62.11 | 51.82 | 44.31 | 83.78 | 57.97 | 80.72 | 30.53 | 74.37 | | [instructor-xl](https://huggingface.co/hkunlp/instructor-xl) | 768 | 512 | 61.79 | 49.26 | 44.74 | 86.62 | 57.29 | 83.06 | 32.32 | 61.79 | | [e5-base-v2](https://huggingface.co/intfloat/e5-base-v2) | 768 | 512 | 61.5 | 50.29 | 43.80 | 85.73 | 55.91 | 81.05 | 30.28 | 73.84 | | [gte-small](https://huggingface.co/thenlper/gte-small) | 384 | 512 | 61.36 | 49.46 | 44.89 | 83.54 | 57.7 | 82.07 | 30.42 | 72.31 | | [text-embedding-ada-002](https://platform.openai.com/docs/guides/embeddings) | 1536 | 8192 | 60.99 | 49.25 | 45.9 | 84.89 | 56.32 | 80.97 | 30.8 | 70.93 | | [e5-small-v2](https://huggingface.co/intfloat/e5-base-v2) | 384 | 512 | 59.93 | 49.04 | 39.92 | 84.67 | 54.32 | 80.39 | 31.16 | 72.94 | | [sentence-t5-xxl](https://huggingface.co/sentence-transformers/sentence-t5-xxl) | 768 | 512 | 59.51 | 42.24 | 43.72 | 85.06 | 56.42 | 82.63 | 30.08 | 73.42 | | [all-mpnet-base-v2](https://huggingface.co/sentence-transformers/all-mpnet-base-v2) | 768 | 514 | 57.78 | 43.81 | 43.69 | 83.04 | 59.36 | 80.28 | 27.49 | 65.07 | | [sgpt-bloom-7b1-msmarco](https://huggingface.co/bigscience/sgpt-bloom-7b1-msmarco) | 4096 | 2048 | 57.59 | 48.22 | 38.93 | 81.9 | 55.65 | 77.74 | 33.6 | 66.19 | - **C-MTEB**: We create the benchmark C-MTEB for Chinese text embedding which consists of 31 datasets from 6 tasks. Please refer to [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/README.md) for a detailed introduction. | Model | Embedding dimension | Avg | Retrieval | STS | PairClassification | Classification | Reranking | Clustering | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | [**BAAI/bge-large-zh-v1.5**](https://huggingface.co/BAAI/bge-large-zh-v1.5) | 1024 | **64.53** | 70.46 | 56.25 | 81.6 | 69.13 | 65.84 | 48.99 | | [BAAI/bge-base-zh-v1.5](https://huggingface.co/BAAI/bge-base-zh-v1.5) | 768 | 63.13 | 69.49 | 53.72 | 79.75 | 68.07 | 65.39 | 47.53 | | [BAAI/bge-small-zh-v1.5](https://huggingface.co/BAAI/bge-small-zh-v1.5) | 512 | 57.82 | 61.77 | 49.11 | 70.41 | 63.96 | 60.92 | 44.18 | | [BAAI/bge-large-zh](https://huggingface.co/BAAI/bge-large-zh) | 1024 | 64.20 | 71.53 | 54.98 | 78.94 | 68.32 | 65.11 | 48.39 | | [bge-large-zh-noinstruct](https://huggingface.co/BAAI/bge-large-zh-noinstruct) | 1024 | 63.53 | 70.55 | 53 | 76.77 | 68.58 | 64.91 | 50.01 | | [BAAI/bge-base-zh](https://huggingface.co/BAAI/bge-base-zh) | 768 | 62.96 | 69.53 | 54.12 | 77.5 | 67.07 | 64.91 | 47.63 | | [multilingual-e5-large](https://huggingface.co/intfloat/multilingual-e5-large) | 1024 | 58.79 | 63.66 | 48.44 | 69.89 | 67.34 | 56.00 | 48.23 | | [BAAI/bge-small-zh](https://huggingface.co/BAAI/bge-small-zh) | 512 | 58.27 | 63.07 | 49.45 | 70.35 | 63.64 | 61.48 | 45.09 | | [m3e-base](https://huggingface.co/moka-ai/m3e-base) | 768 | 57.10 | 56.91 | 50.47 | 63.99 | 67.52 | 59.34 | 47.68 | | [m3e-large](https://huggingface.co/moka-ai/m3e-large) | 1024 | 57.05 | 54.75 | 50.42 | 64.3 | 68.2 | 59.66 | 48.88 | | [multilingual-e5-base](https://huggingface.co/intfloat/multilingual-e5-base) | 768 | 55.48 | 61.63 | 46.49 | 67.07 | 65.35 | 54.35 | 40.68 | | [multilingual-e5-small](https://huggingface.co/intfloat/multilingual-e5-small) | 384 | 55.38 | 59.95 | 45.27 | 66.45 | 65.85 | 53.86 | 45.26 | | [text-embedding-ada-002(OpenAI)](https://platform.openai.com/docs/guides/embeddings/what-are-embeddings) | 1536 | 53.02 | 52.0 | 43.35 | 69.56 | 64.31 | 54.28 | 45.68 | | [luotuo](https://huggingface.co/silk-road/luotuo-bert-medium) | 1024 | 49.37 | 44.4 | 42.78 | 66.62 | 61 | 49.25 | 44.39 | | [text2vec-base](https://huggingface.co/shibing624/text2vec-base-chinese) | 768 | 47.63 | 38.79 | 43.41 | 67.41 | 62.19 | 49.45 | 37.66 | | [text2vec-large](https://huggingface.co/GanymedeNil/text2vec-large-chinese) | 1024 | 47.36 | 41.94 | 44.97 | 70.86 | 60.66 | 49.16 | 30.02 | - **Reranking**: See [C_MTEB](https://github.com/FlagOpen/FlagEmbedding/blob/master/C_MTEB/) for evaluation script. | Model | T2Reranking | T2RerankingZh2En\* | T2RerankingEn2Zh\* | MMarcoReranking | CMedQAv1 | CMedQAv2 | Avg | |:-------------------------------|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:|:--------:| | text2vec-base-multilingual | 64.66 | 62.94 | 62.51 | 14.37 | 48.46 | 48.6 | 50.26 | | multilingual-e5-small | 65.62 | 60.94 | 56.41 | 29.91 | 67.26 | 66.54 | 57.78 | | multilingual-e5-large | 64.55 | 61.61 | 54.28 | 28.6 | 67.42 | 67.92 | 57.4 | | multilingual-e5-base | 64.21 | 62.13 | 54.68 | 29.5 | 66.23 | 66.98 | 57.29 | | m3e-base | 66.03 | 62.74 | 56.07 | 17.51 | 77.05 | 76.76 | 59.36 | | m3e-large | 66.13 | 62.72 | 56.1 | 16.46 | 77.76 | 78.27 | 59.57 | | bge-base-zh-v1.5 | 66.49 | 63.25 | 57.02 | 29.74 | 80.47 | 84.88 | 63.64 | | bge-large-zh-v1.5 | 65.74 | 63.39 | 57.03 | 28.74 | 83.45 | 85.44 | 63.97 | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | 67.28 | 63.95 | 60.45 | 35.46 | 81.26 | 84.1 | 65.42 | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | 67.6 | 64.03 | 61.44 | 37.16 | 82.15 | 84.18 | 66.09 | \* : T2RerankingZh2En and T2RerankingEn2Zh are cross-language retrieval tasks ## Train ### BAAI Embedding We pre-train the models using [retromae](https://github.com/staoxiao/RetroMAE) and train them on large-scale pair data using contrastive learning. **You can fine-tune the embedding model on your data following our [examples](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/finetune).** We also provide a [pre-train example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/pretrain). Note that the goal of pre-training is to reconstruct the text, and the pre-trained model cannot be used for similarity calculation directly, it needs to be fine-tuned. For more training details for bge see [baai_general_embedding](https://github.com/FlagOpen/FlagEmbedding/blob/master/FlagEmbedding/baai_general_embedding/README.md). ### BGE Reranker Cross-encoder will perform full-attention over the input pair, which is more accurate than embedding model (i.e., bi-encoder) but more time-consuming than embedding model. Therefore, it can be used to re-rank the top-k documents returned by embedding model. We train the cross-encoder on a multilingual pair data, The data format is the same as embedding model, so you can fine-tune it easily following our [example](https://github.com/FlagOpen/FlagEmbedding/tree/master/examples/reranker). For more details please refer to [./FlagEmbedding/reranker/README.md](https://github.com/FlagOpen/FlagEmbedding/tree/master/FlagEmbedding/reranker) ### Our Contributors: <a href="https://github.com/FlagOpen/FlagEmbedding/graphs/contributors"> <img src="https://contrib.rocks/image?repo=FlagOpen/FlagEmbedding" /> </a> ## Contact If you have any question or suggestion related to this project, feel free to open an issue or pull request. You also can email Shitao Xiao(stxiao@baai.ac.cn) and Zheng Liu(liuzheng@baai.ac.cn). ## Citation If you find this repository useful, please consider giving a star :star: and citation ``` @misc{bge_embedding, title={C-Pack: Packaged Resources To Advance General Chinese Embedding}, author={Shitao Xiao and Zheng Liu and Peitian Zhang and Niklas Muennighoff}, year={2023}, eprint={2309.07597}, archivePrefix={arXiv}, primaryClass={cs.CL} } @misc{llm_embedder, title={Retrieve Anything To Augment Large Language Models}, author={Peitian Zhang and Shitao Xiao and Zheng Liu and Zhicheng Dou and Jian-Yun Nie}, year={2023}, eprint={2310.07554}, archivePrefix={arXiv}, primaryClass={cs.IR} } ``` ## License FlagEmbedding is licensed under the [MIT License](https://github.com/FlagOpen/FlagEmbedding/blob/master/LICENSE). The released models can be used for commercial purposes free of charge.

upstage/SOLAR-10.7B-Instruct-v1.0

upstage

transformers

text-generation

--- datasets: - c-s-ale/alpaca-gpt4-data - Open-Orca/OpenOrca - Intel/orca_dpo_pairs - allenai/ultrafeedback_binarized_cleaned language: - en license: cc-by-nc-4.0 base_model: - upstage/SOLAR-10.7B-v1.0 --- <p align="left"> <a href="https://console.upstage.ai/"> <img src="https://huggingface.co/upstage/SOLAR-10.7B-Instruct-v1.0/resolve/main/solar-api-banner.png" width="100%"/> </a> <p> # **Meet 10.7B Solar: Elevating Performance with Upstage Depth UP Scaling!** **(This model is [upstage/SOLAR-10.7B-v1.0](https://huggingface.co/upstage/SOLAR-10.7B-v1.0) fine-tuned version for single-turn conversation.)** # **Introduction** We introduce SOLAR-10.7B, an advanced large language model (LLM) with 10.7 billion parameters, demonstrating superior performance in various natural language processing (NLP) tasks. It's compact, yet remarkably powerful, and demonstrates unparalleled state-of-the-art performance in models with parameters under 30B. We present a methodology for scaling LLMs called depth up-scaling (DUS) , which encompasses architectural modifications and continued pretraining. In other words, we integrated Mistral 7B weights into the upscaled layers, and finally, continued pre-training for the entire model. SOLAR-10.7B has remarkable performance. It outperforms models with up to 30B parameters, even surpassing the recent Mixtral 8X7B model. For detailed information, please refer to the experimental table. Solar 10.7B is an ideal choice for fine-tuning. SOLAR-10.7B offers robustness and adaptability for your fine-tuning needs. Our simple instruction fine-tuning using the SOLAR-10.7B pre-trained model yields significant performance improvements. For full details of this model please read our [paper](https://arxiv.org/abs/2312.15166). # **Instruction Fine-Tuning Strategy** We utilize state-of-the-art instruction fine-tuning methods including supervised fine-tuning (SFT) and direct preference optimization (DPO) [1]. We used a mixture of the following datasets - c-s-ale/alpaca-gpt4-data (SFT) - Open-Orca/OpenOrca (SFT) - in-house generated data utilizing Metamath [2] (SFT, DPO) - Intel/orca_dpo_pairs (DPO) - allenai/ultrafeedback_binarized_cleaned (DPO) where we were careful of data contamination by not using GSM8K samples when generating data and filtering tasks when applicable via the following list. ```python filtering_task_list = [ 'task228_arc_answer_generation_easy', 'ai2_arc/ARC-Challenge:1.0.0', 'ai2_arc/ARC-Easy:1.0.0', 'task229_arc_answer_generation_hard', 'hellaswag:1.1.0', 'task1389_hellaswag_completion', 'cot_gsm8k', 'cot_gsm8k_ii', 'drop:2.0.0', 'winogrande:1.1.0' ] ``` Using the datasets mentioned above, we applied SFT and iterative DPO training, a proprietary alignment strategy, to maximize the performance of our resulting model. [1] Rafailov, R., Sharma, A., Mitchell, E., Ermon, S., Manning, C.D. and Finn, C., 2023. Direct preference optimization: Your language model is secretly a reward model. NeurIPS. [2] Yu, L., Jiang, W., Shi, H., Yu, J., Liu, Z., Zhang, Y., Kwok, J.T., Li, Z., Weller, A. and Liu, W., 2023. Metamath: Bootstrap your own mathematical questions for large language models. arXiv preprint arXiv:2309.12284. # **Data Contamination Test Results** Recently, there have been contamination issues in some models on the LLM leaderboard. We note that we made every effort to exclude any benchmark-related datasets from training. We also ensured the integrity of our model by conducting a data contamination test [3] that is also used by the HuggingFace team [4, 5]. Our results, with `result < 0.1, %:` being well below 0.9, indicate that our model is free from contamination. *The data contamination test results of HellaSwag and Winograde will be added once [3] supports them.* | Model | ARC | MMLU | TruthfulQA | GSM8K | |------------------------------|-------|-------|-------|-------| | **SOLAR-10.7B-Instruct-v1.0**| result < 0.1, %: 0.06 |result < 0.1, %: 0.15 | result < 0.1, %: 0.28 | result < 0.1, %: 0.70 | [3] https://github.com/swj0419/detect-pretrain-code-contamination [4] https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard/discussions/474#657f2245365456e362412a06 [5] https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard/discussions/265#657b6debf81f6b44b8966230 # **Evaluation Results** | Model | H6 | Model Size | |----------------------------------------|-------|------------| | **SOLAR-10.7B-Instruct-v1.0** | **74.20** | **~ 11B** | | mistralai/Mixtral-8x7B-Instruct-v0.1 | 72.62 | ~ 46.7B | | 01-ai/Yi-34B-200K | 70.81 | ~ 34B | | 01-ai/Yi-34B | 69.42 | ~ 34B | | mistralai/Mixtral-8x7B-v0.1 | 68.42 | ~ 46.7B | | meta-llama/Llama-2-70b-hf | 67.87 | ~ 70B | | tiiuae/falcon-180B | 67.85 | ~ 180B | | **SOLAR-10.7B-v1.0** | **66.04** | **~11B** | | mistralai/Mistral-7B-Instruct-v0.2 | 65.71 | ~ 7B | | Qwen/Qwen-14B | 65.86 | ~ 14B | | 01-ai/Yi-34B-Chat | 65.32 | ~34B | | meta-llama/Llama-2-70b-chat-hf | 62.4 | ~ 70B | | mistralai/Mistral-7B-v0.1 | 60.97 | ~ 7B | | mistralai/Mistral-7B-Instruct-v0.1 | 54.96 | ~ 7B | # **Usage Instructions** This model has been fine-tuned primarily for single-turn conversation, making it less suitable for multi-turn conversations such as chat. ### **Version** Make sure you have the correct version of the transformers library installed: ```sh pip install transformers==4.35.2 ``` ### **Loading the Model** Use the following Python code to load the model: ```python import torch from transformers import AutoModelForCausalLM, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained("Upstage/SOLAR-10.7B-Instruct-v1.0") model = AutoModelForCausalLM.from_pretrained( "Upstage/SOLAR-10.7B-Instruct-v1.0", device_map="auto", torch_dtype=torch.float16, ) ``` ### **Conducting Single-Turn Conversation** ```python conversation = [ {'role': 'user', 'content': 'Hello?'} ] prompt = tokenizer.apply_chat_template(conversation, tokenize=False, add_generation_prompt=True) inputs = tokenizer(prompt, return_tensors="pt").to(model.device) outputs = model.generate(**inputs, use_cache=True, max_length=4096) output_text = tokenizer.decode(outputs[0]) print(output_text) ``` Below is an example of the output. ``` <s> ### User: Hello? ### Assistant: Hello, how can I assist you today? Please feel free to ask any questions or request help with a specific task.</s> ``` ### **License** - [upstage/SOLAR-10.7B-v1.0](https://huggingface.co/upstage/SOLAR-10.7B-v1.0): apache-2.0 - [upstage/SOLAR-10.7B-Instruct-v1.0](https://huggingface.co/upstage/SOLAR-10.7B-Instruct-v1.0): cc-by-nc-4.0 - Since some non-commercial datasets such as Alpaca are used for fine-tuning, we release this model as cc-by-nc-4.0. ### **How to Cite** Please cite the following papers using the below format when using this model. ```bibtex @misc{kim2023solar, title={SOLAR 10.7B: Scaling Large Language Models with Simple yet Effective Depth Up-Scaling}, author={Dahyun Kim and Chanjun Park and Sanghoon Kim and Wonsung Lee and Wonho Song and Yunsu Kim and Hyeonwoo Kim and Yungi Kim and Hyeonju Lee and Jihoo Kim and Changbae Ahn and Seonghoon Yang and Sukyung Lee and Hyunbyung Park and Gyoungjin Gim and Mikyoung Cha and Hwalsuk Lee and Sunghun Kim}, year={2023}, eprint={2312.15166}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` ```bibtext @misc{kim2024sdpo, title={sDPO: Don't Use Your Data All at Once}, author={Dahyun Kim and Yungi Kim and Wonho Song and Hyeonwoo Kim and Yunsu Kim and Sanghoon Kim and Chanjun Park}, year={2024}, eprint={2403.19270}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` ### **The Upstage AI Team** ### Upstage is creating the best LLM and DocAI. Please find more information at https://upstage.ai ### **Contact Us** ### Any questions and suggestions, please use the discussion tab. If you want to contact us directly, drop an email to [contact@upstage.ai](mailto:contact@upstage.ai)

cahya/bert-base-indonesian-NER

cahya

transformers

token-classification

--- license: mit language: - id pipeline_tag: token-classification ---

InstantX/InstantID

InstantX

diffusers

text-to-image

--- license: apache-2.0 language: - en library_name: diffusers pipeline_tag: text-to-image --- # InstantID Model Card <div align="center"> [**Project Page**](https://instantid.github.io/) **|** [**Paper**](https://arxiv.org/abs/2401.07519) **|** [**Code**](https://github.com/InstantID/InstantID) **|** [🤗 **Gradio demo**](https://huggingface.co/spaces/InstantX/InstantID) </div> ## Introduction InstantID is a new state-of-the-art tuning-free method to achieve ID-Preserving generation with only single image, supporting various downstream tasks. <div align="center"> <img src='examples/applications.png'> </div> ## Usage You can directly download the model in this repository. You also can download the model in python script: ```python from huggingface_hub import hf_hub_download hf_hub_download(repo_id="InstantX/InstantID", filename="ControlNetModel/config.json", local_dir="./checkpoints") hf_hub_download(repo_id="InstantX/InstantID", filename="ControlNetModel/diffusion_pytorch_model.safetensors", local_dir="./checkpoints") hf_hub_download(repo_id="InstantX/InstantID", filename="ip-adapter.bin", local_dir="./checkpoints") ``` For face encoder, you need to manutally download via this [URL](https://github.com/deepinsight/insightface/issues/1896#issuecomment-1023867304) to `models/antelopev2`. ```python # !pip install opencv-python transformers accelerate insightface import diffusers from diffusers.utils import load_image from diffusers.models import ControlNetModel import cv2 import torch import numpy as np from PIL import Image from insightface.app import FaceAnalysis from pipeline_stable_diffusion_xl_instantid import StableDiffusionXLInstantIDPipeline, draw_kps # prepare 'antelopev2' under ./models app = FaceAnalysis(name='antelopev2', root='./', providers=['CUDAExecutionProvider', 'CPUExecutionProvider']) app.prepare(ctx_id=0, det_size=(640, 640)) # prepare models under ./checkpoints face_adapter = f'./checkpoints/ip-adapter.bin' controlnet_path = f'./checkpoints/ControlNetModel' # load IdentityNet controlnet = ControlNetModel.from_pretrained(controlnet_path, torch_dtype=torch.float16) pipe = StableDiffusionXLInstantIDPipeline.from_pretrained( ... "stabilityai/stable-diffusion-xl-base-1.0", controlnet=controlnet, torch_dtype=torch.float16 ... ) pipe.cuda() # load adapter pipe.load_ip_adapter_instantid(face_adapter) ``` Then, you can customized your own face images ```python # load an image image = load_image("your-example.jpg") # prepare face emb face_info = app.get(cv2.cvtColor(np.array(face_image), cv2.COLOR_RGB2BGR)) face_info = sorted(face_info, key=lambda x:(x['bbox'][2]-x['bbox'][0])*x['bbox'][3]-x['bbox'][1])[-1] # only use the maximum face face_emb = face_info['embedding'] face_kps = draw_kps(face_image, face_info['kps']) pipe.set_ip_adapter_scale(0.8) prompt = "analog film photo of a man. faded film, desaturated, 35mm photo, grainy, vignette, vintage, Kodachrome, Lomography, stained, highly detailed, found footage, masterpiece, best quality" negative_prompt = "(lowres, low quality, worst quality:1.2), (text:1.2), watermark, painting, drawing, illustration, glitch, deformed, mutated, cross-eyed, ugly, disfigured (lowres, low quality, worst quality:1.2), (text:1.2), watermark, painting, drawing, illustration, glitch,deformed, mutated, cross-eyed, ugly, disfigured" # generate image image = pipe( ... prompt, image_embeds=face_emb, image=face_kps, controlnet_conditioning_scale=0.8 ... ).images[0] ``` For more details, please follow the instructions in our [GitHub repository](https://github.com/InstantID/InstantID). ## Usage Tips 1. If you're not satisfied with the similarity, try to increase the weight of "IdentityNet Strength" and "Adapter Strength". 2. If you feel that the saturation is too high, first decrease the Adapter strength. If it is still too high, then decrease the IdentityNet strength. 3. If you find that text control is not as expected, decrease Adapter strength. 4. If you find that realistic style is not good enough, go for our Github repo and use a more realistic base model. ## Demos <div align="center"> <img src='examples/0.png'> </div> <div align="center"> <img src='examples/1.png'> </div> ## Disclaimer This project is released under Apache License and aims to positively impact the field of AI-driven image generation. Users are granted the freedom to create images using this tool, but they are obligated to comply with local laws and utilize it responsibly. The developers will not assume any responsibility for potential misuse by users. ## Citation ```bibtex @article{wang2024instantid, title={InstantID: Zero-shot Identity-Preserving Generation in Seconds}, author={Wang, Qixun and Bai, Xu and Wang, Haofan and Qin, Zekui and Chen, Anthony}, journal={arXiv preprint arXiv:2401.07519}, year={2024} } ```

TheBloke/Mistral-7B-Instruct-v0.2-GGUF

TheBloke

transformers

text-generation

--- base_model: mistralai/Mistral-7B-Instruct-v0.2 inference: false license: apache-2.0 model_creator: Mistral AI_ model_name: Mistral 7B Instruct v0.2 model_type: mistral pipeline_tag: text-generation prompt_template: '<s>[INST] {prompt} [/INST] ' quantized_by: TheBloke tags: - finetuned --- <!-- markdownlint-disable MD041 --> <!-- header start --> <!-- 200823 --> <div style="width: auto; margin-left: auto; margin-right: auto"> <img src="https://i.imgur.com/EBdldam.jpg" alt="TheBlokeAI" style="width: 100%; min-width: 400px; display: block; margin: auto;"> </div> <div style="display: flex; justify-content: space-between; width: 100%;"> <div style="display: flex; flex-direction: column; align-items: flex-start;"> <p style="margin-top: 0.5em; margin-bottom: 0em;"><a href="https://discord.gg/theblokeai">Chat & support: TheBloke's Discord server</a></p> </div> <div style="display: flex; flex-direction: column; align-items: flex-end;"> <p style="margin-top: 0.5em; margin-bottom: 0em;"><a href="https://www.patreon.com/TheBlokeAI">Want to contribute? TheBloke's Patreon page</a></p> </div> </div> <div style="text-align:center; margin-top: 0em; margin-bottom: 0em"><p style="margin-top: 0.25em; margin-bottom: 0em;">TheBloke's LLM work is generously supported by a grant from <a href="https://a16z.com">andreessen horowitz (a16z)</a></p></div> <hr style="margin-top: 1.0em; margin-bottom: 1.0em;"> <!-- header end --> # Mistral 7B Instruct v0.2 - GGUF - Model creator: [Mistral AI_](https://huggingface.co/mistralai) - Original model: [Mistral 7B Instruct v0.2](https://huggingface.co/mistralai/Mistral-7B-Instruct-v0.2) <!-- description start --> ## Description This repo contains GGUF format model files for [Mistral AI_'s Mistral 7B Instruct v0.2](https://huggingface.co/mistralai/Mistral-7B-Instruct-v0.2). These files were quantised using hardware kindly provided by [Massed Compute](https://massedcompute.com/). <!-- description end --> <!-- README_GGUF.md-about-gguf start --> ### About GGUF GGUF is a new format introduced by the llama.cpp team on August 21st 2023. It is a replacement for GGML, which is no longer supported by llama.cpp. Here is an incomplete list of clients and libraries that are known to support GGUF: * [llama.cpp](https://github.com/ggerganov/llama.cpp). The source project for GGUF. Offers a CLI and a server option. * [text-generation-webui](https://github.com/oobabooga/text-generation-webui), the most widely used web UI, with many features and powerful extensions. Supports GPU acceleration. * [KoboldCpp](https://github.com/LostRuins/koboldcpp), a fully featured web UI, with GPU accel across all platforms and GPU architectures. Especially good for story telling. * [GPT4All](https://gpt4all.io/index.html), a free and open source local running GUI, supporting Windows, Linux and macOS with full GPU accel. * [LM Studio](https://lmstudio.ai/), an easy-to-use and powerful local GUI for Windows and macOS (Silicon), with GPU acceleration. Linux available, in beta as of 27/11/2023. * [LoLLMS Web UI](https://github.com/ParisNeo/lollms-webui), a great web UI with many interesting and unique features, including a full model library for easy model selection. * [Faraday.dev](https://faraday.dev/), an attractive and easy to use character-based chat GUI for Windows and macOS (both Silicon and Intel), with GPU acceleration. * [llama-cpp-python](https://github.com/abetlen/llama-cpp-python), a Python library with GPU accel, LangChain support, and OpenAI-compatible API server. * [candle](https://github.com/huggingface/candle), a Rust ML framework with a focus on performance, including GPU support, and ease of use. * [ctransformers](https://github.com/marella/ctransformers), a Python library with GPU accel, LangChain support, and OpenAI-compatible AI server. Note, as of time of writing (November 27th 2023), ctransformers has not been updated in a long time and does not support many recent models. <!-- README_GGUF.md-about-gguf end --> <!-- repositories-available start --> ## Repositories available * [AWQ model(s) for GPU inference.](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-AWQ) * [GPTQ models for GPU inference, with multiple quantisation parameter options.](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GPTQ) * [2, 3, 4, 5, 6 and 8-bit GGUF models for CPU+GPU inference](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF) * [Mistral AI_'s original unquantised fp16 model in pytorch format, for GPU inference and for further conversions](https://huggingface.co/mistralai/Mistral-7B-Instruct-v0.2) <!-- repositories-available end --> <!-- prompt-template start --> ## Prompt template: Mistral ``` <s>[INST] {prompt} [/INST] ``` <!-- prompt-template end --> <!-- compatibility_gguf start --> ## Compatibility These quantised GGUFv2 files are compatible with llama.cpp from August 27th onwards, as of commit [d0cee0d](https://github.com/ggerganov/llama.cpp/commit/d0cee0d36d5be95a0d9088b674dbb27354107221) They are also compatible with many third party UIs and libraries - please see the list at the top of this README. ## Explanation of quantisation methods <details> <summary>Click to see details</summary> The new methods available are: * GGML_TYPE_Q2_K - "type-1" 2-bit quantization in super-blocks containing 16 blocks, each block having 16 weight. Block scales and mins are quantized with 4 bits. This ends up effectively using 2.5625 bits per weight (bpw) * GGML_TYPE_Q3_K - "type-0" 3-bit quantization in super-blocks containing 16 blocks, each block having 16 weights. Scales are quantized with 6 bits. This end up using 3.4375 bpw. * GGML_TYPE_Q4_K - "type-1" 4-bit quantization in super-blocks containing 8 blocks, each block having 32 weights. Scales and mins are quantized with 6 bits. This ends up using 4.5 bpw. * GGML_TYPE_Q5_K - "type-1" 5-bit quantization. Same super-block structure as GGML_TYPE_Q4_K resulting in 5.5 bpw * GGML_TYPE_Q6_K - "type-0" 6-bit quantization. Super-blocks with 16 blocks, each block having 16 weights. Scales are quantized with 8 bits. This ends up using 6.5625 bpw Refer to the Provided Files table below to see what files use which methods, and how. </details> <!-- compatibility_gguf end --> <!-- README_GGUF.md-provided-files start --> ## Provided files | Name | Quant method | Bits | Size | Max RAM required | Use case | | ---- | ---- | ---- | ---- | ---- | ----- | | [mistral-7b-instruct-v0.2.Q2_K.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q2_K.gguf) | Q2_K | 2 | 3.08 GB| 5.58 GB | smallest, significant quality loss - not recommended for most purposes | | [mistral-7b-instruct-v0.2.Q3_K_S.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q3_K_S.gguf) | Q3_K_S | 3 | 3.16 GB| 5.66 GB | very small, high quality loss | | [mistral-7b-instruct-v0.2.Q3_K_M.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q3_K_M.gguf) | Q3_K_M | 3 | 3.52 GB| 6.02 GB | very small, high quality loss | | [mistral-7b-instruct-v0.2.Q3_K_L.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q3_K_L.gguf) | Q3_K_L | 3 | 3.82 GB| 6.32 GB | small, substantial quality loss | | [mistral-7b-instruct-v0.2.Q4_0.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q4_0.gguf) | Q4_0 | 4 | 4.11 GB| 6.61 GB | legacy; small, very high quality loss - prefer using Q3_K_M | | [mistral-7b-instruct-v0.2.Q4_K_S.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q4_K_S.gguf) | Q4_K_S | 4 | 4.14 GB| 6.64 GB | small, greater quality loss | | [mistral-7b-instruct-v0.2.Q4_K_M.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q4_K_M.gguf) | Q4_K_M | 4 | 4.37 GB| 6.87 GB | medium, balanced quality - recommended | | [mistral-7b-instruct-v0.2.Q5_0.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q5_0.gguf) | Q5_0 | 5 | 5.00 GB| 7.50 GB | legacy; medium, balanced quality - prefer using Q4_K_M | | [mistral-7b-instruct-v0.2.Q5_K_S.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q5_K_S.gguf) | Q5_K_S | 5 | 5.00 GB| 7.50 GB | large, low quality loss - recommended | | [mistral-7b-instruct-v0.2.Q5_K_M.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q5_K_M.gguf) | Q5_K_M | 5 | 5.13 GB| 7.63 GB | large, very low quality loss - recommended | | [mistral-7b-instruct-v0.2.Q6_K.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q6_K.gguf) | Q6_K | 6 | 5.94 GB| 8.44 GB | very large, extremely low quality loss | | [mistral-7b-instruct-v0.2.Q8_0.gguf](https://huggingface.co/TheBloke/Mistral-7B-Instruct-v0.2-GGUF/blob/main/mistral-7b-instruct-v0.2.Q8_0.gguf) | Q8_0 | 8 | 7.70 GB| 10.20 GB | very large, extremely low quality loss - not recommended | **Note**: the above RAM figures assume no GPU offloading. If layers are offloaded to the GPU, this will reduce RAM usage and use VRAM instead. <!-- README_GGUF.md-provided-files end --> <!-- README_GGUF.md-how-to-download start --> ## How to download GGUF files **Note for manual downloaders:** You almost never want to clone the entire repo! Multiple different quantisation formats are provided, and most users only want to pick and download a single file. The following clients/libraries will automatically download models for you, providing a list of available models to choose from: * LM Studio * LoLLMS Web UI * Faraday.dev ### In `text-generation-webui` Under Download Model, you can enter the model repo: TheBloke/Mistral-7B-Instruct-v0.2-GGUF and below it, a specific filename to download, such as: mistral-7b-instruct-v0.2.Q4_K_M.gguf. Then click Download. ### On the command line, including multiple files at once I recommend using the `huggingface-hub` Python library: ```shell pip3 install huggingface-hub ``` Then you can download any individual model file to the current directory, at high speed, with a command like this: ```shell huggingface-cli download TheBloke/Mistral-7B-Instruct-v0.2-GGUF mistral-7b-instruct-v0.2.Q4_K_M.gguf --local-dir . --local-dir-use-symlinks False ``` <details> <summary>More advanced huggingface-cli download usage (click to read)</summary> You can also download multiple files at once with a pattern: ```shell huggingface-cli download TheBloke/Mistral-7B-Instruct-v0.2-GGUF --local-dir . --local-dir-use-symlinks False --include='*Q4_K*gguf' ``` For more documentation on downloading with `huggingface-cli`, please see: [HF -> Hub Python Library -> Download files -> Download from the CLI](https://huggingface.co/docs/huggingface_hub/guides/download#download-from-the-cli). To accelerate downloads on fast connections (1Gbit/s or higher), install `hf_transfer`: ```shell pip3 install hf_transfer ``` And set environment variable `HF_HUB_ENABLE_HF_TRANSFER` to `1`: ```shell HF_HUB_ENABLE_HF_TRANSFER=1 huggingface-cli download TheBloke/Mistral-7B-Instruct-v0.2-GGUF mistral-7b-instruct-v0.2.Q4_K_M.gguf --local-dir . --local-dir-use-symlinks False ``` Windows Command Line users: You can set the environment variable by running `set HF_HUB_ENABLE_HF_TRANSFER=1` before the download command. </details> <!-- README_GGUF.md-how-to-download end --> <!-- README_GGUF.md-how-to-run start --> ## Example `llama.cpp` command Make sure you are using `llama.cpp` from commit [d0cee0d](https://github.com/ggerganov/llama.cpp/commit/d0cee0d36d5be95a0d9088b674dbb27354107221) or later. ```shell ./main -ngl 35 -m mistral-7b-instruct-v0.2.Q4_K_M.gguf --color -c 32768 --temp 0.7 --repeat_penalty 1.1 -n -1 -p "<s>[INST] {prompt} [/INST]" ``` Change `-ngl 32` to the number of layers to offload to GPU. Remove it if you don't have GPU acceleration. Change `-c 32768` to the desired sequence length. For extended sequence models - eg 8K, 16K, 32K - the necessary RoPE scaling parameters are read from the GGUF file and set by llama.cpp automatically. Note that longer sequence lengths require much more resources, so you may need to reduce this value. If you want to have a chat-style conversation, replace the `-p <PROMPT>` argument with `-i -ins` For other parameters and how to use them, please refer to [the llama.cpp documentation](https://github.com/ggerganov/llama.cpp/blob/master/examples/main/README.md) ## How to run in `text-generation-webui` Further instructions can be found in the text-generation-webui documentation, here: [text-generation-webui/docs/04 ‐ Model Tab.md](https://github.com/oobabooga/text-generation-webui/blob/main/docs/04%20%E2%80%90%20Model%20Tab.md#llamacpp). ## How to run from Python code You can use GGUF models from Python using the [llama-cpp-python](https://github.com/abetlen/llama-cpp-python) or [ctransformers](https://github.com/marella/ctransformers) libraries. Note that at the time of writing (Nov 27th 2023), ctransformers has not been updated for some time and is not compatible with some recent models. Therefore I recommend you use llama-cpp-python. ### How to load this model in Python code, using llama-cpp-python For full documentation, please see: [llama-cpp-python docs](https://abetlen.github.io/llama-cpp-python/). #### First install the package Run one of the following commands, according to your system: ```shell # Base ctransformers with no GPU acceleration pip install llama-cpp-python # With NVidia CUDA acceleration CMAKE_ARGS="-DLLAMA_CUBLAS=on" pip install llama-cpp-python # Or with OpenBLAS acceleration CMAKE_ARGS="-DLLAMA_BLAS=ON -DLLAMA_BLAS_VENDOR=OpenBLAS" pip install llama-cpp-python # Or with CLBLast acceleration CMAKE_ARGS="-DLLAMA_CLBLAST=on" pip install llama-cpp-python # Or with AMD ROCm GPU acceleration (Linux only) CMAKE_ARGS="-DLLAMA_HIPBLAS=on" pip install llama-cpp-python # Or with Metal GPU acceleration for macOS systems only CMAKE_ARGS="-DLLAMA_METAL=on" pip install llama-cpp-python # In windows, to set the variables CMAKE_ARGS in PowerShell, follow this format; eg for NVidia CUDA: $env:CMAKE_ARGS = "-DLLAMA_OPENBLAS=on" pip install llama-cpp-python ``` #### Simple llama-cpp-python example code ```python from llama_cpp import Llama # Set gpu_layers to the number of layers to offload to GPU. Set to 0 if no GPU acceleration is available on your system. llm = Llama( model_path="./mistral-7b-instruct-v0.2.Q4_K_M.gguf", # Download the model file first n_ctx=32768, # The max sequence length to use - note that longer sequence lengths require much more resources n_threads=8, # The number of CPU threads to use, tailor to your system and the resulting performance n_gpu_layers=35 # The number of layers to offload to GPU, if you have GPU acceleration available ) # Simple inference example output = llm( "<s>[INST] {prompt} [/INST]", # Prompt max_tokens=512, # Generate up to 512 tokens stop=["</s>"], # Example stop token - not necessarily correct for this specific model! Please check before using. echo=True # Whether to echo the prompt ) # Chat Completion API llm = Llama(model_path="./mistral-7b-instruct-v0.2.Q4_K_M.gguf", chat_format="llama-2") # Set chat_format according to the model you are using llm.create_chat_completion( messages = [ {"role": "system", "content": "You are a story writing assistant."}, { "role": "user", "content": "Write a story about llamas." } ] ) ``` ## How to use with LangChain Here are guides on using llama-cpp-python and ctransformers with LangChain: * [LangChain + llama-cpp-python](https://python.langchain.com/docs/integrations/llms/llamacpp) * [LangChain + ctransformers](https://python.langchain.com/docs/integrations/providers/ctransformers) <!-- README_GGUF.md-how-to-run end --> <!-- footer start --> <!-- 200823 --> ## Discord For further support, and discussions on these models and AI in general, join us at: [TheBloke AI's Discord server](https://discord.gg/theblokeai) ## Thanks, and how to contribute Thanks to the [chirper.ai](https://chirper.ai) team! Thanks to Clay from [gpus.llm-utils.org](llm-utils)! I've had a lot of people ask if they can contribute. I enjoy providing models and helping people, and would love to be able to spend even more time doing it, as well as expanding into new projects like fine tuning/training. If you're able and willing to contribute it will be most gratefully received and will help me to keep providing more models, and to start work on new AI projects. Donaters will get priority support on any and all AI/LLM/model questions and requests, access to a private Discord room, plus other benefits. * Patreon: https://patreon.com/TheBlokeAI * Ko-Fi: https://ko-fi.com/TheBlokeAI **Special thanks to**: Aemon Algiz. **Patreon special mentions**: Michael Levine, 阿明, Trailburnt, Nikolai Manek, John Detwiler, Randy H, Will Dee, Sebastain Graf, NimbleBox.ai, Eugene Pentland, Emad Mostaque, Ai Maven, Jim Angel, Jeff Scroggin, Michael Davis, Manuel Alberto Morcote, Stephen Murray, Robert, Justin Joy, Luke @flexchar, Brandon Frisco, Elijah Stavena, S_X, Dan Guido, Undi ., Komninos Chatzipapas, Shadi, theTransient, Lone Striker, Raven Klaugh, jjj, Cap'n Zoog, Michel-Marie MAUDET (LINAGORA), Matthew Berman, David, Fen Risland, Omer Bin Jawed, Luke Pendergrass, Kalila, OG, Erik Bjäreholt, Rooh Singh, Joseph William Delisle, Dan Lewis, TL, John Villwock, AzureBlack, Brad, Pedro Madruga, Caitlyn Gatomon, K, jinyuan sun, Mano Prime, Alex, Jeffrey Morgan, Alicia Loh, Illia Dulskyi, Chadd, transmissions 11, fincy, Rainer Wilmers, ReadyPlayerEmma, knownsqashed, Mandus, biorpg, Deo Leter, Brandon Phillips, SuperWojo, Sean Connelly, Iucharbius, Jack West, Harry Royden McLaughlin, Nicholas, terasurfer, Vitor Caleffi, Duane Dunston, Johann-Peter Hartmann, David Ziegler, Olakabola, Ken Nordquist, Trenton Dambrowitz, Tom X Nguyen, Vadim, Ajan Kanaga, Leonard Tan, Clay Pascal, Alexandros Triantafyllidis, JM33133, Xule, vamX, ya boyyy, subjectnull, Talal Aujan, Alps Aficionado, wassieverse, Ari Malik, James Bentley, Woland, Spencer Kim, Michael Dempsey, Fred von Graf, Elle, zynix, William Richards, Stanislav Ovsiannikov, Edmond Seymore, Jonathan Leane, Martin Kemka, usrbinkat, Enrico Ros Thank you to all my generous patrons and donaters! And thank you again to a16z for their generous grant. <!-- footer end --> <!-- original-model-card start --> # Original model card: Mistral AI_'s Mistral 7B Instruct v0.2 # Model Card for Mistral-7B-Instruct-v0.2 The Mistral-7B-Instruct-v0.2 Large Language Model (LLM) is an improved instruct fine-tuned version of [Mistral-7B-Instruct-v0.1](https://huggingface.co/mistralai/Mistral-7B-Instruct-v0.1). For full details of this model please read our [paper](https://arxiv.org/abs/2310.06825) and [release blog post](https://mistral.ai/news/la-plateforme/). ## Instruction format In order to leverage instruction fine-tuning, your prompt should be surrounded by `[INST]` and `[/INST]` tokens. The very first instruction should begin with a begin of sentence id. The next instructions should not. The assistant generation will be ended by the end-of-sentence token id. E.g. ``` text = "<s>[INST] What is your favourite condiment? [/INST]" "Well, I'm quite partial to a good squeeze of fresh lemon juice. It adds just the right amount of zesty flavour to whatever I'm cooking up in the kitchen!</s> " "[INST] Do you have mayonnaise recipes? [/INST]" ``` This format is available as a [chat template](https://huggingface.co/docs/transformers/main/chat_templating) via the `apply_chat_template()` method: ```python from transformers import AutoModelForCausalLM, AutoTokenizer device = "cuda" # the device to load the model onto model = AutoModelForCausalLM.from_pretrained("mistralai/Mistral-7B-Instruct-v0.1") tokenizer = AutoTokenizer.from_pretrained("mistralai/Mistral-7B-Instruct-v0.1") messages = [ {"role": "user", "content": "What is your favourite condiment?"}, {"role": "assistant", "content": "Well, I'm quite partial to a good squeeze of fresh lemon juice. It adds just the right amount of zesty flavour to whatever I'm cooking up in the kitchen!"}, {"role": "user", "content": "Do you have mayonnaise recipes?"} ] encodeds = tokenizer.apply_chat_template(messages, return_tensors="pt") model_inputs = encodeds.to(device) model.to(device) generated_ids = model.generate(model_inputs, max_new_tokens=1000, do_sample=True) decoded = tokenizer.batch_decode(generated_ids) print(decoded[0]) ``` ## Model Architecture This instruction model is based on Mistral-7B-v0.1, a transformer model with the following architecture choices: - Grouped-Query Attention - Sliding-Window Attention - Byte-fallback BPE tokenizer ## Troubleshooting - If you see the following error: ``` Traceback (most recent call last): File "", line 1, in File "/transformers/models/auto/auto_factory.py", line 482, in from_pretrained config, kwargs = AutoConfig.from_pretrained( File "/transformers/models/auto/configuration_auto.py", line 1022, in from_pretrained config_class = CONFIG_MAPPING[config_dict["model_type"]] File "/transformers/models/auto/configuration_auto.py", line 723, in getitem raise KeyError(key) KeyError: 'mistral' ``` Installing transformers from source should solve the issue pip install git+https://github.com/huggingface/transformers This should not be required after transformers-v4.33.4. ## Limitations The Mistral 7B Instruct model is a quick demonstration that the base model can be easily fine-tuned to achieve compelling performance. It does not have any moderation mechanisms. We're looking forward to engaging with the community on ways to make the model finely respect guardrails, allowing for deployment in environments requiring moderated outputs. ## The Mistral AI Team Albert Jiang, Alexandre Sablayrolles, Arthur Mensch, Blanche Savary, Chris Bamford, Devendra Singh Chaplot, Diego de las Casas, Emma Bou Hanna, Florian Bressand, Gianna Lengyel, Guillaume Bour, Guillaume Lample, Lélio Renard Lavaud, Louis Ternon, Lucile Saulnier, Marie-Anne Lachaux, Pierre Stock, Teven Le Scao, Théophile Gervet, Thibaut Lavril, Thomas Wang, Timothée Lacroix, William El Sayed. <!-- original-model-card end -->

timm/swin_tiny_patch4_window7_224.ms_in1k

timm

timm

image-classification

--- license: mit library_name: timm tags: - image-classification - timm datasets: - imagenet-1k --- # Model card for swin_tiny_patch4_window7_224.ms_in1k A Swin Transformer image classification model. Pretrained on ImageNet-1k by paper authors. ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 28.3 - GMACs: 4.5 - Activations (M): 17.1 - Image size: 224 x 224 - **Papers:** - Swin Transformer: Hierarchical Vision Transformer using Shifted Windows: https://arxiv.org/abs/2103.14030 - **Original:** https://github.com/microsoft/Swin-Transformer - **Dataset:** ImageNet-1k ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('swin_tiny_patch4_window7_224.ms_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Feature Map Extraction ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'swin_tiny_patch4_window7_224.ms_in1k', pretrained=True, features_only=True, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 for o in output: # print shape of each feature map in output # e.g. for swin_base_patch4_window7_224 (NHWC output) # torch.Size([1, 56, 56, 128]) # torch.Size([1, 28, 28, 256]) # torch.Size([1, 14, 14, 512]) # torch.Size([1, 7, 7, 1024]) # e.g. for swinv2_cr_small_ns_224 (NCHW output) # torch.Size([1, 96, 56, 56]) # torch.Size([1, 192, 28, 28]) # torch.Size([1, 384, 14, 14]) # torch.Size([1, 768, 7, 7]) print(o.shape) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'swin_tiny_patch4_window7_224.ms_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled (ie.e a (batch_size, H, W, num_features) tensor for swin / swinv2 # or (batch_size, num_features, H, W) for swinv2_cr output = model.forward_head(output, pre_logits=True) # output is (batch_size, num_features) tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). ## Citation ```bibtex @inproceedings{liu2021Swin, title={Swin Transformer: Hierarchical Vision Transformer using Shifted Windows}, author={Liu, Ze and Lin, Yutong and Cao, Yue and Hu, Han and Wei, Yixuan and Zhang, Zheng and Lin, Stephen and Guo, Baining}, booktitle={Proceedings of the IEEE/CVF International Conference on Computer Vision (ICCV)}, year={2021} } ``` ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ```

facebook/bart-large

facebook

transformers

feature-extraction

--- license: apache-2.0 language: en --- # BART (large-sized model) BART model pre-trained on English language. It was introduced in the paper [BART: Denoising Sequence-to-Sequence Pre-training for Natural Language Generation, Translation, and Comprehension](https://arxiv.org/abs/1910.13461) by Lewis et al. and first released in [this repository](https://github.com/pytorch/fairseq/tree/master/examples/bart). Disclaimer: The team releasing BART did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description BART is a transformer encoder-decoder (seq2seq) model with a bidirectional (BERT-like) encoder and an autoregressive (GPT-like) decoder. BART is pre-trained by (1) corrupting text with an arbitrary noising function, and (2) learning a model to reconstruct the original text. BART is particularly effective when fine-tuned for text generation (e.g. summarization, translation) but also works well for comprehension tasks (e.g. text classification, question answering). ## Intended uses & limitations You can use the raw model for text infilling. However, the model is mostly meant to be fine-tuned on a supervised dataset. See the [model hub](https://huggingface.co/models?search=bart) to look for fine-tuned versions on a task that interests you. ### How to use Here is how to use this model in PyTorch: ```python from transformers import BartTokenizer, BartModel tokenizer = BartTokenizer.from_pretrained('facebook/bart-large') model = BartModel.from_pretrained('facebook/bart-large') inputs = tokenizer("Hello, my dog is cute", return_tensors="pt") outputs = model(**inputs) last_hidden_states = outputs.last_hidden_state ``` ### BibTeX entry and citation info ```bibtex @article{DBLP:journals/corr/abs-1910-13461, author = {Mike Lewis and Yinhan Liu and Naman Goyal and Marjan Ghazvininejad and Abdelrahman Mohamed and Omer Levy and Veselin Stoyanov and Luke Zettlemoyer}, title = {{BART:} Denoising Sequence-to-Sequence Pre-training for Natural Language Generation, Translation, and Comprehension}, journal = {CoRR}, volume = {abs/1910.13461}, year = {2019}, url = {http://arxiv.org/abs/1910.13461}, eprinttype = {arXiv}, eprint = {1910.13461}, timestamp = {Thu, 31 Oct 2019 14:02:26 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1910-13461.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ```

IDEA-CCNL/Erlangshen-Roberta-330M-Sentiment

IDEA-CCNL

transformers

text-classification

--- language: - zh license: apache-2.0 tags: - roberta - NLU - Sentiment - Chinese inference: true widget: - text: "今天心情不好" --- # Erlangshen-Roberta-330M-Sentiment - Main Page:[Fengshenbang](https://fengshenbang-lm.com/) - Github: [Fengshenbang-LM](https://github.com/IDEA-CCNL/Fengshenbang-LM) ## 简介 Brief Introduction 中文的RoBERTa-wwm-ext-large在数个情感分析任务微调后的版本 This is the fine-tuned version of the Chinese RoBERTa-wwm-ext-large model on several sentiment analysis datasets. ## 模型分类 Model Taxonomy | 需求 Demand | 任务 Task | 系列 Series | 模型 Model | 参数 Parameter | 额外 Extra | | :----: | :----: | :----: | :----: | :----: | :----: | | 通用 General | 自然语言理解 NLU | 二郎神 Erlangshen | Roberta | 330M | 中文-情感分析 Chinese-Sentiment | ## 模型信息 Model Information 基于[chinese-roberta-wwm-ext-large](https://huggingface.co/hfl/chinese-roberta-wwm-ext-large)，我们在收集的8个中文领域的情感分析数据集，总计227347个样本上微调了一个Semtiment版本。 Based on [chinese-roberta-wwm-ext-large](https://huggingface.co/hfl/chinese-roberta-wwm-ext-large), we fine-tuned a sentiment analysis version on 8 Chinese sentiment analysis datasets, with totaling 227,347 samples. ### 下游效果 Performance | 模型 Model | ASAP-SENT | ASAP-ASPECT | ChnSentiCorp | | :--------: | :-----: | :----: | :-----: | | Erlangshen-Roberta-110M-Sentiment | 97.77 | 97.31 | 96.61 | | Erlangshen-Roberta-330M-Sentiment | 97.9 | 97.51 | 96.66 | | Erlangshen-MegatronBert-1.3B-Sentiment | 98.1 | 97.8 | 97 | ## 使用 Usage ``` python from transformers import BertForSequenceClassification from transformers import BertTokenizer import torch tokenizer=BertTokenizer.from_pretrained('IDEA-CCNL/Erlangshen-Roberta-330M-Sentiment') model=BertForSequenceClassification.from_pretrained('IDEA-CCNL/Erlangshen-Roberta-330M-Sentiment') text='今天心情不好' output=model(torch.tensor([tokenizer.encode(text)])) print(torch.nn.functional.softmax(output.logits,dim=-1)) ``` ## 引用 Citation 如果您在您的工作中使用了我们的模型，可以引用我们的[论文](https://arxiv.org/abs/2209.02970)： If you are using the resource for your work, please cite the our [paper](https://arxiv.org/abs/2209.02970): ```text @article{fengshenbang, author = {Jiaxing Zhang and Ruyi Gan and Junjie Wang and Yuxiang Zhang and Lin Zhang and Ping Yang and Xinyu Gao and Ziwei Wu and Xiaoqun Dong and Junqing He and Jianheng Zhuo and Qi Yang and Yongfeng Huang and Xiayu Li and Yanghan Wu and Junyu Lu and Xinyu Zhu and Weifeng Chen and Ting Han and Kunhao Pan and Rui Wang and Hao Wang and Xiaojun Wu and Zhongshen Zeng and Chongpei Chen}, title = {Fengshenbang 1.0: Being the Foundation of Chinese Cognitive Intelligence}, journal = {CoRR}, volume = {abs/2209.02970}, year = {2022} } ``` 也可以引用我们的[网站](https://github.com/IDEA-CCNL/Fengshenbang-LM/): You can also cite our [website](https://github.com/IDEA-CCNL/Fengshenbang-LM/): ```text @misc{Fengshenbang-LM, title={Fengshenbang-LM}, author={IDEA-CCNL}, year={2021}, howpublished={\url{https://github.com/IDEA-CCNL/Fengshenbang-LM}}, } ```

tiiuae/falcon-40b-instruct

tiiuae

transformers

text-generation

--- datasets: - tiiuae/falcon-refinedweb language: - en inference: false license: apache-2.0 --- # ✨ Falcon-40B-Instruct **Falcon-40B-Instruct is a 40B parameters causal decoder-only model built by [TII](https://www.tii.ae) based on [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b) and finetuned on a mixture of [Baize](https://github.com/project-baize/baize-chatbot). It is made available under the Apache 2.0 license.** *Paper coming soon 😊.* 🤗 To get started with Falcon (inference, finetuning, quantization, etc.), we recommend reading [this great blogpost fron HF](https://huggingface.co/blog/falcon)! ## Why use Falcon-40B-Instruct? * **You are looking for a ready-to-use chat/instruct model based on [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b).** * **Falcon-40B is the best open-source model available.** It outperforms [LLaMA](https://github.com/facebookresearch/llama), [StableLM](https://github.com/Stability-AI/StableLM), [RedPajama](https://huggingface.co/togethercomputer/RedPajama-INCITE-Base-7B-v0.1), [MPT](https://huggingface.co/mosaicml/mpt-7b), etc. See the [OpenLLM Leaderboard](https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard). * **It features an architecture optimized for inference**, with FlashAttention ([Dao et al., 2022](https://arxiv.org/abs/2205.14135)) and multiquery ([Shazeer et al., 2019](https://arxiv.org/abs/1911.02150)). 💬 **This is an instruct model, which may not be ideal for further finetuning.** If you are interested in building your own instruct/chat model, we recommend starting from [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b). 💸 **Looking for a smaller, less expensive model?** [Falcon-7B-Instruct](https://huggingface.co/tiiuae/falcon-7b-instruct) is Falcon-40B-Instruct's little brother! ```python from transformers import AutoTokenizer, AutoModelForCausalLM import transformers import torch model = "tiiuae/falcon-40b-instruct" tokenizer = AutoTokenizer.from_pretrained(model) pipeline = transformers.pipeline( "text-generation", model=model, tokenizer=tokenizer, torch_dtype=torch.bfloat16, trust_remote_code=True, device_map="auto", ) sequences = pipeline( "Girafatron is obsessed with giraffes, the most glorious animal on the face of this Earth. Giraftron believes all other animals are irrelevant when compared to the glorious majesty of the giraffe.\nDaniel: Hello, Girafatron!\nGirafatron:", max_length=200, do_sample=True, top_k=10, num_return_sequences=1, eos_token_id=tokenizer.eos_token_id, ) for seq in sequences: print(f"Result: {seq['generated_text']}") ``` For fast inference with Falcon, check-out [Text Generation Inference](https://github.com/huggingface/text-generation-inference)! Read more in this [blogpost]((https://huggingface.co/blog/falcon). You will need **at least 85-100GB of memory** to swiftly run inference with Falcon-40B. # Model Card for Falcon-40B-Instruct ## Model Details ### Model Description - **Developed by:** [https://www.tii.ae](https://www.tii.ae); - **Model type:** Causal decoder-only; - **Language(s) (NLP):** English and French; - **License:** Apache 2.0; - **Finetuned from model:** [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b). ### Model Source - **Paper:** *coming soon*. ## Uses ### Direct Use Falcon-40B-Instruct has been finetuned on a chat dataset. ### Out-of-Scope Use Production use without adequate assessment of risks and mitigation; any use cases which may be considered irresponsible or harmful. ## Bias, Risks, and Limitations Falcon-40B-Instruct is mostly trained on English data, and will not generalize appropriately to other languages. Furthermore, as it is trained on a large-scale corpora representative of the web, it will carry the stereotypes and biases commonly encountered online. ### Recommendations We recommend users of Falcon-40B-Instruct to develop guardrails and to take appropriate precautions for any production use. ## How to Get Started with the Model ```python from transformers import AutoTokenizer, AutoModelForCausalLM import transformers import torch model = "tiiuae/falcon-40b-instruct" tokenizer = AutoTokenizer.from_pretrained(model) pipeline = transformers.pipeline( "text-generation", model=model, tokenizer=tokenizer, torch_dtype=torch.bfloat16, trust_remote_code=True, device_map="auto", ) sequences = pipeline( "Girafatron is obsessed with giraffes, the most glorious animal on the face of this Earth. Giraftron believes all other animals are irrelevant when compared to the glorious majesty of the giraffe.\nDaniel: Hello, Girafatron!\nGirafatron:", max_length=200, do_sample=True, top_k=10, num_return_sequences=1, eos_token_id=tokenizer.eos_token_id, ) for seq in sequences: print(f"Result: {seq['generated_text']}") ``` ## Training Details ### Training Data Falcon-40B-Instruct was finetuned on a 150M tokens from [Bai ze](https://github.com/project-baize/baize-chatbot) mixed with 5% of [RefinedWeb](https://huggingface.co/datasets/tiiuae/falcon-refinedweb) data. The data was tokenized with the Falcon-[7B](https://huggingface.co/tiiuae/falcon-7b)/[40B](https://huggingface.co/tiiuae/falcon-40b) tokenizer. ## Evaluation *Paper coming soon.* See the [OpenLLM Leaderboard](https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard) for early results. ## Technical Specifications For more information about pretraining, see [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b). ### Model Architecture and Objective Falcon-40B is a causal decoder-only model trained on a causal language modeling task (i.e., predict the next token). The architecture is broadly adapted from the GPT-3 paper ([Brown et al., 2020](https://arxiv.org/abs/2005.14165)), with the following differences: * **Positionnal embeddings:** rotary ([Su et al., 2021](https://arxiv.org/abs/2104.09864)); * **Attention:** multiquery ([Shazeer et al., 2019](https://arxiv.org/abs/1911.02150)) and FlashAttention ([Dao et al., 2022](https://arxiv.org/abs/2205.14135)); * **Decoder-block:** parallel attention/MLP with a single layer norm. For multiquery, we are using an internal variant which uses independent key and values per tensor parallel degree. | **Hyperparameter** | **Value** | **Comment** | |--------------------|-----------|----------------------------------------| | Layers | 60 | | | `d_model` | 8192 | | | `head_dim` | 64 | Reduced to optimise for FlashAttention | | Vocabulary | 65024 | | | Sequence length | 2048 | | ### Compute Infrastructure #### Hardware Falcon-40B-Instruct was trained on AWS SageMaker, on 64 A100 40GB GPUs in P4d instances. #### Software Falcon-40B-Instruct was trained a custom distributed training codebase, Gigatron. It uses a 3D parallelism approach combined with ZeRO and high-performance Triton kernels (FlashAttention, etc.) ## Citation *Paper coming soon* 😊. In the meanwhile, you can use the following information to cite: ``` @article{falcon40b, title={{Falcon-40B}: an open large language model with state-of-the-art performance}, author={Almazrouei, Ebtesam and Alobeidli, Hamza and Alshamsi, Abdulaziz and Cappelli, Alessandro and Cojocaru, Ruxandra and Debbah, Merouane and Goffinet, Etienne and Heslow, Daniel and Launay, Julien and Malartic, Quentin and Noune, Badreddine and Pannier, Baptiste and Penedo, Guilherme}, year={2023} } ``` To learn more about the pretraining dataset, see the 📓 [RefinedWeb paper](https://arxiv.org/abs/2306.01116). ``` @article{refinedweb, title={The {R}efined{W}eb dataset for {F}alcon {LLM}: outperforming curated corpora with web data, and web data only}, author={Guilherme Penedo and Quentin Malartic and Daniel Hesslow and Ruxandra Cojocaru and Alessandro Cappelli and Hamza Alobeidli and Baptiste Pannier and Ebtesam Almazrouei and Julien Launay}, journal={arXiv preprint arXiv:2306.01116}, eprint={2306.01116}, eprinttype = {arXiv}, url={https://arxiv.org/abs/2306.01116}, year={2023} } ``` To cite the [Baize](https://github.com/project-baize/baize-chatbot) instruction dataset used for this model: ``` @article{xu2023baize, title={Baize: An Open-Source Chat Model with Parameter-Efficient Tuning on Self-Chat Data}, author={Xu, Canwen and Guo, Daya and Duan, Nan and McAuley, Julian}, journal={arXiv preprint arXiv:2304.01196}, year={2023} } ``` ## License Falcon-40B-Instruct is made available under the Apache 2.0 license. ## Contact falconllm@tii.ae

sentence-transformers/paraphrase-MiniLM-L12-v2

sentence-transformers

sentence-transformers

sentence-similarity

--- license: apache-2.0 library_name: sentence-transformers tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers pipeline_tag: sentence-similarity --- # sentence-transformers/paraphrase-MiniLM-L12-v2 This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 384 dimensional dense vector space and can be used for tasks like clustering or semantic search. ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer sentences = ["This is an example sentence", "Each sentence is converted"] model = SentenceTransformer('sentence-transformers/paraphrase-MiniLM-L12-v2') embeddings = model.encode(sentences) print(embeddings) ``` ## Usage (HuggingFace Transformers) Without [sentence-transformers](https://www.SBERT.net), you can use the model like this: First, you pass your input through the transformer model, then you have to apply the right pooling-operation on-top of the contextualized word embeddings. ```python from transformers import AutoTokenizer, AutoModel import torch #Mean Pooling - Take attention mask into account for correct averaging def mean_pooling(model_output, attention_mask): token_embeddings = model_output[0] #First element of model_output contains all token embeddings input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) # Sentences we want sentence embeddings for sentences = ['This is an example sentence', 'Each sentence is converted'] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('sentence-transformers/paraphrase-MiniLM-L12-v2') model = AutoModel.from_pretrained('sentence-transformers/paraphrase-MiniLM-L12-v2') # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, max pooling. sentence_embeddings = mean_pooling(model_output, encoded_input['attention_mask']) print("Sentence embeddings:") print(sentence_embeddings) ``` ## Evaluation Results For an automated evaluation of this model, see the *Sentence Embeddings Benchmark*: [https://seb.sbert.net](https://seb.sbert.net?model_name=sentence-transformers/paraphrase-MiniLM-L12-v2) ## Full Model Architecture ``` SentenceTransformer( (0): Transformer({'max_seq_length': 128, 'do_lower_case': False}) with Transformer model: BertModel (1): Pooling({'word_embedding_dimension': 384, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False}) ) ``` ## Citing & Authors This model was trained by [sentence-transformers](https://www.sbert.net/). If you find this model helpful, feel free to cite our publication [Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks](https://arxiv.org/abs/1908.10084): ```bibtex @inproceedings{reimers-2019-sentence-bert, title = "Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks", author = "Reimers, Nils and Gurevych, Iryna", booktitle = "Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing", month = "11", year = "2019", publisher = "Association for Computational Linguistics", url = "http://arxiv.org/abs/1908.10084", } ```

microsoft/phi-1_5

microsoft

transformers

text-generation

--- license: mit license_link: https://huggingface.co/microsoft/phi-1_5/resolve/main/LICENSE language: - en pipeline_tag: text-generation tags: - nlp - code --- ## Model Summary The language model Phi-1.5 is a Transformer with **1.3 billion** parameters. It was trained using the same data sources as [phi-1](https://huggingface.co/microsoft/phi-1), augmented with a new data source that consists of various NLP synthetic texts. When assessed against benchmarks testing common sense, language understanding, and logical reasoning, Phi-1.5 demonstrates a nearly state-of-the-art performance among models with less than 10 billion parameters. We **did not** fine-tune Phi-1.5 either for **instruction following or through reinforcement learning from human feedback**. The intention behind crafting this open-source model is to provide the research community with a non-restricted small model to explore vital safety challenges, such as reducing toxicity, understanding societal biases, enhancing controllability, and more. For a safer model release, we exclude generic web-crawl data sources such as common-crawl from the training. This strategy prevents direct exposure to potentially harmful online content, enhancing the model's safety without RLHF. However, the model is still vulnerable to generating harmful content. We hope the model can help the research community to further study the safety of language models. Phi-1.5 can write poems, draft emails, create stories, summarize texts, write Python code (such as downloading a Hugging Face transformer model), etc. ## How to Use Phi-1.5 has been integrated in the `transformers` version 4.37.0, please ensure that you are using a version equal or higher than it. ## Intended Uses Given the nature of the training data, Phi-1.5 is best suited for prompts using the QA format, the chat format, and the code format. Note that Phi-1.5, being a base model, often produces irrelevant text following the main answer. In the following example, we've truncated the answer for illustrative purposes only. ### QA Format: ```markdown Write a detailed analogy between mathematics and a lighthouse. Answer: Mathematics is like a lighthouse, guiding us through the vast ocean of numbers and calculations. Just as a lighthouse illuminates the darkness, mathematics provides us with a clear path to navigate through complex problems. It helps us make sense of the world around us, just like a lighthouse helps ships find their way home. ``` where the model generates the text after "Answer:". ### Chat Format: ```markdown Alice: I don't know why, I'm struggling to maintain focus while studying. Any suggestions? Bob: Have you tried using a timer? It can help you stay on track and avoid distractions. Alice: That's a good idea. I'll give it a try. Charlie: Another thing that can help is to break up your study sessions into smaller chunks. It's easier to concentrate on one thing at a time. Alice: That makes sense. I'll try that too. Bob: And don't forget to take breaks! It's important to give your brain a rest so you can come back to your studies with a fresh perspective. Alice: Thanks for the advice, guys. I feel more motivated now. Charlie: No problem, Alice. We're all in this together. Bob: Yeah, and remember that it's okay to ask for help if you need it. We're here to support each other. ``` where the model generates the text after the first "Bob:". ### Code Format: ```python def print_prime(n): """ Print all primes between 1 and n """ primes = [] for num in range(2, n+1): is_prime = True for i in range(2, int(math.sqrt(num))+1): if num % i == 0: is_prime = False break if is_prime: primes.append(num) print(primes) ``` where the model generates the text after the comments. **Notes:** * Phi-1.5-generated text/code should be treated as a starting point rather than a definitive solution for potential use cases. Users should be cautious when employing these models in their applications. * Phi-1.5 has not been tested to ensure that it performs adequately for any production-level application. Please refer to the limitation sections of this document for more details. ## Sample Code ```python import torch from transformers import AutoModelForCausalLM, AutoTokenizer torch.set_default_device("cuda") model = AutoModelForCausalLM.from_pretrained("microsoft/phi-1_5", torch_dtype="auto") tokenizer = AutoTokenizer.from_pretrained("microsoft/phi-1_5") inputs = tokenizer('''def print_prime(n): """ Print all primes between 1 and n """''', return_tensors="pt", return_attention_mask=False) outputs = model.generate(**inputs, max_length=200) text = tokenizer.batch_decode(outputs)[0] print(text) ``` ## Limitations of Phi-1.5 * Generate Inaccurate Code and Facts: The model often produces incorrect code snippets and statements. Users should treat these outputs as suggestions or starting points, not as definitive or accurate solutions. * Limited Scope for code: If the model generates Python scripts that utilize uncommon packages or scripts in other languages, we strongly recommend users manually verify all API uses. * Unreliable Responses to Instruction: The model has not undergone instruction fine-tuning. As a result, it may struggle or fail to adhere to intricate or nuanced instructions provided by users. * Language Limitations: The model is primarily designed to understand standard English. Informal English, slang, or any other language outside of English might pose challenges to its comprehension, leading to potential misinterpretations or errors in response. * Potential Societal Biases: Regardless of the safe data used for its training, the model is not entirely free from societal biases. There's a possibility it may generate content that mirrors these societal biases, particularly if prompted or instructed to do so. We urge users to be aware of this and to exercise caution and critical thinking when interpreting model outputs. * Toxicity: Despite that the model is trained with carefully selected data, the model can still produce harmful content if explicitly prompted or instructed to do so. We chose to release the model for research purposes only -- We hope to help the open-source community develop the most effective ways to reduce the toxicity of a model directly after pretraining. ## Training ### Model * Architecture: a Transformer-based model with next-word prediction objective * Dataset size: 30B tokens * Training tokens: 150B tokens * Precision: fp16 * GPUs: 32xA100-40G * Training time: 8 days ### Software * [PyTorch](https://github.com/pytorch/pytorch) * [DeepSpeed](https://github.com/microsoft/DeepSpeed) * [Flash-Attention](https://github.com/HazyResearch/flash-attention) ### License The model is licensed under the [MIT license](https://huggingface.co/microsoft/phi-1_5/resolve/main/LICENSE). ### Citation You can find the paper at https://arxiv.org/abs/2309.05463. Please cite as: ```bib @article{textbooks2, title={Textbooks Are All You Need II: \textbf{phi-1.5} technical report}, author={Li, Yuanzhi and Bubeck, S{\'e}bastien and Eldan, Ronen and Del Giorno, Allie and Gunasekar, Suriya and Lee, Yin Tat}, journal={arXiv preprint arXiv:2309.05463}, year={2023} } ``` ## Trademarks This project may contain trademarks or logos for projects, products, or services. Authorized use of Microsoft trademarks or logos is subject to and must follow [Microsoft’s Trademark & Brand Guidelines](https://www.microsoft.com/en-us/legal/intellectualproperty/trademarks). Use of Microsoft trademarks or logos in modified versions of this project must not cause confusion or imply Microsoft sponsorship. Any use of third-party trademarks or logos are subject to those third-party’s policies.

jinaai/jina-bert-flash-implementation

jinaai

transformers

# BERT with Flash-Attention ### Installing dependencies To run the model on GPU, you need to install Flash Attention. You may either install from pypi (which may not work with fused-dense), or from source. To install from source, clone the GitHub repository: ```console git clone git@github.com:Dao-AILab/flash-attention.git ``` The code provided here should work with commit `43950dd`. Change to the cloned repo and install: ```console cd flash-attention && python setup.py install ``` This will compile the flash-attention kernel, which will take some time. If you would like to use fused MLPs (e.g. to use activation checkpointing), you may install fused-dense also from source: ```console cd csrc/fused_dense_lib && python setup.py install ``` ### Configuration The config adds some new parameters: - `use_flash_attn`: If `True`, always use flash attention. If `None`, use flash attention when GPU is available. If `False`, never use flash attention (works on CPU). - `window_size`: Size (left and right) of the local attention window. If `(-1, -1)`, use global attention - `dense_seq_output`: If true, we only need to pass the hidden states for the masked out token (around 15%) to the classifier heads. I set this to true for pretraining. - `fused_mlp`: Whether to use fused-dense. Useful to reduce VRAM in combination with activation checkpointing - `mlp_checkpoint_lvl`: One of `{0, 1, 2}`. Increasing this increases the amount of activation checkpointing within the MLP. Keep this at 0 for pretraining and use gradient accumulation instead. For embedding training, increase this as much as needed. - `last_layer_subset`: If true, we only need the compute the last layer for a subset of tokens. I left this to false. - `use_qk_norm`: Whether or not to use QK-normalization - `num_loras`: Number of LoRAs to use when initializing a `BertLoRA` model. Has no effect on other models.

Qwen/Qwen2.5-14B-Instruct

Qwen

transformers

text-generation

--- license: apache-2.0 license_link: https://huggingface.co/Qwen/Qwen2.5-14B-Instruct/blob/main/LICENSE language: - en pipeline_tag: text-generation base_model: Qwen/Qwen2.5-14B tags: - chat library_name: transformers --- # Qwen2.5-14B-Instruct ## Introduction Qwen2.5 is the latest series of Qwen large language models. For Qwen2.5, we release a number of base language models and instruction-tuned language models ranging from 0.5 to 72 billion parameters. Qwen2.5 brings the following improvements upon Qwen2: - Significantly **more knowledge** and has greatly improved capabilities in **coding** and **mathematics**, thanks to our specialized expert models in these domains. - Significant improvements in **instruction following**, **generating long texts** (over 8K tokens), **understanding structured data** (e.g, tables), and **generating structured outputs** especially JSON. **More resilient to the diversity of system prompts**, enhancing role-play implementation and condition-setting for chatbots. - **Long-context Support** up to 128K tokens and can generate up to 8K tokens. - **Multilingual support** for over 29 languages, including Chinese, English, French, Spanish, Portuguese, German, Italian, Russian, Japanese, Korean, Vietnamese, Thai, Arabic, and more. **This repo contains the instruction-tuned 14B Qwen2.5 model**, which has the following features: - Type: Causal Language Models - Training Stage: Pretraining & Post-training - Architecture: transformers with RoPE, SwiGLU, RMSNorm, and Attention QKV bias - Number of Parameters: 14.7B - Number of Paramaters (Non-Embedding): 13.1B - Number of Layers: 48 - Number of Attention Heads (GQA): 40 for Q and 8 for KV - Context Length: Full 131,072 tokens and generation 8192 tokens - Please refer to [this section](#processing-long-texts) for detailed instructions on how to deploy Qwen2.5 for handling long texts. For more details, please refer to our [blog](https://qwenlm.github.io/blog/qwen2.5/), [GitHub](https://github.com/QwenLM/Qwen2.5), and [Documentation](https://qwen.readthedocs.io/en/latest/). ## Requirements The code of Qwen2.5 has been in the latest Hugging face `transformers` and we advise you to use the latest version of `transformers`. With `transformers<4.37.0`, you will encounter the following error: ``` KeyError: 'qwen2' ``` ## Quickstart Here provides a code snippet with `apply_chat_template` to show you how to load the tokenizer and model and how to generate contents. ```python from transformers import AutoModelForCausalLM, AutoTokenizer model_name = "Qwen/Qwen2.5-14B-Instruct" model = AutoModelForCausalLM.from_pretrained( model_name, torch_dtype="auto", device_map="auto" ) tokenizer = AutoTokenizer.from_pretrained(model_name) prompt = "Give me a short introduction to large language model." messages = [ {"role": "system", "content": "You are Qwen, created by Alibaba Cloud. You are a helpful assistant."}, {"role": "user", "content": prompt} ] text = tokenizer.apply_chat_template( messages, tokenize=False, add_generation_prompt=True ) model_inputs = tokenizer([text], return_tensors="pt").to(model.device) generated_ids = model.generate( **model_inputs, max_new_tokens=512 ) generated_ids = [ output_ids[len(input_ids):] for input_ids, output_ids in zip(model_inputs.input_ids, generated_ids) ] response = tokenizer.batch_decode(generated_ids, skip_special_tokens=True)[0] ``` ### Processing Long Texts The current `config.json` is set for context length up to 32,768 tokens. To handle extensive inputs exceeding 32,768 tokens, we utilize [YaRN](https://arxiv.org/abs/2309.00071), a technique for enhancing model length extrapolation, ensuring optimal performance on lengthy texts. For supported frameworks, you could add the following to `config.json` to enable YaRN: ```json { ..., "rope_scaling": { "factor": 4.0, "original_max_position_embeddings": 32768, "type": "yarn" } } ``` For deployment, we recommend using vLLM. Please refer to our [Documentation](https://qwen.readthedocs.io/en/latest/deployment/vllm.html) for usage if you are not familar with vLLM. Presently, vLLM only supports static YARN, which means the scaling factor remains constant regardless of input length, **potentially impacting performance on shorter texts**. We advise adding the `rope_scaling` configuration only when processing long contexts is required. ## Evaluation & Performance Detailed evaluation results are reported in this [📑 blog](https://qwenlm.github.io/blog/qwen2.5/). For requirements on GPU memory and the respective throughput, see results [here](https://qwen.readthedocs.io/en/latest/benchmark/speed_benchmark.html). ## Citation If you find our work helpful, feel free to give us a cite. ``` @misc{qwen2.5, title = {Qwen2.5: A Party of Foundation Models}, url = {https://qwenlm.github.io/blog/qwen2.5/}, author = {Qwen Team}, month = {September}, year = {2024} } @article{qwen2, title={Qwen2 Technical Report}, author={An Yang and Baosong Yang and Binyuan Hui and Bo Zheng and Bowen Yu and Chang Zhou and Chengpeng Li and Chengyuan Li and Dayiheng Liu and Fei Huang and Guanting Dong and Haoran Wei and Huan Lin and Jialong Tang and Jialin Wang and Jian Yang and Jianhong Tu and Jianwei Zhang and Jianxin Ma and Jin Xu and Jingren Zhou and Jinze Bai and Jinzheng He and Junyang Lin and Kai Dang and Keming Lu and Keqin Chen and Kexin Yang and Mei Li and Mingfeng Xue and Na Ni and Pei Zhang and Peng Wang and Ru Peng and Rui Men and Ruize Gao and Runji Lin and Shijie Wang and Shuai Bai and Sinan Tan and Tianhang Zhu and Tianhao Li and Tianyu Liu and Wenbin Ge and Xiaodong Deng and Xiaohuan Zhou and Xingzhang Ren and Xinyu Zhang and Xipin Wei and Xuancheng Ren and Yang Fan and Yang Yao and Yichang Zhang and Yu Wan and Yunfei Chu and Yuqiong Liu and Zeyu Cui and Zhenru Zhang and Zhihao Fan}, journal={arXiv preprint arXiv:2407.10671}, year={2024} } ```

shuyuej/Mistral-Nemo-Instruct-2407-GPTQ

shuyuej

transformers

text-generation

--- license: apache-2.0 --- # The Quantized Mistral Nemo Instruct 2407 Model Original Base Model: `mistralai/Mistral-Nemo-Instruct-2407`.<br> Link: [https://huggingface.co/mistralai/Mistral-Nemo-Instruct-2407](https://huggingface.co/mistralai/Mistral-Nemo-Instruct-2407) ## Quantization Configurations ``` "quantization_config": { "batch_size": 1, "bits": 4, "block_name_to_quantize": null, "cache_block_outputs": true, "damp_percent": 0.1, "dataset": null, "desc_act": false, "exllama_config": { "version": 1 }, "group_size": 128, "max_input_length": null, "model_seqlen": null, "module_name_preceding_first_block": null, "modules_in_block_to_quantize": null, "pad_token_id": null, "quant_method": "gptq", "sym": true, "tokenizer": null, "true_sequential": true, "use_cuda_fp16": false, "use_exllama": true }, ``` ## Source Codes Source Codes: [https://github.com/vkola-lab/medpodgpt/tree/main/quantization](https://github.com/vkola-lab/medpodgpt/tree/main/quantization).

sentence-transformers/xlm-r-100langs-bert-base-nli-stsb-mean-tokens

sentence-transformers

sentence-transformers

sentence-similarity

--- license: apache-2.0 library_name: sentence-transformers tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers pipeline_tag: sentence-similarity --- **⚠️ This model is deprecated. Please don't use it as it produces sentence embeddings of low quality. You can find recommended sentence embedding models here: [SBERT.net - Pretrained Models](https://www.sbert.net/docs/pretrained_models.html)** # sentence-transformers/xlm-r-100langs-bert-base-nli-stsb-mean-tokens This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 768 dimensional dense vector space and can be used for tasks like clustering or semantic search. ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer sentences = ["This is an example sentence", "Each sentence is converted"] model = SentenceTransformer('sentence-transformers/xlm-r-100langs-bert-base-nli-stsb-mean-tokens') embeddings = model.encode(sentences) print(embeddings) ``` ## Usage (HuggingFace Transformers) Without [sentence-transformers](https://www.SBERT.net), you can use the model like this: First, you pass your input through the transformer model, then you have to apply the right pooling-operation on-top of the contextualized word embeddings. ```python from transformers import AutoTokenizer, AutoModel import torch #Mean Pooling - Take attention mask into account for correct averaging def mean_pooling(model_output, attention_mask): token_embeddings = model_output[0] #First element of model_output contains all token embeddings input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) # Sentences we want sentence embeddings for sentences = ['This is an example sentence', 'Each sentence is converted'] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('sentence-transformers/xlm-r-100langs-bert-base-nli-stsb-mean-tokens') model = AutoModel.from_pretrained('sentence-transformers/xlm-r-100langs-bert-base-nli-stsb-mean-tokens') # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, max pooling. sentence_embeddings = mean_pooling(model_output, encoded_input['attention_mask']) print("Sentence embeddings:") print(sentence_embeddings) ``` ## Evaluation Results For an automated evaluation of this model, see the *Sentence Embeddings Benchmark*: [https://seb.sbert.net](https://seb.sbert.net?model_name=sentence-transformers/xlm-r-100langs-bert-base-nli-stsb-mean-tokens) ## Full Model Architecture ``` SentenceTransformer( (0): Transformer({'max_seq_length': 128, 'do_lower_case': False}) with Transformer model: XLMRobertaModel (1): Pooling({'word_embedding_dimension': 768, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False}) ) ``` ## Citing & Authors This model was trained by [sentence-transformers](https://www.sbert.net/). If you find this model helpful, feel free to cite our publication [Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks](https://arxiv.org/abs/1908.10084): ```bibtex @inproceedings{reimers-2019-sentence-bert, title = "Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks", author = "Reimers, Nils and Gurevych, Iryna", booktitle = "Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing", month = "11", year = "2019", publisher = "Association for Computational Linguistics", url = "http://arxiv.org/abs/1908.10084", } ```

sentinet/suicidality

sentinet

transformers

text-classification

--- license: cc0-1.0 language: - en metrics: - accuracy: 0.939432 - recall: 0.937164 - precision: 0.92822 - f1: 0.92822 tags: - classification - suicidality - suicidal text detection - suicidal sentiment - sentiment - suicide - self harm - depression pipeline_tag: text-classification --- # Advanced Suicidality Classifier Model ## Introduction Welcome to the Suicidality Detection AI Model! This project aims to provide a machine learning solution for detecting sequences of words indicative of suicidality in text. By utilizing the ELECTRA architecture and fine-tuning on a diverse dataset, we have created a powerful classification model that can distinguish between suicidal and non-suicidal text expressions. ## Labels The model classifies input text into two labels: - `LABEL_0`: Indicates that the text is non-suicidal. - `LABEL_1`: Indicates that the text is indicative of suicidality. ## Training The model was fine-tuned using the ELECTRA architecture on a carefully curated dataset. Our training process involved cleaning and preprocessing various text sources to create a comprehensive training set. The training results indicate promising performance, with metrics including: ## Performance The model's performance on the validation dataset is as follows: - Accuracy: 0.939432 - Recall: 0.937164 - Precision: 0.92822 - F1 Score: 0.932672 These metrics demonstrate the model's ability to accurately classify sequences of text as either indicative of suicidality or non-suicidal. ## Data Sources We collected data from multiple sources to create a rich and diverse training dataset: - https://www.kaggle.com/datasets/thedevastator/c-ssrs-labeled-suicidality-in-500-anonymized-red - https://www.kaggle.com/datasets/amangoyl/reddit-dataset-for-multi-task-nlp - https://www.kaggle.com/datasets/imeshsonu/suicideal-phrases - https://raw.githubusercontent.com/laxmimerit/twitter-suicidal-intention-dataset/master/twitter-suicidal_data.csv - https://www.kaggle.com/datasets/mohanedmashaly/suicide-notes - https://www.kaggle.com/datasets/natalialech/suicidal-ideation-on-twitter The data underwent thorough cleaning and preprocessing before being used for training the model. ## How to Use ### Installation To use the model, you need to install the Transformers library: ```bash pip install transformers ``` ### Using the Model You can utilize the model for text classification using the following code snippets: 1. Using the pipeline approach: ```python from transformers import pipeline classifier = pipeline("sentiment-analysis", model="sentinetyd/suicidality") result = classifier("text to classify") print(result) ``` 2. Using the tokenizer and model programmatically: ```python from transformers import AutoTokenizer, AutoModel tokenizer = AutoTokenizer.from_pretrained("sentinetyd/suicidality") model = AutoModel.from_pretrained("sentinetyd/suicidality") # Perform tokenization and prediction using the tokenizer and model ``` ## Ethical Considerations Suicidality is a sensitive and serious topic. It's important to exercise caution and consider ethical implications when using this model. Predictions made by the model should be handled with care and used to complement human judgment and intervention. ## Model Credits We would like to acknowledge the "gooohjy/suicidal-electra" model available on Hugging Face's model repository. You can find the model at [this link](https://huggingface.co/gooohjy/suicidal-electra). We used this model as a starting point and fine-tuned it to create our specialized suicidality detection model. ## Contributions We welcome contributions and feedback from the community to further improve the model's performance, enhance the dataset, and ensure its responsible deployment.

intfloat/e5-small-v2

intfloat

sentence-transformers

sentence-similarity

--- tags: - mteb - Sentence Transformers - sentence-similarity - sentence-transformers model-index: - name: e5-small-v2 results: - task: type: Classification dataset: type: mteb/amazon_counterfactual name: MTEB AmazonCounterfactualClassification (en) config: en split: test revision: e8379541af4e31359cca9fbcf4b00f2671dba205 metrics: - type: accuracy value: 77.59701492537313 - type: ap value: 41.67064885731708 - type: f1 value: 71.86465946398573 - task: type: Classification dataset: type: mteb/amazon_polarity name: MTEB AmazonPolarityClassification config: default split: test revision: e2d317d38cd51312af73b3d32a06d1a08b442046 metrics: - type: accuracy value: 91.265875 - type: ap value: 87.67633085349644 - type: f1 value: 91.24297521425744 - task: type: Classification dataset: type: mteb/amazon_reviews_multi name: MTEB AmazonReviewsClassification (en) config: en split: test revision: 1399c76144fd37290681b995c656ef9b2e06e26d metrics: - type: accuracy value: 45.882000000000005 - type: f1 value: 45.08058870381236 - task: type: Retrieval dataset: type: arguana name: MTEB ArguAna config: default split: test revision: None metrics: - type: map_at_1 value: 20.697 - type: map_at_10 value: 33.975 - type: map_at_100 value: 35.223 - type: map_at_1000 value: 35.260000000000005 - type: map_at_3 value: 29.776999999999997 - type: map_at_5 value: 32.035000000000004 - type: mrr_at_1 value: 20.982 - type: mrr_at_10 value: 34.094 - type: mrr_at_100 value: 35.343 - type: mrr_at_1000 value: 35.38 - type: mrr_at_3 value: 29.884 - type: mrr_at_5 value: 32.141999999999996 - type: ndcg_at_1 value: 20.697 - type: ndcg_at_10 value: 41.668 - type: ndcg_at_100 value: 47.397 - type: ndcg_at_1000 value: 48.305 - type: ndcg_at_3 value: 32.928000000000004 - type: ndcg_at_5 value: 36.998999999999995 - type: precision_at_1 value: 20.697 - type: precision_at_10 value: 6.636 - type: precision_at_100 value: 0.924 - type: precision_at_1000 value: 0.099 - type: precision_at_3 value: 14.035 - type: precision_at_5 value: 10.398 - type: recall_at_1 value: 20.697 - type: recall_at_10 value: 66.35799999999999 - type: recall_at_100 value: 92.39 - type: recall_at_1000 value: 99.36 - type: recall_at_3 value: 42.105 - type: recall_at_5 value: 51.991 - task: type: Clustering dataset: type: mteb/arxiv-clustering-p2p name: MTEB ArxivClusteringP2P config: default split: test revision: a122ad7f3f0291bf49cc6f4d32aa80929df69d5d metrics: - type: v_measure value: 42.1169517447068 - task: type: Clustering dataset: type: mteb/arxiv-clustering-s2s name: MTEB ArxivClusteringS2S config: default split: test revision: f910caf1a6075f7329cdf8c1a6135696f37dbd53 metrics: - type: v_measure value: 34.79553720107097 - task: type: Reranking dataset: type: mteb/askubuntudupquestions-reranking name: MTEB AskUbuntuDupQuestions config: default split: test revision: 2000358ca161889fa9c082cb41daa8dcfb161a54 metrics: - type: map value: 58.10811337308168 - type: mrr value: 71.56410763751482 - task: type: STS dataset: type: mteb/biosses-sts name: MTEB BIOSSES config: default split: test revision: d3fb88f8f02e40887cd149695127462bbcf29b4a metrics: - type: cos_sim_pearson value: 78.46834918248696 - type: cos_sim_spearman value: 79.4289182755206 - type: euclidean_pearson value: 76.26662973727008 - type: euclidean_spearman value: 78.11744260952536 - type: manhattan_pearson value: 76.08175262609434 - type: manhattan_spearman value: 78.29395265552289 - task: type: Classification dataset: type: mteb/banking77 name: MTEB Banking77Classification config: default split: test revision: 0fd18e25b25c072e09e0d92ab615fda904d66300 metrics: - type: accuracy value: 81.63636363636364 - type: f1 value: 81.55779952376953 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-p2p name: MTEB BiorxivClusteringP2P config: default split: test revision: 65b79d1d13f80053f67aca9498d9402c2d9f1f40 metrics: - type: v_measure value: 35.88541137137571 - task: type: Clustering dataset: type: mteb/biorxiv-clustering-s2s name: MTEB BiorxivClusteringS2S config: default split: test revision: 258694dd0231531bc1fd9de6ceb52a0853c6d908 metrics: - type: v_measure value: 30.05205685274407 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackAndroidRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 30.293999999999997 - type: map_at_10 value: 39.876 - type: map_at_100 value: 41.315000000000005 - type: map_at_1000 value: 41.451 - type: map_at_3 value: 37.194 - type: map_at_5 value: 38.728 - type: mrr_at_1 value: 37.053000000000004 - type: mrr_at_10 value: 45.281 - type: mrr_at_100 value: 46.188 - type: mrr_at_1000 value: 46.245999999999995 - type: mrr_at_3 value: 43.228 - type: mrr_at_5 value: 44.366 - type: ndcg_at_1 value: 37.053000000000004 - type: ndcg_at_10 value: 45.086 - type: ndcg_at_100 value: 50.756 - type: ndcg_at_1000 value: 53.123 - type: ndcg_at_3 value: 41.416 - type: ndcg_at_5 value: 43.098 - type: precision_at_1 value: 37.053000000000004 - type: precision_at_10 value: 8.34 - type: precision_at_100 value: 1.346 - type: precision_at_1000 value: 0.186 - type: precision_at_3 value: 19.647000000000002 - type: precision_at_5 value: 13.877 - type: recall_at_1 value: 30.293999999999997 - type: recall_at_10 value: 54.309 - type: recall_at_100 value: 78.59 - type: recall_at_1000 value: 93.82300000000001 - type: recall_at_3 value: 43.168 - type: recall_at_5 value: 48.192 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackEnglishRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 28.738000000000003 - type: map_at_10 value: 36.925999999999995 - type: map_at_100 value: 38.017 - type: map_at_1000 value: 38.144 - type: map_at_3 value: 34.446 - type: map_at_5 value: 35.704 - type: mrr_at_1 value: 35.478 - type: mrr_at_10 value: 42.786 - type: mrr_at_100 value: 43.458999999999996 - type: mrr_at_1000 value: 43.507 - type: mrr_at_3 value: 40.648 - type: mrr_at_5 value: 41.804 - type: ndcg_at_1 value: 35.478 - type: ndcg_at_10 value: 42.044 - type: ndcg_at_100 value: 46.249 - type: ndcg_at_1000 value: 48.44 - type: ndcg_at_3 value: 38.314 - type: ndcg_at_5 value: 39.798 - type: precision_at_1 value: 35.478 - type: precision_at_10 value: 7.764 - type: precision_at_100 value: 1.253 - type: precision_at_1000 value: 0.174 - type: precision_at_3 value: 18.047 - type: precision_at_5 value: 12.637 - type: recall_at_1 value: 28.738000000000003 - type: recall_at_10 value: 50.659 - type: recall_at_100 value: 68.76299999999999 - type: recall_at_1000 value: 82.811 - type: recall_at_3 value: 39.536 - type: recall_at_5 value: 43.763999999999996 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGamingRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 38.565 - type: map_at_10 value: 50.168 - type: map_at_100 value: 51.11 - type: map_at_1000 value: 51.173 - type: map_at_3 value: 47.044000000000004 - type: map_at_5 value: 48.838 - type: mrr_at_1 value: 44.201 - type: mrr_at_10 value: 53.596999999999994 - type: mrr_at_100 value: 54.211 - type: mrr_at_1000 value: 54.247 - type: mrr_at_3 value: 51.202000000000005 - type: mrr_at_5 value: 52.608999999999995 - type: ndcg_at_1 value: 44.201 - type: ndcg_at_10 value: 55.694 - type: ndcg_at_100 value: 59.518 - type: ndcg_at_1000 value: 60.907 - type: ndcg_at_3 value: 50.395999999999994 - type: ndcg_at_5 value: 53.022999999999996 - type: precision_at_1 value: 44.201 - type: precision_at_10 value: 8.84 - type: precision_at_100 value: 1.162 - type: precision_at_1000 value: 0.133 - type: precision_at_3 value: 22.153 - type: precision_at_5 value: 15.260000000000002 - type: recall_at_1 value: 38.565 - type: recall_at_10 value: 68.65 - type: recall_at_100 value: 85.37400000000001 - type: recall_at_1000 value: 95.37400000000001 - type: recall_at_3 value: 54.645999999999994 - type: recall_at_5 value: 60.958 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackGisRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 23.945 - type: map_at_10 value: 30.641000000000002 - type: map_at_100 value: 31.599 - type: map_at_1000 value: 31.691000000000003 - type: map_at_3 value: 28.405 - type: map_at_5 value: 29.704000000000004 - type: mrr_at_1 value: 25.537 - type: mrr_at_10 value: 32.22 - type: mrr_at_100 value: 33.138 - type: mrr_at_1000 value: 33.214 - type: mrr_at_3 value: 30.151 - type: mrr_at_5 value: 31.298 - type: ndcg_at_1 value: 25.537 - type: ndcg_at_10 value: 34.638000000000005 - type: ndcg_at_100 value: 39.486 - type: ndcg_at_1000 value: 41.936 - type: ndcg_at_3 value: 30.333 - type: ndcg_at_5 value: 32.482 - type: precision_at_1 value: 25.537 - type: precision_at_10 value: 5.153 - type: precision_at_100 value: 0.7929999999999999 - type: precision_at_1000 value: 0.104 - type: precision_at_3 value: 12.429 - type: precision_at_5 value: 8.723 - type: recall_at_1 value: 23.945 - type: recall_at_10 value: 45.412 - type: recall_at_100 value: 67.836 - type: recall_at_1000 value: 86.467 - type: recall_at_3 value: 34.031 - type: recall_at_5 value: 39.039 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackMathematicaRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 14.419 - type: map_at_10 value: 20.858999999999998 - type: map_at_100 value: 22.067999999999998 - type: map_at_1000 value: 22.192 - type: map_at_3 value: 18.673000000000002 - type: map_at_5 value: 19.968 - type: mrr_at_1 value: 17.785999999999998 - type: mrr_at_10 value: 24.878 - type: mrr_at_100 value: 26.021 - type: mrr_at_1000 value: 26.095000000000002 - type: mrr_at_3 value: 22.616 - type: mrr_at_5 value: 23.785 - type: ndcg_at_1 value: 17.785999999999998 - type: ndcg_at_10 value: 25.153 - type: ndcg_at_100 value: 31.05 - type: ndcg_at_1000 value: 34.052 - type: ndcg_at_3 value: 21.117 - type: ndcg_at_5 value: 23.048 - type: precision_at_1 value: 17.785999999999998 - type: precision_at_10 value: 4.590000000000001 - type: precision_at_100 value: 0.864 - type: precision_at_1000 value: 0.125 - type: precision_at_3 value: 9.908999999999999 - type: precision_at_5 value: 7.313 - type: recall_at_1 value: 14.419 - type: recall_at_10 value: 34.477999999999994 - type: recall_at_100 value: 60.02499999999999 - type: recall_at_1000 value: 81.646 - type: recall_at_3 value: 23.515 - type: recall_at_5 value: 28.266999999999996 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackPhysicsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 26.268 - type: map_at_10 value: 35.114000000000004 - type: map_at_100 value: 36.212 - type: map_at_1000 value: 36.333 - type: map_at_3 value: 32.436 - type: map_at_5 value: 33.992 - type: mrr_at_1 value: 31.761 - type: mrr_at_10 value: 40.355999999999995 - type: mrr_at_100 value: 41.125 - type: mrr_at_1000 value: 41.186 - type: mrr_at_3 value: 37.937 - type: mrr_at_5 value: 39.463 - type: ndcg_at_1 value: 31.761 - type: ndcg_at_10 value: 40.422000000000004 - type: ndcg_at_100 value: 45.458999999999996 - type: ndcg_at_1000 value: 47.951 - type: ndcg_at_3 value: 35.972 - type: ndcg_at_5 value: 38.272 - type: precision_at_1 value: 31.761 - type: precision_at_10 value: 7.103 - type: precision_at_100 value: 1.133 - type: precision_at_1000 value: 0.152 - type: precision_at_3 value: 16.779 - type: precision_at_5 value: 11.877 - type: recall_at_1 value: 26.268 - type: recall_at_10 value: 51.053000000000004 - type: recall_at_100 value: 72.702 - type: recall_at_1000 value: 89.521 - type: recall_at_3 value: 38.619 - type: recall_at_5 value: 44.671 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackProgrammersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 25.230999999999998 - type: map_at_10 value: 34.227000000000004 - type: map_at_100 value: 35.370000000000005 - type: map_at_1000 value: 35.488 - type: map_at_3 value: 31.496000000000002 - type: map_at_5 value: 33.034 - type: mrr_at_1 value: 30.822 - type: mrr_at_10 value: 39.045 - type: mrr_at_100 value: 39.809 - type: mrr_at_1000 value: 39.873 - type: mrr_at_3 value: 36.663000000000004 - type: mrr_at_5 value: 37.964 - type: ndcg_at_1 value: 30.822 - type: ndcg_at_10 value: 39.472 - type: ndcg_at_100 value: 44.574999999999996 - type: ndcg_at_1000 value: 47.162 - type: ndcg_at_3 value: 34.929 - type: ndcg_at_5 value: 37.002 - type: precision_at_1 value: 30.822 - type: precision_at_10 value: 7.055 - type: precision_at_100 value: 1.124 - type: precision_at_1000 value: 0.152 - type: precision_at_3 value: 16.591 - type: precision_at_5 value: 11.667 - type: recall_at_1 value: 25.230999999999998 - type: recall_at_10 value: 50.42100000000001 - type: recall_at_100 value: 72.685 - type: recall_at_1000 value: 90.469 - type: recall_at_3 value: 37.503 - type: recall_at_5 value: 43.123 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 24.604166666666664 - type: map_at_10 value: 32.427166666666665 - type: map_at_100 value: 33.51474999999999 - type: map_at_1000 value: 33.6345 - type: map_at_3 value: 30.02366666666667 - type: map_at_5 value: 31.382333333333328 - type: mrr_at_1 value: 29.001166666666666 - type: mrr_at_10 value: 36.3315 - type: mrr_at_100 value: 37.16683333333333 - type: mrr_at_1000 value: 37.23341666666668 - type: mrr_at_3 value: 34.19916666666667 - type: mrr_at_5 value: 35.40458333333334 - type: ndcg_at_1 value: 29.001166666666666 - type: ndcg_at_10 value: 37.06883333333334 - type: ndcg_at_100 value: 41.95816666666666 - type: ndcg_at_1000 value: 44.501583333333336 - type: ndcg_at_3 value: 32.973499999999994 - type: ndcg_at_5 value: 34.90833333333334 - type: precision_at_1 value: 29.001166666666666 - type: precision_at_10 value: 6.336 - type: precision_at_100 value: 1.0282499999999999 - type: precision_at_1000 value: 0.14391666666666664 - type: precision_at_3 value: 14.932499999999996 - type: precision_at_5 value: 10.50825 - type: recall_at_1 value: 24.604166666666664 - type: recall_at_10 value: 46.9525 - type: recall_at_100 value: 68.67816666666667 - type: recall_at_1000 value: 86.59783333333334 - type: recall_at_3 value: 35.49783333333333 - type: recall_at_5 value: 40.52525000000001 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackStatsRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 23.559 - type: map_at_10 value: 29.023 - type: map_at_100 value: 29.818 - type: map_at_1000 value: 29.909000000000002 - type: map_at_3 value: 27.037 - type: map_at_5 value: 28.225 - type: mrr_at_1 value: 26.994 - type: mrr_at_10 value: 31.962000000000003 - type: mrr_at_100 value: 32.726 - type: mrr_at_1000 value: 32.800000000000004 - type: mrr_at_3 value: 30.266 - type: mrr_at_5 value: 31.208999999999996 - type: ndcg_at_1 value: 26.994 - type: ndcg_at_10 value: 32.53 - type: ndcg_at_100 value: 36.758 - type: ndcg_at_1000 value: 39.362 - type: ndcg_at_3 value: 28.985 - type: ndcg_at_5 value: 30.757 - type: precision_at_1 value: 26.994 - type: precision_at_10 value: 4.968999999999999 - type: precision_at_100 value: 0.759 - type: precision_at_1000 value: 0.106 - type: precision_at_3 value: 12.219 - type: precision_at_5 value: 8.527999999999999 - type: recall_at_1 value: 23.559 - type: recall_at_10 value: 40.585 - type: recall_at_100 value: 60.306000000000004 - type: recall_at_1000 value: 80.11 - type: recall_at_3 value: 30.794 - type: recall_at_5 value: 35.186 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackTexRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 16.384999999999998 - type: map_at_10 value: 22.142 - type: map_at_100 value: 23.057 - type: map_at_1000 value: 23.177 - type: map_at_3 value: 20.29 - type: map_at_5 value: 21.332 - type: mrr_at_1 value: 19.89 - type: mrr_at_10 value: 25.771 - type: mrr_at_100 value: 26.599 - type: mrr_at_1000 value: 26.680999999999997 - type: mrr_at_3 value: 23.962 - type: mrr_at_5 value: 24.934 - type: ndcg_at_1 value: 19.89 - type: ndcg_at_10 value: 25.97 - type: ndcg_at_100 value: 30.605 - type: ndcg_at_1000 value: 33.619 - type: ndcg_at_3 value: 22.704 - type: ndcg_at_5 value: 24.199 - type: precision_at_1 value: 19.89 - type: precision_at_10 value: 4.553 - type: precision_at_100 value: 0.8049999999999999 - type: precision_at_1000 value: 0.122 - type: precision_at_3 value: 10.541 - type: precision_at_5 value: 7.46 - type: recall_at_1 value: 16.384999999999998 - type: recall_at_10 value: 34.001 - type: recall_at_100 value: 55.17100000000001 - type: recall_at_1000 value: 77.125 - type: recall_at_3 value: 24.618000000000002 - type: recall_at_5 value: 28.695999999999998 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackUnixRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 23.726 - type: map_at_10 value: 31.227 - type: map_at_100 value: 32.311 - type: map_at_1000 value: 32.419 - type: map_at_3 value: 28.765 - type: map_at_5 value: 30.229 - type: mrr_at_1 value: 27.705000000000002 - type: mrr_at_10 value: 35.085 - type: mrr_at_100 value: 35.931000000000004 - type: mrr_at_1000 value: 36 - type: mrr_at_3 value: 32.603 - type: mrr_at_5 value: 34.117999999999995 - type: ndcg_at_1 value: 27.705000000000002 - type: ndcg_at_10 value: 35.968 - type: ndcg_at_100 value: 41.197 - type: ndcg_at_1000 value: 43.76 - type: ndcg_at_3 value: 31.304 - type: ndcg_at_5 value: 33.661 - type: precision_at_1 value: 27.705000000000002 - type: precision_at_10 value: 5.942 - type: precision_at_100 value: 0.964 - type: precision_at_1000 value: 0.13 - type: precision_at_3 value: 13.868 - type: precision_at_5 value: 9.944 - type: recall_at_1 value: 23.726 - type: recall_at_10 value: 46.786 - type: recall_at_100 value: 70.072 - type: recall_at_1000 value: 88.2 - type: recall_at_3 value: 33.981 - type: recall_at_5 value: 39.893 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWebmastersRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 23.344 - type: map_at_10 value: 31.636999999999997 - type: map_at_100 value: 33.065 - type: map_at_1000 value: 33.300000000000004 - type: map_at_3 value: 29.351 - type: map_at_5 value: 30.432 - type: mrr_at_1 value: 27.866000000000003 - type: mrr_at_10 value: 35.587 - type: mrr_at_100 value: 36.52 - type: mrr_at_1000 value: 36.597 - type: mrr_at_3 value: 33.696 - type: mrr_at_5 value: 34.713 - type: ndcg_at_1 value: 27.866000000000003 - type: ndcg_at_10 value: 36.61 - type: ndcg_at_100 value: 41.88 - type: ndcg_at_1000 value: 45.105000000000004 - type: ndcg_at_3 value: 33.038000000000004 - type: ndcg_at_5 value: 34.331 - type: precision_at_1 value: 27.866000000000003 - type: precision_at_10 value: 6.917 - type: precision_at_100 value: 1.3599999999999999 - type: precision_at_1000 value: 0.233 - type: precision_at_3 value: 15.547 - type: precision_at_5 value: 10.791 - type: recall_at_1 value: 23.344 - type: recall_at_10 value: 45.782000000000004 - type: recall_at_100 value: 69.503 - type: recall_at_1000 value: 90.742 - type: recall_at_3 value: 35.160000000000004 - type: recall_at_5 value: 39.058 - task: type: Retrieval dataset: type: BeIR/cqadupstack name: MTEB CQADupstackWordpressRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 20.776 - type: map_at_10 value: 27.285999999999998 - type: map_at_100 value: 28.235 - type: map_at_1000 value: 28.337 - type: map_at_3 value: 25.147000000000002 - type: map_at_5 value: 26.401999999999997 - type: mrr_at_1 value: 22.921 - type: mrr_at_10 value: 29.409999999999997 - type: mrr_at_100 value: 30.275000000000002 - type: mrr_at_1000 value: 30.354999999999997 - type: mrr_at_3 value: 27.418 - type: mrr_at_5 value: 28.592000000000002 - type: ndcg_at_1 value: 22.921 - type: ndcg_at_10 value: 31.239 - type: ndcg_at_100 value: 35.965 - type: ndcg_at_1000 value: 38.602 - type: ndcg_at_3 value: 27.174 - type: ndcg_at_5 value: 29.229 - type: precision_at_1 value: 22.921 - type: precision_at_10 value: 4.806 - type: precision_at_100 value: 0.776 - type: precision_at_1000 value: 0.11 - type: precision_at_3 value: 11.459999999999999 - type: precision_at_5 value: 8.022 - type: recall_at_1 value: 20.776 - type: recall_at_10 value: 41.294 - type: recall_at_100 value: 63.111 - type: recall_at_1000 value: 82.88600000000001 - type: recall_at_3 value: 30.403000000000002 - type: recall_at_5 value: 35.455999999999996 - task: type: Retrieval dataset: type: climate-fever name: MTEB ClimateFEVER config: default split: test revision: None metrics: - type: map_at_1 value: 9.376 - type: map_at_10 value: 15.926000000000002 - type: map_at_100 value: 17.585 - type: map_at_1000 value: 17.776 - type: map_at_3 value: 13.014000000000001 - type: map_at_5 value: 14.417 - type: mrr_at_1 value: 20.195 - type: mrr_at_10 value: 29.95 - type: mrr_at_100 value: 31.052000000000003 - type: mrr_at_1000 value: 31.108000000000004 - type: mrr_at_3 value: 26.667 - type: mrr_at_5 value: 28.458 - type: ndcg_at_1 value: 20.195 - type: ndcg_at_10 value: 22.871 - type: ndcg_at_100 value: 29.921999999999997 - type: ndcg_at_1000 value: 33.672999999999995 - type: ndcg_at_3 value: 17.782999999999998 - type: ndcg_at_5 value: 19.544 - type: precision_at_1 value: 20.195 - type: precision_at_10 value: 7.394 - type: precision_at_100 value: 1.493 - type: precision_at_1000 value: 0.218 - type: precision_at_3 value: 13.073 - type: precision_at_5 value: 10.436 - type: recall_at_1 value: 9.376 - type: recall_at_10 value: 28.544999999999998 - type: recall_at_100 value: 53.147999999999996 - type: recall_at_1000 value: 74.62 - type: recall_at_3 value: 16.464000000000002 - type: recall_at_5 value: 21.004 - task: type: Retrieval dataset: type: dbpedia-entity name: MTEB DBPedia config: default split: test revision: None metrics: - type: map_at_1 value: 8.415000000000001 - type: map_at_10 value: 18.738 - type: map_at_100 value: 27.291999999999998 - type: map_at_1000 value: 28.992 - type: map_at_3 value: 13.196 - type: map_at_5 value: 15.539 - type: mrr_at_1 value: 66.5 - type: mrr_at_10 value: 74.518 - type: mrr_at_100 value: 74.86 - type: mrr_at_1000 value: 74.87 - type: mrr_at_3 value: 72.375 - type: mrr_at_5 value: 73.86200000000001 - type: ndcg_at_1 value: 54.37499999999999 - type: ndcg_at_10 value: 41.317 - type: ndcg_at_100 value: 45.845 - type: ndcg_at_1000 value: 52.92 - type: ndcg_at_3 value: 44.983000000000004 - type: ndcg_at_5 value: 42.989 - type: precision_at_1 value: 66.5 - type: precision_at_10 value: 33.6 - type: precision_at_100 value: 10.972999999999999 - type: precision_at_1000 value: 2.214 - type: precision_at_3 value: 48.583 - type: precision_at_5 value: 42.15 - type: recall_at_1 value: 8.415000000000001 - type: recall_at_10 value: 24.953 - type: recall_at_100 value: 52.48199999999999 - type: recall_at_1000 value: 75.093 - type: recall_at_3 value: 14.341000000000001 - type: recall_at_5 value: 18.468 - task: type: Classification dataset: type: mteb/emotion name: MTEB EmotionClassification config: default split: test revision: 4f58c6b202a23cf9a4da393831edf4f9183cad37 metrics: - type: accuracy value: 47.06499999999999 - type: f1 value: 41.439327599975385 - task: type: Retrieval dataset: type: fever name: MTEB FEVER config: default split: test revision: None metrics: - type: map_at_1 value: 66.02 - type: map_at_10 value: 76.68599999999999 - type: map_at_100 value: 76.959 - type: map_at_1000 value: 76.972 - type: map_at_3 value: 75.024 - type: map_at_5 value: 76.153 - type: mrr_at_1 value: 71.197 - type: mrr_at_10 value: 81.105 - type: mrr_at_100 value: 81.232 - type: mrr_at_1000 value: 81.233 - type: mrr_at_3 value: 79.758 - type: mrr_at_5 value: 80.69 - type: ndcg_at_1 value: 71.197 - type: ndcg_at_10 value: 81.644 - type: ndcg_at_100 value: 82.645 - type: ndcg_at_1000 value: 82.879 - type: ndcg_at_3 value: 78.792 - type: ndcg_at_5 value: 80.528 - type: precision_at_1 value: 71.197 - type: precision_at_10 value: 10.206999999999999 - type: precision_at_100 value: 1.093 - type: precision_at_1000 value: 0.11299999999999999 - type: precision_at_3 value: 30.868000000000002 - type: precision_at_5 value: 19.559 - type: recall_at_1 value: 66.02 - type: recall_at_10 value: 92.50699999999999 - type: recall_at_100 value: 96.497 - type: recall_at_1000 value: 97.956 - type: recall_at_3 value: 84.866 - type: recall_at_5 value: 89.16199999999999 - task: type: Retrieval dataset: type: fiqa name: MTEB FiQA2018 config: default split: test revision: None metrics: - type: map_at_1 value: 17.948 - type: map_at_10 value: 29.833 - type: map_at_100 value: 31.487 - type: map_at_1000 value: 31.674000000000003 - type: map_at_3 value: 26.029999999999998 - type: map_at_5 value: 28.038999999999998 - type: mrr_at_1 value: 34.721999999999994 - type: mrr_at_10 value: 44.214999999999996 - type: mrr_at_100 value: 44.994 - type: mrr_at_1000 value: 45.051 - type: mrr_at_3 value: 41.667 - type: mrr_at_5 value: 43.032 - type: ndcg_at_1 value: 34.721999999999994 - type: ndcg_at_10 value: 37.434 - type: ndcg_at_100 value: 43.702000000000005 - type: ndcg_at_1000 value: 46.993 - type: ndcg_at_3 value: 33.56 - type: ndcg_at_5 value: 34.687 - type: precision_at_1 value: 34.721999999999994 - type: precision_at_10 value: 10.401 - type: precision_at_100 value: 1.7049999999999998 - type: precision_at_1000 value: 0.22799999999999998 - type: precision_at_3 value: 22.531000000000002 - type: precision_at_5 value: 16.42 - type: recall_at_1 value: 17.948 - type: recall_at_10 value: 45.062999999999995 - type: recall_at_100 value: 68.191 - type: recall_at_1000 value: 87.954 - type: recall_at_3 value: 31.112000000000002 - type: recall_at_5 value: 36.823 - task: type: Retrieval dataset: type: hotpotqa name: MTEB HotpotQA config: default split: test revision: None metrics: - type: map_at_1 value: 36.644 - type: map_at_10 value: 57.658 - type: map_at_100 value: 58.562000000000005 - type: map_at_1000 value: 58.62500000000001 - type: map_at_3 value: 54.022999999999996 - type: map_at_5 value: 56.293000000000006 - type: mrr_at_1 value: 73.288 - type: mrr_at_10 value: 80.51700000000001 - type: mrr_at_100 value: 80.72 - type: mrr_at_1000 value: 80.728 - type: mrr_at_3 value: 79.33200000000001 - type: mrr_at_5 value: 80.085 - type: ndcg_at_1 value: 73.288 - type: ndcg_at_10 value: 66.61 - type: ndcg_at_100 value: 69.723 - type: ndcg_at_1000 value: 70.96000000000001 - type: ndcg_at_3 value: 61.358999999999995 - type: ndcg_at_5 value: 64.277 - type: precision_at_1 value: 73.288 - type: precision_at_10 value: 14.17 - type: precision_at_100 value: 1.659 - type: precision_at_1000 value: 0.182 - type: precision_at_3 value: 39.487 - type: precision_at_5 value: 25.999 - type: recall_at_1 value: 36.644 - type: recall_at_10 value: 70.851 - type: recall_at_100 value: 82.94399999999999 - type: recall_at_1000 value: 91.134 - type: recall_at_3 value: 59.230000000000004 - type: recall_at_5 value: 64.997 - task: type: Classification dataset: type: mteb/imdb name: MTEB ImdbClassification config: default split: test revision: 3d86128a09e091d6018b6d26cad27f2739fc2db7 metrics: - type: accuracy value: 86.00280000000001 - type: ap value: 80.46302061021223 - type: f1 value: 85.9592921596419 - task: type: Retrieval dataset: type: msmarco name: MTEB MSMARCO config: default split: dev revision: None metrics: - type: map_at_1 value: 22.541 - type: map_at_10 value: 34.625 - type: map_at_100 value: 35.785 - type: map_at_1000 value: 35.831 - type: map_at_3 value: 30.823 - type: map_at_5 value: 32.967999999999996 - type: mrr_at_1 value: 23.180999999999997 - type: mrr_at_10 value: 35.207 - type: mrr_at_100 value: 36.315 - type: mrr_at_1000 value: 36.355 - type: mrr_at_3 value: 31.483 - type: mrr_at_5 value: 33.589999999999996 - type: ndcg_at_1 value: 23.195 - type: ndcg_at_10 value: 41.461 - type: ndcg_at_100 value: 47.032000000000004 - type: ndcg_at_1000 value: 48.199999999999996 - type: ndcg_at_3 value: 33.702 - type: ndcg_at_5 value: 37.522 - type: precision_at_1 value: 23.195 - type: precision_at_10 value: 6.526999999999999 - type: precision_at_100 value: 0.932 - type: precision_at_1000 value: 0.10300000000000001 - type: precision_at_3 value: 14.308000000000002 - type: precision_at_5 value: 10.507 - type: recall_at_1 value: 22.541 - type: recall_at_10 value: 62.524 - type: recall_at_100 value: 88.228 - type: recall_at_1000 value: 97.243 - type: recall_at_3 value: 41.38 - type: recall_at_5 value: 50.55 - task: type: Classification dataset: type: mteb/mtop_domain name: MTEB MTOPDomainClassification (en) config: en split: test revision: d80d48c1eb48d3562165c59d59d0034df9fff0bf metrics: - type: accuracy value: 92.69949840401279 - type: f1 value: 92.54141471311786 - task: type: Classification dataset: type: mteb/mtop_intent name: MTEB MTOPIntentClassification (en) config: en split: test revision: ae001d0e6b1228650b7bd1c2c65fb50ad11a8aba metrics: - type: accuracy value: 72.56041951664386 - type: f1 value: 55.88499977508287 - task: type: Classification dataset: type: mteb/amazon_massive_intent name: MTEB MassiveIntentClassification (en) config: en split: test revision: 31efe3c427b0bae9c22cbb560b8f15491cc6bed7 metrics: - type: accuracy value: 71.62071284465365 - type: f1 value: 69.36717546572152 - task: type: Classification dataset: type: mteb/amazon_massive_scenario name: MTEB MassiveScenarioClassification (en) config: en split: test revision: 7d571f92784cd94a019292a1f45445077d0ef634 metrics: - type: accuracy value: 76.35843981170142 - type: f1 value: 76.15496453538884 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-p2p name: MTEB MedrxivClusteringP2P config: default split: test revision: e7a26af6f3ae46b30dde8737f02c07b1505bcc73 metrics: - type: v_measure value: 31.33664956793118 - task: type: Clustering dataset: type: mteb/medrxiv-clustering-s2s name: MTEB MedrxivClusteringS2S config: default split: test revision: 35191c8c0dca72d8ff3efcd72aa802307d469663 metrics: - type: v_measure value: 27.883839621715524 - task: type: Reranking dataset: type: mteb/mind_small name: MTEB MindSmallReranking config: default split: test revision: 3bdac13927fdc888b903db93b2ffdbd90b295a69 metrics: - type: map value: 30.096874986740758 - type: mrr value: 30.97300481932132 - task: type: Retrieval dataset: type: nfcorpus name: MTEB NFCorpus config: default split: test revision: None metrics: - type: map_at_1 value: 5.4 - type: map_at_10 value: 11.852 - type: map_at_100 value: 14.758 - type: map_at_1000 value: 16.134 - type: map_at_3 value: 8.558 - type: map_at_5 value: 10.087 - type: mrr_at_1 value: 44.272 - type: mrr_at_10 value: 52.05800000000001 - type: mrr_at_100 value: 52.689 - type: mrr_at_1000 value: 52.742999999999995 - type: mrr_at_3 value: 50.205999999999996 - type: mrr_at_5 value: 51.367 - type: ndcg_at_1 value: 42.57 - type: ndcg_at_10 value: 32.449 - type: ndcg_at_100 value: 29.596 - type: ndcg_at_1000 value: 38.351 - type: ndcg_at_3 value: 37.044 - type: ndcg_at_5 value: 35.275 - type: precision_at_1 value: 44.272 - type: precision_at_10 value: 23.87 - type: precision_at_100 value: 7.625 - type: precision_at_1000 value: 2.045 - type: precision_at_3 value: 34.365 - type: precision_at_5 value: 30.341 - type: recall_at_1 value: 5.4 - type: recall_at_10 value: 15.943999999999999 - type: recall_at_100 value: 29.805 - type: recall_at_1000 value: 61.695 - type: recall_at_3 value: 9.539 - type: recall_at_5 value: 12.127 - task: type: Retrieval dataset: type: nq name: MTEB NQ config: default split: test revision: None metrics: - type: map_at_1 value: 36.047000000000004 - type: map_at_10 value: 51.6 - type: map_at_100 value: 52.449999999999996 - type: map_at_1000 value: 52.476 - type: map_at_3 value: 47.452 - type: map_at_5 value: 49.964 - type: mrr_at_1 value: 40.382 - type: mrr_at_10 value: 54.273 - type: mrr_at_100 value: 54.859 - type: mrr_at_1000 value: 54.876000000000005 - type: mrr_at_3 value: 51.014 - type: mrr_at_5 value: 52.983999999999995 - type: ndcg_at_1 value: 40.353 - type: ndcg_at_10 value: 59.11300000000001 - type: ndcg_at_100 value: 62.604000000000006 - type: ndcg_at_1000 value: 63.187000000000005 - type: ndcg_at_3 value: 51.513 - type: ndcg_at_5 value: 55.576 - type: precision_at_1 value: 40.353 - type: precision_at_10 value: 9.418 - type: precision_at_100 value: 1.1440000000000001 - type: precision_at_1000 value: 0.12 - type: precision_at_3 value: 23.078000000000003 - type: precision_at_5 value: 16.250999999999998 - type: recall_at_1 value: 36.047000000000004 - type: recall_at_10 value: 79.22200000000001 - type: recall_at_100 value: 94.23 - type: recall_at_1000 value: 98.51100000000001 - type: recall_at_3 value: 59.678 - type: recall_at_5 value: 68.967 - task: type: Retrieval dataset: type: quora name: MTEB QuoraRetrieval config: default split: test revision: None metrics: - type: map_at_1 value: 68.232 - type: map_at_10 value: 81.674 - type: map_at_100 value: 82.338 - type: map_at_1000 value: 82.36099999999999 - type: map_at_3 value: 78.833 - type: map_at_5 value: 80.58 - type: mrr_at_1 value: 78.64 - type: mrr_at_10 value: 85.164 - type: mrr_at_100 value: 85.317 - type: mrr_at_1000 value: 85.319 - type: mrr_at_3 value: 84.127 - type: mrr_at_5 value: 84.789 - type: ndcg_at_1 value: 78.63 - type: ndcg_at_10 value: 85.711 - type: ndcg_at_100 value: 87.238 - type: ndcg_at_1000 value: 87.444 - type: ndcg_at_3 value: 82.788 - type: ndcg_at_5 value: 84.313 - type: precision_at_1 value: 78.63 - type: precision_at_10 value: 12.977 - type: precision_at_100 value: 1.503 - type: precision_at_1000 value: 0.156 - type: precision_at_3 value: 36.113 - type: precision_at_5 value: 23.71 - type: recall_at_1 value: 68.232 - type: recall_at_10 value: 93.30199999999999 - type: recall_at_100 value: 98.799 - type: recall_at_1000 value: 99.885 - type: recall_at_3 value: 84.827 - type: recall_at_5 value: 89.188 - task: type: Clustering dataset: type: mteb/reddit-clustering name: MTEB RedditClustering config: default split: test revision: 24640382cdbf8abc73003fb0fa6d111a705499eb metrics: - type: v_measure value: 45.71879170816294 - task: type: Clustering dataset: type: mteb/reddit-clustering-p2p name: MTEB RedditClusteringP2P config: default split: test revision: 282350215ef01743dc01b456c7f5241fa8937f16 metrics: - type: v_measure value: 59.65866311751794 - task: type: Retrieval dataset: type: scidocs name: MTEB SCIDOCS config: default split: test revision: None metrics: - type: map_at_1 value: 4.218 - type: map_at_10 value: 10.337 - type: map_at_100 value: 12.131 - type: map_at_1000 value: 12.411 - type: map_at_3 value: 7.4270000000000005 - type: map_at_5 value: 8.913 - type: mrr_at_1 value: 20.8 - type: mrr_at_10 value: 30.868000000000002 - type: mrr_at_100 value: 31.903 - type: mrr_at_1000 value: 31.972 - type: mrr_at_3 value: 27.367 - type: mrr_at_5 value: 29.372 - type: ndcg_at_1 value: 20.8 - type: ndcg_at_10 value: 17.765 - type: ndcg_at_100 value: 24.914 - type: ndcg_at_1000 value: 30.206 - type: ndcg_at_3 value: 16.64 - type: ndcg_at_5 value: 14.712 - type: precision_at_1 value: 20.8 - type: precision_at_10 value: 9.24 - type: precision_at_100 value: 1.9560000000000002 - type: precision_at_1000 value: 0.32299999999999995 - type: precision_at_3 value: 15.467 - type: precision_at_5 value: 12.94 - type: recall_at_1 value: 4.218 - type: recall_at_10 value: 18.752 - type: recall_at_100 value: 39.7 - type: recall_at_1000 value: 65.57300000000001 - type: recall_at_3 value: 9.428 - type: recall_at_5 value: 13.133000000000001 - task: type: STS dataset: type: mteb/sickr-sts name: MTEB SICK-R config: default split: test revision: a6ea5a8cab320b040a23452cc28066d9beae2cee metrics: - type: cos_sim_pearson value: 83.04338850207233 - type: cos_sim_spearman value: 78.5054651430423 - type: euclidean_pearson value: 80.30739451228612 - type: euclidean_spearman value: 78.48377464299097 - type: manhattan_pearson value: 80.40795049052781 - type: manhattan_spearman value: 78.49506205443114 - task: type: STS dataset: type: mteb/sts12-sts name: MTEB STS12 config: default split: test revision: a0d554a64d88156834ff5ae9920b964011b16384 metrics: - type: cos_sim_pearson value: 84.11596224442962 - type: cos_sim_spearman value: 76.20997388935461 - type: euclidean_pearson value: 80.56858451349109 - type: euclidean_spearman value: 75.92659183871186 - type: manhattan_pearson value: 80.60246102203844 - type: manhattan_spearman value: 76.03018971432664 - task: type: STS dataset: type: mteb/sts13-sts name: MTEB STS13 config: default split: test revision: 7e90230a92c190f1bf69ae9002b8cea547a64cca metrics: - type: cos_sim_pearson value: 81.34691640755737 - type: cos_sim_spearman value: 82.4018369631579 - type: euclidean_pearson value: 81.87673092245366 - type: euclidean_spearman value: 82.3671489960678 - type: manhattan_pearson value: 81.88222387719948 - type: manhattan_spearman value: 82.3816590344736 - task: type: STS dataset: type: mteb/sts14-sts name: MTEB STS14 config: default split: test revision: 6031580fec1f6af667f0bd2da0a551cf4f0b2375 metrics: - type: cos_sim_pearson value: 81.2836092579524 - type: cos_sim_spearman value: 78.99982781772064 - type: euclidean_pearson value: 80.5184271010527 - type: euclidean_spearman value: 78.89777392101904 - type: manhattan_pearson value: 80.53585705018664 - type: manhattan_spearman value: 78.92898405472994 - task: type: STS dataset: type: mteb/sts15-sts name: MTEB STS15 config: default split: test revision: ae752c7c21bf194d8b67fd573edf7ae58183cbe3 metrics: - type: cos_sim_pearson value: 86.7349907750784 - type: cos_sim_spearman value: 87.7611234446225 - type: euclidean_pearson value: 86.98759326731624 - type: euclidean_spearman value: 87.58321319424618 - type: manhattan_pearson value: 87.03483090370842 - type: manhattan_spearman value: 87.63278333060288 - task: type: STS dataset: type: mteb/sts16-sts name: MTEB STS16 config: default split: test revision: 4d8694f8f0e0100860b497b999b3dbed754a0513 metrics: - type: cos_sim_pearson value: 81.75873694924825 - type: cos_sim_spearman value: 83.80237999094724 - type: euclidean_pearson value: 83.55023725861537 - type: euclidean_spearman value: 84.12744338577744 - type: manhattan_pearson value: 83.58816983036232 - type: manhattan_spearman value: 84.18520748676501 - task: type: STS dataset: type: mteb/sts17-crosslingual-sts name: MTEB STS17 (en-en) config: en-en split: test revision: af5e6fb845001ecf41f4c1e033ce921939a2a68d metrics: - type: cos_sim_pearson value: 87.21630882940174 - type: cos_sim_spearman value: 87.72382883437031 - type: euclidean_pearson value: 88.69933350930333 - type: euclidean_spearman value: 88.24660814383081 - type: manhattan_pearson value: 88.77331018833499 - type: manhattan_spearman value: 88.26109989380632 - task: type: STS dataset: type: mteb/sts22-crosslingual-sts name: MTEB STS22 (en) config: en split: test revision: 6d1ba47164174a496b7fa5d3569dae26a6813b80 metrics: - type: cos_sim_pearson value: 61.11854063060489 - type: cos_sim_spearman value: 63.14678634195072 - type: euclidean_pearson value: 61.679090067000864 - type: euclidean_spearman value: 62.28876589509653 - type: manhattan_pearson value: 62.082324165511004 - type: manhattan_spearman value: 62.56030932816679 - task: type: STS dataset: type: mteb/stsbenchmark-sts name: MTEB STSBenchmark config: default split: test revision: b0fddb56ed78048fa8b90373c8a3cfc37b684831 metrics: - type: cos_sim_pearson value: 84.00319882832645 - type: cos_sim_spearman value: 85.94529772647257 - type: euclidean_pearson value: 85.6661390122756 - type: euclidean_spearman value: 85.97747815545827 - type: manhattan_pearson value: 85.58422770541893 - type: manhattan_spearman value: 85.9237139181532 - task: type: Reranking dataset: type: mteb/scidocs-reranking name: MTEB SciDocsRR config: default split: test revision: d3c5e1fc0b855ab6097bf1cda04dd73947d7caab metrics: - type: map value: 79.16198731863916 - type: mrr value: 94.25202702163487 - task: type: Retrieval dataset: type: scifact name: MTEB SciFact config: default split: test revision: None metrics: - type: map_at_1 value: 54.761 - type: map_at_10 value: 64.396 - type: map_at_100 value: 65.07 - type: map_at_1000 value: 65.09899999999999 - type: map_at_3 value: 61.846000000000004 - type: map_at_5 value: 63.284 - type: mrr_at_1 value: 57.667 - type: mrr_at_10 value: 65.83099999999999 - type: mrr_at_100 value: 66.36800000000001 - type: mrr_at_1000 value: 66.39399999999999 - type: mrr_at_3 value: 64.056 - type: mrr_at_5 value: 65.206 - type: ndcg_at_1 value: 57.667 - type: ndcg_at_10 value: 68.854 - type: ndcg_at_100 value: 71.59100000000001 - type: ndcg_at_1000 value: 72.383 - type: ndcg_at_3 value: 64.671 - type: ndcg_at_5 value: 66.796 - type: precision_at_1 value: 57.667 - type: precision_at_10 value: 9.167 - type: precision_at_100 value: 1.053 - type: precision_at_1000 value: 0.11199999999999999 - type: precision_at_3 value: 25.444 - type: precision_at_5 value: 16.667 - type: recall_at_1 value: 54.761 - type: recall_at_10 value: 80.9 - type: recall_at_100 value: 92.767 - type: recall_at_1000 value: 99 - type: recall_at_3 value: 69.672 - type: recall_at_5 value: 75.083 - task: type: PairClassification dataset: type: mteb/sprintduplicatequestions-pairclassification name: MTEB SprintDuplicateQuestions config: default split: test revision: d66bd1f72af766a5cc4b0ca5e00c162f89e8cc46 metrics: - type: cos_sim_accuracy value: 99.8079207920792 - type: cos_sim_ap value: 94.88470927617445 - type: cos_sim_f1 value: 90.08179959100204 - type: cos_sim_precision value: 92.15481171548117 - type: cos_sim_recall value: 88.1 - type: dot_accuracy value: 99.58613861386138 - type: dot_ap value: 82.94822578881316 - type: dot_f1 value: 77.33333333333333 - type: dot_precision value: 79.36842105263158 - type: dot_recall value: 75.4 - type: euclidean_accuracy value: 99.8069306930693 - type: euclidean_ap value: 94.81367858031837 - type: euclidean_f1 value: 90.01009081735621 - type: euclidean_precision value: 90.83503054989816 - type: euclidean_recall value: 89.2 - type: manhattan_accuracy value: 99.81188118811882 - type: manhattan_ap value: 94.91405337220161 - type: manhattan_f1 value: 90.2763561924258 - type: manhattan_precision value: 92.45283018867924 - type: manhattan_recall value: 88.2 - type: max_accuracy value: 99.81188118811882 - type: max_ap value: 94.91405337220161 - type: max_f1 value: 90.2763561924258 - task: type: Clustering dataset: type: mteb/stackexchange-clustering name: MTEB StackExchangeClustering config: default split: test revision: 6cbc1f7b2bc0622f2e39d2c77fa502909748c259 metrics: - type: v_measure value: 58.511599500053094 - task: type: Clustering dataset: type: mteb/stackexchange-clustering-p2p name: MTEB StackExchangeClusteringP2P config: default split: test revision: 815ca46b2622cec33ccafc3735d572c266efdb44 metrics: - type: v_measure value: 31.984728147814707 - task: type: Reranking dataset: type: mteb/stackoverflowdupquestions-reranking name: MTEB StackOverflowDupQuestions config: default split: test revision: e185fbe320c72810689fc5848eb6114e1ef5ec69 metrics: - type: map value: 49.93428193939015 - type: mrr value: 50.916557911043206 - task: type: Summarization dataset: type: mteb/summeval name: MTEB SummEval config: default split: test revision: cda12ad7615edc362dbf25a00fdd61d3b1eaf93c metrics: - type: cos_sim_pearson value: 31.562500894537145 - type: cos_sim_spearman value: 31.162587976726307 - type: dot_pearson value: 22.633662187735762 - type: dot_spearman value: 22.723000282378962 - task: type: Retrieval dataset: type: trec-covid name: MTEB TRECCOVID config: default split: test revision: None metrics: - type: map_at_1 value: 0.219 - type: map_at_10 value: 1.871 - type: map_at_100 value: 10.487 - type: map_at_1000 value: 25.122 - type: map_at_3 value: 0.657 - type: map_at_5 value: 1.0699999999999998 - type: mrr_at_1 value: 84 - type: mrr_at_10 value: 89.567 - type: mrr_at_100 value: 89.748 - type: mrr_at_1000 value: 89.748 - type: mrr_at_3 value: 88.667 - type: mrr_at_5 value: 89.567 - type: ndcg_at_1 value: 80 - type: ndcg_at_10 value: 74.533 - type: ndcg_at_100 value: 55.839000000000006 - type: ndcg_at_1000 value: 49.748 - type: ndcg_at_3 value: 79.53099999999999 - type: ndcg_at_5 value: 78.245 - type: precision_at_1 value: 84 - type: precision_at_10 value: 78.4 - type: precision_at_100 value: 56.99999999999999 - type: precision_at_1000 value: 21.98 - type: precision_at_3 value: 85.333 - type: precision_at_5 value: 84.8 - type: recall_at_1 value: 0.219 - type: recall_at_10 value: 2.02 - type: recall_at_100 value: 13.555 - type: recall_at_1000 value: 46.739999999999995 - type: recall_at_3 value: 0.685 - type: recall_at_5 value: 1.13 - task: type: Retrieval dataset: type: webis-touche2020 name: MTEB Touche2020 config: default split: test revision: None metrics: - type: map_at_1 value: 3.5029999999999997 - type: map_at_10 value: 11.042 - type: map_at_100 value: 16.326999999999998 - type: map_at_1000 value: 17.836 - type: map_at_3 value: 6.174 - type: map_at_5 value: 7.979 - type: mrr_at_1 value: 42.857 - type: mrr_at_10 value: 52.617000000000004 - type: mrr_at_100 value: 53.351000000000006 - type: mrr_at_1000 value: 53.351000000000006 - type: mrr_at_3 value: 46.939 - type: mrr_at_5 value: 50.714000000000006 - type: ndcg_at_1 value: 38.775999999999996 - type: ndcg_at_10 value: 27.125 - type: ndcg_at_100 value: 35.845 - type: ndcg_at_1000 value: 47.377 - type: ndcg_at_3 value: 29.633 - type: ndcg_at_5 value: 28.378999999999998 - type: precision_at_1 value: 42.857 - type: precision_at_10 value: 24.082 - type: precision_at_100 value: 6.877999999999999 - type: precision_at_1000 value: 1.463 - type: precision_at_3 value: 29.932 - type: precision_at_5 value: 28.571 - type: recall_at_1 value: 3.5029999999999997 - type: recall_at_10 value: 17.068 - type: recall_at_100 value: 43.361 - type: recall_at_1000 value: 78.835 - type: recall_at_3 value: 6.821000000000001 - type: recall_at_5 value: 10.357 - task: type: Classification dataset: type: mteb/toxic_conversations_50k name: MTEB ToxicConversationsClassification config: default split: test revision: d7c0de2777da35d6aae2200a62c6e0e5af397c4c metrics: - type: accuracy value: 71.0954 - type: ap value: 14.216844153511959 - type: f1 value: 54.63687418565117 - task: type: Classification dataset: type: mteb/tweet_sentiment_extraction name: MTEB TweetSentimentExtractionClassification config: default split: test revision: d604517c81ca91fe16a244d1248fc021f9ecee7a metrics: - type: accuracy value: 61.46293152235427 - type: f1 value: 61.744177921638645 - task: type: Clustering dataset: type: mteb/twentynewsgroups-clustering name: MTEB TwentyNewsgroupsClustering config: default split: test revision: 6125ec4e24fa026cec8a478383ee943acfbd5449 metrics: - type: v_measure value: 41.12708617788644 - task: type: PairClassification dataset: type: mteb/twittersemeval2015-pairclassification name: MTEB TwitterSemEval2015 config: default split: test revision: 70970daeab8776df92f5ea462b6173c0b46fd2d1 metrics: - type: cos_sim_accuracy value: 85.75430649102938 - type: cos_sim_ap value: 73.34252536948081 - type: cos_sim_f1 value: 67.53758935173774 - type: cos_sim_precision value: 63.3672525439408 - type: cos_sim_recall value: 72.29551451187335 - type: dot_accuracy value: 81.71305954580676 - type: dot_ap value: 59.5532209082386 - type: dot_f1 value: 56.18466898954705 - type: dot_precision value: 47.830923248053395 - type: dot_recall value: 68.07387862796834 - type: euclidean_accuracy value: 85.81987244441795 - type: euclidean_ap value: 73.34325409809446 - type: euclidean_f1 value: 67.83451360417443 - type: euclidean_precision value: 64.09955388588871 - type: euclidean_recall value: 72.0316622691293 - type: manhattan_accuracy value: 85.68277999642368 - type: manhattan_ap value: 73.1535450121903 - type: manhattan_f1 value: 67.928237896289 - type: manhattan_precision value: 63.56945722171113 - type: manhattan_recall value: 72.9287598944591 - type: max_accuracy value: 85.81987244441795 - type: max_ap value: 73.34325409809446 - type: max_f1 value: 67.928237896289 - task: type: PairClassification dataset: type: mteb/twitterurlcorpus-pairclassification name: MTEB TwitterURLCorpus config: default split: test revision: 8b6510b0b1fa4e4c4f879467980e9be563ec1cdf metrics: - type: cos_sim_accuracy value: 88.90441262079403 - type: cos_sim_ap value: 85.79331880741438 - type: cos_sim_f1 value: 78.31563529842548 - type: cos_sim_precision value: 74.6683424102779 - type: cos_sim_recall value: 82.33754234678165 - type: dot_accuracy value: 84.89928978926534 - type: dot_ap value: 75.25819218316 - type: dot_f1 value: 69.88730119720536 - type: dot_precision value: 64.23362374959665 - type: dot_recall value: 76.63227594702803 - type: euclidean_accuracy value: 89.01695967710637 - type: euclidean_ap value: 85.98986606038852 - type: euclidean_f1 value: 78.5277880014722 - type: euclidean_precision value: 75.22211253701876 - type: euclidean_recall value: 82.13735756082538 - type: manhattan_accuracy value: 88.99561454573679 - type: manhattan_ap value: 85.92262421793953 - type: manhattan_f1 value: 78.38866094740769 - type: manhattan_precision value: 76.02373028505282 - type: manhattan_recall value: 80.9054511857099 - type: max_accuracy value: 89.01695967710637 - type: max_ap value: 85.98986606038852 - type: max_f1 value: 78.5277880014722 language: - en license: mit --- # E5-small-v2 [Text Embeddings by Weakly-Supervised Contrastive Pre-training](https://arxiv.org/pdf/2212.03533.pdf). Liang Wang, Nan Yang, Xiaolong Huang, Binxing Jiao, Linjun Yang, Daxin Jiang, Rangan Majumder, Furu Wei, arXiv 2022 This model has 12 layers and the embedding size is 384. ## Usage Below is an example to encode queries and passages from the MS-MARCO passage ranking dataset. ```python import torch.nn.functional as F from torch import Tensor from transformers import AutoTokenizer, AutoModel def average_pool(last_hidden_states: Tensor, attention_mask: Tensor) -> Tensor: last_hidden = last_hidden_states.masked_fill(~attention_mask[..., None].bool(), 0.0) return last_hidden.sum(dim=1) / attention_mask.sum(dim=1)[..., None] # Each input text should start with "query: " or "passage: ". # For tasks other than retrieval, you can simply use the "query: " prefix. input_texts = ['query: how much protein should a female eat', 'query: summit define', "passage: As a general guideline, the CDC's average requirement of protein for women ages 19 to 70 is 46 grams per day. But, as you can see from this chart, you'll need to increase that if you're expecting or training for a marathon. Check out the chart below to see how much protein you should be eating each day.", "passage: Definition of summit for English Language Learners. : 1 the highest point of a mountain : the top of a mountain. : 2 the highest level. : 3 a meeting or series of meetings between the leaders of two or more governments."] tokenizer = AutoTokenizer.from_pretrained('intfloat/e5-small-v2') model = AutoModel.from_pretrained('intfloat/e5-small-v2') # Tokenize the input texts batch_dict = tokenizer(input_texts, max_length=512, padding=True, truncation=True, return_tensors='pt') outputs = model(**batch_dict) embeddings = average_pool(outputs.last_hidden_state, batch_dict['attention_mask']) # normalize embeddings embeddings = F.normalize(embeddings, p=2, dim=1) scores = (embeddings[:2] @ embeddings[2:].T) * 100 print(scores.tolist()) ``` ## Training Details Please refer to our paper at [https://arxiv.org/pdf/2212.03533.pdf](https://arxiv.org/pdf/2212.03533.pdf). ## Benchmark Evaluation Check out [unilm/e5](https://github.com/microsoft/unilm/tree/master/e5) to reproduce evaluation results on the [BEIR](https://arxiv.org/abs/2104.08663) and [MTEB benchmark](https://arxiv.org/abs/2210.07316). ## Support for Sentence Transformers Below is an example for usage with sentence_transformers. ```python from sentence_transformers import SentenceTransformer model = SentenceTransformer('intfloat/e5-small-v2') input_texts = [ 'query: how much protein should a female eat', 'query: summit define', "passage: As a general guideline, the CDC's average requirement of protein for women ages 19 to 70 is 46 grams per day. But, as you can see from this chart, you'll need to increase that if you're expecting or training for a marathon. Check out the chart below to see how much protein you should be eating each day.", "passage: Definition of summit for English Language Learners. : 1 the highest point of a mountain : the top of a mountain. : 2 the highest level. : 3 a meeting or series of meetings between the leaders of two or more governments." ] embeddings = model.encode(input_texts, normalize_embeddings=True) ``` Package requirements `pip install sentence_transformers~=2.2.2` Contributors: [michaelfeil](https://huggingface.co/michaelfeil) ## FAQ **1. Do I need to add the prefix "query: " and "passage: " to input texts?** Yes, this is how the model is trained, otherwise you will see a performance degradation. Here are some rules of thumb: - Use "query: " and "passage: " correspondingly for asymmetric tasks such as passage retrieval in open QA, ad-hoc information retrieval. - Use "query: " prefix for symmetric tasks such as semantic similarity, paraphrase retrieval. - Use "query: " prefix if you want to use embeddings as features, such as linear probing classification, clustering. **2. Why are my reproduced results slightly different from reported in the model card?** Different versions of `transformers` and `pytorch` could cause negligible but non-zero performance differences. **3. Why does the cosine similarity scores distribute around 0.7 to 1.0?** This is a known and expected behavior as we use a low temperature 0.01 for InfoNCE contrastive loss. For text embedding tasks like text retrieval or semantic similarity, what matters is the relative order of the scores instead of the absolute values, so this should not be an issue. ## Citation If you find our paper or models helpful, please consider cite as follows: ``` @article{wang2022text, title={Text Embeddings by Weakly-Supervised Contrastive Pre-training}, author={Wang, Liang and Yang, Nan and Huang, Xiaolong and Jiao, Binxing and Yang, Linjun and Jiang, Daxin and Majumder, Rangan and Wei, Furu}, journal={arXiv preprint arXiv:2212.03533}, year={2022} } ``` ## Limitations This model only works for English texts. Long texts will be truncated to at most 512 tokens.

facebook/dragon-plus-context-encoder

facebook

transformers

feature-extraction

--- tags: - feature-extraction pipeline_tag: feature-extraction --- DRAGON+ is a BERT-base sized dense retriever initialized from [RetroMAE](https://huggingface.co/Shitao/RetroMAE) and further trained on the data augmented from MS MARCO corpus, following the approach described in [How to Train Your DRAGON: Diverse Augmentation Towards Generalizable Dense Retrieval](https://arxiv.org/abs/2302.07452). <p align="center"> <img src="https://raw.githubusercontent.com/facebookresearch/dpr-scale/main/dragon/images/teaser.png" width="600"> </p> The associated GitHub repository is available here https://github.com/facebookresearch/dpr-scale/tree/main/dragon. We use asymmetric dual encoder, with two distinctly parameterized encoders. The following models are also available: Model | Initialization | MARCO Dev | BEIR | Query Encoder Path | Context Encoder Path |---|---|---|---|---|--- DRAGON+ | Shitao/RetroMAE| 39.0 | 47.4 | [facebook/dragon-plus-query-encoder](https://huggingface.co/facebook/dragon-plus-query-encoder) | [facebook/dragon-plus-context-encoder](https://huggingface.co/facebook/dragon-plus-context-encoder) DRAGON-RoBERTa | RoBERTa-base | 39.4 | 47.2 | [facebook/dragon-roberta-query-encoder](https://huggingface.co/facebook/dragon-roberta-query-encoder) | [facebook/dragon-roberta-context-encoder](https://huggingface.co/facebook/dragon-roberta-context-encoder) ## Usage (HuggingFace Transformers) Using the model directly available in HuggingFace transformers . ```python import torch from transformers import AutoTokenizer, AutoModel tokenizer = AutoTokenizer.from_pretrained('facebook/dragon-plus-query-encoder') query_encoder = AutoModel.from_pretrained('facebook/dragon-plus-query-encoder') context_encoder = AutoModel.from_pretrained('facebook/dragon-plus-context-encoder') # We use msmarco query and passages as an example query = "Where was Marie Curie born?" contexts = [ "Maria Sklodowska, later known as Marie Curie, was born on November 7, 1867.", "Born in Paris on 15 May 1859, Pierre Curie was the son of Eugène Curie, a doctor of French Catholic origin from Alsace." ] # Apply tokenizer query_input = tokenizer(query, return_tensors='pt') ctx_input = tokenizer(contexts, padding=True, truncation=True, return_tensors='pt') # Compute embeddings: take the last-layer hidden state of the [CLS] token query_emb = query_encoder(**query_input).last_hidden_state[:, 0, :] ctx_emb = context_encoder(**ctx_input).last_hidden_state[:, 0, :] # Compute similarity scores using dot product score1 = query_emb @ ctx_emb[0] # 396.5625 score2 = query_emb @ ctx_emb[1] # 393.8340 ```

openbmb/MiniCPM-V-2_6

openbmb

transformers

image-text-to-text

--- pipeline_tag: image-text-to-text datasets: - openbmb/RLAIF-V-Dataset library_name: transformers language: - multilingual tags: - minicpm-v - vision - ocr - multi-image - video - custom_code --- <h1>A GPT-4V Level MLLM for Single Image, Multi Image and Video on Your Phone</h1> [GitHub](https://github.com/OpenBMB/MiniCPM-V) | [Demo](http://120.92.209.146:8887/)</a> ## MiniCPM-V 2.6 **MiniCPM-V 2.6** is the latest and most capable model in the MiniCPM-V series. The model is built on SigLip-400M and Qwen2-7B with a total of 8B parameters. It exhibits a significant performance improvement over MiniCPM-Llama3-V 2.5, and introduces new features for multi-image and video understanding. Notable features of MiniCPM-V 2.6 include: - 🔥 **Leading Performance.** MiniCPM-V 2.6 achieves an average score of 65.2 on the latest version of OpenCompass, a comprehensive evaluation over 8 popular benchmarks. **With only 8B parameters, it surpasses widely used proprietary models like GPT-4o mini, GPT-4V, Gemini 1.5 Pro, and Claude 3.5 Sonnet** for single image understanding. - 🖼️ **Multi Image Understanding and In-context Learning.** MiniCPM-V 2.6 can also perform **conversation and reasoning over multiple images**. It achieves **state-of-the-art performance** on popular multi-image benchmarks such as Mantis-Eval, BLINK, Mathverse mv and Sciverse mv, and also shows promising in-context learning capability. - 🎬 **Video Understanding.** MiniCPM-V 2.6 can also **accept video inputs**, performing conversation and providing dense captions for spatial-temporal information. It outperforms **GPT-4V, Claude 3.5 Sonnet and LLaVA-NeXT-Video-34B** on Video-MME with/without subtitles. - 💪 **Strong OCR Capability and Others.** MiniCPM-V 2.6 can process images with any aspect ratio and up to 1.8 million pixels (e.g., 1344x1344). It achieves **state-of-the-art performance on OCRBench, surpassing proprietary models such as GPT-4o, GPT-4V, and Gemini 1.5 Pro**. Based on the the latest [RLAIF-V](https://github.com/RLHF-V/RLAIF-V/) and [VisCPM](https://github.com/OpenBMB/VisCPM) techniques, it features **trustworthy behaviors**, with significantly lower hallucination rates than GPT-4o and GPT-4V on Object HalBench, and supports **multilingual capabilities** on English, Chinese, German, French, Italian, Korean, etc. - 🚀 **Superior Efficiency.** In addition to its friendly size, MiniCPM-V 2.6 also shows **state-of-the-art token density** (i.e., number of pixels encoded into each visual token). **It produces only 640 tokens when processing a 1.8M pixel image, which is 75% fewer than most models**. This directly improves the inference speed, first-token latency, memory usage, and power consumption. As a result, MiniCPM-V 2.6 can efficiently support **real-time video understanding** on end-side devices such as iPad. - 💫 **Easy Usage.** MiniCPM-V 2.6 can be easily used in various ways: (1) [llama.cpp](https://github.com/OpenBMB/llama.cpp/blob/minicpmv-main/examples/llava/README-minicpmv2.6.md) and [ollama](https://github.com/OpenBMB/ollama/tree/minicpm-v2.6) support for efficient CPU inference on local devices, (2) [int4](https://huggingface.co/openbmb/MiniCPM-V-2_6-int4) and [GGUF](https://huggingface.co/openbmb/MiniCPM-V-2_6-gguf) format quantized models in 16 sizes, (3) [vLLM](https://github.com/OpenBMB/MiniCPM-V/tree/main?tab=readme-ov-file#inference-with-vllm) support for high-throughput and memory-efficient inference, (4) fine-tuning on new domains and tasks, (5) quick local WebUI demo setup with [Gradio](https://github.com/OpenBMB/MiniCPM-V/tree/main?tab=readme-ov-file#chat-with-our-demo-on-gradio) and (6) online web [demo](http://120.92.209.146:8887). ### Evaluation <!-- omit in toc --> <div align="center"> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/radar_final.png" width=66% /> </div> Single image results on OpenCompass, MME, MMVet, OCRBench, MMMU, MathVista, MMB, AI2D, TextVQA, DocVQA, HallusionBench, Object HalBench: <div align="center">  </div> ^* We evaluate this benchmark using chain-of-thought prompting. ⁺ Token Density: number of pixels encoded into each visual token at maximum resolution, i.e., # pixels at maximum resolution / # visual tokens. Note: For proprietary models, we calculate token density based on the image encoding charging strategy defined in the official API documentation, which provides an upper-bound estimation. <details> <summary>Click to view multi-image results on Mantis Eval, BLINK Val, Mathverse mv, Sciverse mv, MIRB.</summary> <div align="center">  </div> ^* We evaluate the officially released checkpoint by ourselves. </details> <details> <summary>Click to view video results on Video-MME and Video-ChatGPT.</summary> <div align="center"> <!--  -->  </div> </details> <details> <summary>Click to view few-shot results on TextVQA, VizWiz, VQAv2, OK-VQA.</summary> <div align="center">  </div> * denotes zero image shot and two additional text shots following Flamingo. ⁺ We evaluate the pretraining ckpt without SFT. </details> ### Examples <!-- omit in toc --> <div style="display: flex; flex-direction: column; align-items: center;"> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/minicpmv2_6/multi_img-bike.png" alt="Bike" style="margin-bottom: -20px;"> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/minicpmv2_6/multi_img-menu.png" alt="Menu" style="margin-bottom: -20px;"> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/minicpmv2_6/multi_img-code.png" alt="Code" style="margin-bottom: -20px;"> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/minicpmv2_6/ICL-Mem.png" alt="Mem" style="margin-bottom: -20px;"> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/minicpmv2_6/multiling-medal.png" alt="medal" style="margin-bottom: 10px;"> </div> <details> <summary>Click to view more cases.</summary> <div style="display: flex; flex-direction: column; align-items: center;"> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/minicpmv2_6/ICL-elec.png" alt="elec" style="margin-bottom: -20px;"> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/minicpmv2_6/multiling-olympic.png" alt="Menu" style="margin-bottom: 10px;"> </div> </details> We deploy MiniCPM-V 2.6 on end devices. The demo video is the raw screen recording on a iPad Pro without edition. <div style="display: flex; justify-content: center;"> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/gif_cases/ai.gif" width="48%" style="margin: 0 10px;"/> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/gif_cases/beer.gif" width="48%" style="margin: 0 10px;"/> </div> <div style="display: flex; justify-content: center; margin-top: 20px;"> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/gif_cases/ticket.gif" width="48%" style="margin: 0 10px;"/> <img src="https://github.com/OpenBMB/MiniCPM-V/raw/main/assets/gif_cases/wfh.gif" width="48%" style="margin: 0 10px;"/> </div> <div style="text-align: center;"> <video controls autoplay src="https://cdn-uploads.huggingface.co/production/uploads/64abc4aa6cadc7aca585dddf/mXAEFQFqNd4nnvPk7r5eX.mp4"></video> <!-- <video controls autoplay src="https://cdn-uploads.huggingface.co/production/uploads/64abc4aa6cadc7aca585dddf/fEWzfHUdKnpkM7sdmnBQa.mp4"></video> --> </div> ## Demo Click here to try the Demo of [MiniCPM-V 2.6](http://120.92.209.146:8887/). ## Usage Inference using Huggingface transformers on NVIDIA GPUs. Requirements tested on python 3.10： ``` Pillow==10.1.0 torch==2.1.2 torchvision==0.16.2 transformers==4.40.0 sentencepiece==0.1.99 decord ``` ```python # test.py import torch from PIL import Image from transformers import AutoModel, AutoTokenizer model = AutoModel.from_pretrained('openbmb/MiniCPM-V-2_6', trust_remote_code=True, attn_implementation='sdpa', torch_dtype=torch.bfloat16) # sdpa or flash_attention_2, no eager model = model.eval().cuda() tokenizer = AutoTokenizer.from_pretrained('openbmb/MiniCPM-V-2_6', trust_remote_code=True) image = Image.open('xx.jpg').convert('RGB') question = 'What is in the image?' msgs = [{'role': 'user', 'content': [image, question]}] res = model.chat( image=None, msgs=msgs, tokenizer=tokenizer ) print(res) ## if you want to use streaming, please make sure sampling=True and stream=True ## the model.chat will return a generator res = model.chat( image=None, msgs=msgs, tokenizer=tokenizer, sampling=True, stream=True ) generated_text = "" for new_text in res: generated_text += new_text print(new_text, flush=True, end='') ``` ### Chat with multiple images <details> <summary> Click to show Python code running MiniCPM-V 2.6 with multiple images input. </summary> ```python import torch from PIL import Image from transformers import AutoModel, AutoTokenizer model = AutoModel.from_pretrained('openbmb/MiniCPM-V-2_6', trust_remote_code=True, attn_implementation='sdpa', torch_dtype=torch.bfloat16) # sdpa or flash_attention_2, no eager model = model.eval().cuda() tokenizer = AutoTokenizer.from_pretrained('openbmb/MiniCPM-V-2_6', trust_remote_code=True) image1 = Image.open('image1.jpg').convert('RGB') image2 = Image.open('image2.jpg').convert('RGB') question = 'Compare image 1 and image 2, tell me about the differences between image 1 and image 2.' msgs = [{'role': 'user', 'content': [image1, image2, question]}] answer = model.chat( image=None, msgs=msgs, tokenizer=tokenizer ) print(answer) ``` </details> ### In-context few-shot learning <details> <summary> Click to view Python code running MiniCPM-V 2.6 with few-shot input. </summary> ```python import torch from PIL import Image from transformers import AutoModel, AutoTokenizer model = AutoModel.from_pretrained('openbmb/MiniCPM-V-2_6', trust_remote_code=True, attn_implementation='sdpa', torch_dtype=torch.bfloat16) # sdpa or flash_attention_2, no eager model = model.eval().cuda() tokenizer = AutoTokenizer.from_pretrained('openbmb/MiniCPM-V-2_6', trust_remote_code=True) question = "production date" image1 = Image.open('example1.jpg').convert('RGB') answer1 = "2023.08.04" image2 = Image.open('example2.jpg').convert('RGB') answer2 = "2007.04.24" image_test = Image.open('test.jpg').convert('RGB') msgs = [ {'role': 'user', 'content': [image1, question]}, {'role': 'assistant', 'content': [answer1]}, {'role': 'user', 'content': [image2, question]}, {'role': 'assistant', 'content': [answer2]}, {'role': 'user', 'content': [image_test, question]} ] answer = model.chat( image=None, msgs=msgs, tokenizer=tokenizer ) print(answer) ``` </details> ### Chat with video <details> <summary> Click to view Python code running MiniCPM-V 2.6 with video input. </summary> ```python import torch from PIL import Image from transformers import AutoModel, AutoTokenizer from decord import VideoReader, cpu # pip install decord model = AutoModel.from_pretrained('openbmb/MiniCPM-V-2_6', trust_remote_code=True, attn_implementation='sdpa', torch_dtype=torch.bfloat16) # sdpa or flash_attention_2, no eager model = model.eval().cuda() tokenizer = AutoTokenizer.from_pretrained('openbmb/MiniCPM-V-2_6', trust_remote_code=True) MAX_NUM_FRAMES=64 # if cuda OOM set a smaller number def encode_video(video_path): def uniform_sample(l, n): gap = len(l) / n idxs = [int(i * gap + gap / 2) for i in range(n)] return [l[i] for i in idxs] vr = VideoReader(video_path, ctx=cpu(0)) sample_fps = round(vr.get_avg_fps() / 1) # FPS frame_idx = [i for i in range(0, len(vr), sample_fps)] if len(frame_idx) > MAX_NUM_FRAMES: frame_idx = uniform_sample(frame_idx, MAX_NUM_FRAMES) frames = vr.get_batch(frame_idx).asnumpy() frames = [Image.fromarray(v.astype('uint8')) for v in frames] print('num frames:', len(frames)) return frames video_path ="video_test.mp4" frames = encode_video(video_path) question = "Describe the video" msgs = [ {'role': 'user', 'content': frames + [question]}, ] # Set decode params for video params={} params["use_image_id"] = False params["max_slice_nums"] = 2 # use 1 if cuda OOM and video resolution > 448*448 answer = model.chat( image=None, msgs=msgs, tokenizer=tokenizer, **params ) print(answer) ``` </details> Please look at [GitHub](https://github.com/OpenBMB/MiniCPM-V) for more detail about usage. ## Inference with llama.cpp<a id="llamacpp"></a> MiniCPM-V 2.6 can run with llama.cpp. See our fork of [llama.cpp](https://github.com/OpenBMB/llama.cpp/tree/minicpm-v2.5/examples/minicpmv) for more detail. ## Int4 quantized version Download the int4 quantized version for lower GPU memory (7GB) usage: [MiniCPM-V-2_6-int4](https://huggingface.co/openbmb/MiniCPM-V-2_6-int4). ## License #### Model License * The code in this repo is released under the [Apache-2.0](https://github.com/OpenBMB/MiniCPM/blob/main/LICENSE) License. * The usage of MiniCPM-V series model weights must strictly follow [MiniCPM Model License.md](https://github.com/OpenBMB/MiniCPM/blob/main/MiniCPM%20Model%20License.md). * The models and weights of MiniCPM are completely free for academic research. After filling out a ["questionnaire"](https://modelbest.feishu.cn/share/base/form/shrcnpV5ZT9EJ6xYjh3Kx0J6v8g) for registration, MiniCPM-V 2.6 weights are also available for free commercial use. #### Statement * As an LMM, MiniCPM-V 2.6 generates contents by learning a large mount of multimodal corpora, but it cannot comprehend, express personal opinions or make value judgement. Anything generated by MiniCPM-V 2.6 does not represent the views and positions of the model developers * We will not be liable for any problems arising from the use of the MinCPM-V models, including but not limited to data security issues, risk of public opinion, or any risks and problems arising from the misdirection, misuse, dissemination or misuse of the model. ## Key Techniques and Other Multimodal Projects 👏 Welcome to explore key techniques of MiniCPM-V 2.6 and other multimodal projects of our team: [VisCPM](https://github.com/OpenBMB/VisCPM/tree/main) | [RLHF-V](https://github.com/RLHF-V/RLHF-V) | [LLaVA-UHD](https://github.com/thunlp/LLaVA-UHD) | [RLAIF-V](https://github.com/RLHF-V/RLAIF-V) ## Citation If you find our work helpful, please consider citing our papers 📝 and liking this project ❤️！ ```bib @article{yao2024minicpm, title={MiniCPM-V: A GPT-4V Level MLLM on Your Phone}, author={Yao, Yuan and Yu, Tianyu and Zhang, Ao and Wang, Chongyi and Cui, Junbo and Zhu, Hongji and Cai, Tianchi and Li, Haoyu and Zhao, Weilin and He, Zhihui and others}, journal={arXiv preprint arXiv:2408.01800}, year={2024} } ```

dicta-il/dictabert-seg

dicta-il

transformers

feature-extraction

--- license: cc-by-4.0 language: - he inference: false --- # DictaBERT: A State-of-the-Art BERT Suite for Modern Hebrew State-of-the-art language model for Hebrew, released [here](https://arxiv.org/abs/2308.16687). This is the fine-tuned model for the prefix segmentation task. For the bert-base models for other tasks, see [here](https://huggingface.co/collections/dicta-il/dictabert-6588e7cc08f83845fc42a18b). Sample usage: ```python from transformers import AutoModel, AutoTokenizer tokenizer = AutoTokenizer.from_pretrained('dicta-il/dictabert-seg') model = AutoModel.from_pretrained('dicta-il/dictabert-seg', trust_remote_code=True) model.eval() sentence = 'בשנת 1948 השלים אפרים קישון את לימודיו בפיסול מתכת ובתולדות האמנות והחל לפרסם מאמרים הומוריסטיים' print(model.predict([sentence], tokenizer)) ``` Output: ```json [ [ [ "[CLS]" ], [ "ב","שנת" ], [ "1948" ], [ "השלים" ], [ "אפרים" ], [ "קישון" ], [ "את" ], [ "לימודיו" ], [ "ב","פיסול" ], [ "מתכת" ], [ "וב","תולדות" ], [ "ה","אמנות" ], [ "ו","החל" ], [ "לפרסם" ], [ "מאמרים" ], [ "הומוריסטיים" ], [ "[SEP]" ] ] ] ``` ## Citation If you use DictaBERT in your research, please cite ```DictaBERT: A State-of-the-Art BERT Suite for Modern Hebrew``` **BibTeX:** ```bibtex @misc{shmidman2023dictabert, title={DictaBERT: A State-of-the-Art BERT Suite for Modern Hebrew}, author={Shaltiel Shmidman and Avi Shmidman and Moshe Koppel}, year={2023}, eprint={2308.16687}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` ## License Shield: [![CC BY 4.0][cc-by-shield]][cc-by] This work is licensed under a [Creative Commons Attribution 4.0 International License][cc-by]. [![CC BY 4.0][cc-by-image]][cc-by] [cc-by]: http://creativecommons.org/licenses/by/4.0/ [cc-by-image]: https://i.creativecommons.org/l/by/4.0/88x31.png [cc-by-shield]: https://img.shields.io/badge/License-CC%20BY%204.0-lightgrey.svg

OpenGVLab/InternVL2-2B

OpenGVLab

transformers

image-text-to-text

--- license: mit pipeline_tag: image-text-to-text library_name: transformers base_model: - OpenGVLab/InternViT-300M-448px - internlm/internlm2-chat-1_8b base_model_relation: merge language: - multilingual tags: - internvl - vision - ocr - multi-image - video - custom_code --- # InternVL2-2B [\[📂 GitHub\]](https://github.com/OpenGVLab/InternVL) [\[🆕 Blog\]](https://internvl.github.io/blog/) [\[📜 InternVL 1.0 Paper\]](https://arxiv.org/abs/2312.14238) [\[📜 InternVL 1.5 Report\]](https://arxiv.org/abs/2404.16821) [\[🗨️ Chat Demo\]](https://internvl.opengvlab.com/) [\[🤗 HF Demo\]](https://huggingface.co/spaces/OpenGVLab/InternVL) [\[🚀 Quick Start\]](#quick-start) [\[📖 中文解读\]](https://zhuanlan.zhihu.com/p/706547971) [\[📖 Documents\]](https://internvl.readthedocs.io/en/latest/) [切换至中文版](#简介)  ## Introduction We are excited to announce the release of InternVL 2.0, the latest addition to the InternVL series of multimodal large language models. InternVL 2.0 features a variety of **instruction-tuned models**, ranging from 1 billion to 108 billion parameters. This repository contains the instruction-tuned InternVL2-2B model. Compared to the state-of-the-art open-source multimodal large language models, InternVL 2.0 surpasses most open-source models. It demonstrates competitive performance on par with proprietary commercial models across various capabilities, including document and chart comprehension, infographics QA, scene text understanding and OCR tasks, scientific and mathematical problem solving, as well as cultural understanding and integrated multimodal capabilities. InternVL 2.0 is trained with an 8k context window and utilizes training data consisting of long texts, multiple images, and videos, significantly improving its ability to handle these types of inputs compared to InternVL 1.5. For more details, please refer to our [blog](https://internvl.github.io/blog/2024-07-02-InternVL-2.0/) and [GitHub](https://github.com/OpenGVLab/InternVL). | Model Name | Vision Part | Language Part | HF Link | MS Link | | :------------------: | :---------------------------------------------------------------------------------: | :------------------------------------------------------------------------------------------: | :--------------------------------------------------------------: | :--------------------------------------------------------------------: | | InternVL2-1B | [InternViT-300M-448px](https://huggingface.co/OpenGVLab/InternViT-300M-448px) | [Qwen2-0.5B-Instruct](https://huggingface.co/Qwen/Qwen2-0.5B-Instruct) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-1B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-1B) | | InternVL2-2B | [InternViT-300M-448px](https://huggingface.co/OpenGVLab/InternViT-300M-448px) | [internlm2-chat-1_8b](https://huggingface.co/internlm/internlm2-chat-1_8b) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-2B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-2B) | | InternVL2-4B | [InternViT-300M-448px](https://huggingface.co/OpenGVLab/InternViT-300M-448px) | [Phi-3-mini-128k-instruct](https://huggingface.co/microsoft/Phi-3-mini-128k-instruct) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-4B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-4B) | | InternVL2-8B | [InternViT-300M-448px](https://huggingface.co/OpenGVLab/InternViT-300M-448px) | [internlm2_5-7b-chat](https://huggingface.co/internlm/internlm2_5-7b-chat) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-8B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-8B) | | InternVL2-26B | [InternViT-6B-448px-V1-5](https://huggingface.co/OpenGVLab/InternViT-6B-448px-V1-5) | [internlm2-chat-20b](https://huggingface.co/internlm/internlm2-chat-20b) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-26B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-26B) | | InternVL2-40B | [InternViT-6B-448px-V1-5](https://huggingface.co/OpenGVLab/InternViT-6B-448px-V1-5) | [Nous-Hermes-2-Yi-34B](https://huggingface.co/NousResearch/Nous-Hermes-2-Yi-34B) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-40B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-40B) | | InternVL2-Llama3-76B | [InternViT-6B-448px-V1-5](https://huggingface.co/OpenGVLab/InternViT-6B-448px-V1-5) | [Hermes-2-Theta-Llama-3-70B](https://huggingface.co/NousResearch/Hermes-2-Theta-Llama-3-70B) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-Llama3-76B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-Llama3-76B) | ## Model Details InternVL 2.0 is a multimodal large language model series, featuring models of various sizes. For each size, we release instruction-tuned models optimized for multimodal tasks. InternVL2-2B consists of [InternViT-300M-448px](https://huggingface.co/OpenGVLab/InternViT-300M-448px), an MLP projector, and [internlm2-chat-1_8b](https://huggingface.co/internlm/internlm2-chat-1_8b). ## Performance ### Image Benchmarks | Benchmark | PaliGemma-3B | Phi-3-Vision | Mini-InternVL-2B-1-5 | InternVL2-2B | | :--------------------------: | :----------: | :----------: | :------------------: | :----------: | | Model Size | 2.9B | 4.2B | 2.2B | 2.2B | | | | | | | | DocVQA_test | - | - | 85.0 | 86.9 | | ChartQA_test | - | 81.4 | 74.8 | 76.2 | | InfoVQA_test | - | - | 55.4 | 58.9 | | TextVQA_val | 68.1 | 70.9 | 70.5 | 73.4 | | OCRBench | 614 | 639 | 654 | 784 | | MME_sum | 1686.1 | 1508.0 | 1901.5 | 1876.8 | | RealWorldQA | 55.2 | 58.8 | 57.9 | 57.3 | | AI2D_test | 68.3 | 76.7 | 69.8 | 74.1 | | MMMU_val | 34.9 | 40.4 / 46.1 | 34.6 / 37.4 | 34.3 / 36.3 | | MMBench-EN_test | 71.0 | 73.6 | 70.9 | 73.2 | | MMBench-CN_test | 63.6 | - | 66.2 | 70.9 | | CCBench_dev | 29.6 | 24.1 | 63.5 | 74.7 | | MMVet_GPT-4-0613 | - | - | 39.3 | 44.6 | | MMVet_GPT-4-Turbo | 33.1 | 44.1 | 35.5 | 39.5 | | SEED-Image | 69.6 | 70.9 | 69.8 | 71.6 | | HallBench_avg | 32.2 | 39.0 | 37.5 | 37.9 | | MathVista_testmini | 28.7 | 44.5 | 41.1 | 46.3 | | OpenCompass_avg | 46.6 | 53.6 | 49.8 | 54.0 | - For more details and evaluation reproduction, please refer to our [Evaluation Guide](https://internvl.readthedocs.io/en/latest/internvl2.0/evaluation.html). - We simultaneously use [InternVL](https://github.com/OpenGVLab/InternVL) and [VLMEvalKit](https://github.com/open-compass/VLMEvalKit) repositories for model evaluation. Specifically, the results reported for DocVQA, ChartQA, InfoVQA, TextVQA, MME, AI2D, MMBench, CCBench, MMVet, and SEED-Image were tested using the InternVL repository. OCRBench, RealWorldQA, HallBench, and MathVista were evaluated using the VLMEvalKit. - For MMMU, we report both the original scores (left side: evaluated using the InternVL codebase for InternVL series models, and sourced from technical reports or webpages for other models) and the VLMEvalKit scores (right side: collected from the OpenCompass leaderboard). - Please note that evaluating the same model using different testing toolkits like [InternVL](https://github.com/OpenGVLab/InternVL) and [VLMEvalKit](https://github.com/open-compass/VLMEvalKit) can result in slight differences, which is normal. Updates to code versions and variations in environment and hardware can also cause minor discrepancies in results. ### Video Benchmarks | Benchmark | VideoChat2-Phi3 | VideoChat2-HD-Mistral | Mini-InternVL-2B-1-5 | InternVL2-2B | | :-------------------------: | :-------------: | :-------------------: | :------------------: | :----------: | | Model Size | 4B | 7B | 2.2B | 2.2B | | | | | | | | MVBench | 55.1 | 60.4 | 37.0 | 60.2 | | MMBench-Video_8f | - | - | 0.99 | 0.97 | | MMBench-Video_16f | - | - | 1.04 | 1.03 | | Video-MME<br>w/o subs | - | 42.3 | 42.9 | 45.0 | | Video-MME<br>w subs | - | 54.6 | 44.7 | 47.3 | - We evaluate our models on MVBench and Video-MME by extracting 16 frames from each video, and each frame was resized to a 448x448 image. ### Grounding Benchmarks | Model | avg. | RefCOCO<br>(val) | RefCOCO<br>(testA) | RefCOCO<br>(testB) | RefCOCO+<br>(val) | RefCOCO+<br>(testA) | RefCOCO+<br>(testB) | RefCOCO‑g<br>(val) | RefCOCO‑g<br>(test) | | :----------------------------: | :--: | :--------------: | :----------------: | :----------------: | :---------------: | :-----------------: | :-----------------: | :----------------: | :-----------------: | | UNINEXT-H<br>(Specialist SOTA) | 88.9 | 92.6 | 94.3 | 91.5 | 85.2 | 89.6 | 79.8 | 88.7 | 89.4 | | | | | | | | | | | | | Mini-InternVL-<br>Chat-2B-V1-5 | 75.8 | 80.7 | 86.7 | 72.9 | 72.5 | 82.3 | 60.8 | 75.6 | 74.9 | | Mini-InternVL-<br>Chat-4B-V1-5 | 84.4 | 88.0 | 91.4 | 83.5 | 81.5 | 87.4 | 73.8 | 84.7 | 84.6 | | InternVL‑Chat‑V1‑5 | 88.8 | 91.4 | 93.7 | 87.1 | 87.0 | 92.3 | 80.9 | 88.5 | 89.3 | | | | | | | | | | | | | InternVL2‑1B | 79.9 | 83.6 | 88.7 | 79.8 | 76.0 | 83.6 | 67.7 | 80.2 | 79.9 | | InternVL2‑2B | 77.7 | 82.3 | 88.2 | 75.9 | 73.5 | 82.8 | 63.3 | 77.6 | 78.3 | | InternVL2‑4B | 84.4 | 88.5 | 91.2 | 83.9 | 81.2 | 87.2 | 73.8 | 84.6 | 84.6 | | InternVL2‑8B | 82.9 | 87.1 | 91.1 | 80.7 | 79.8 | 87.9 | 71.4 | 82.7 | 82.7 | | InternVL2‑26B | 88.5 | 91.2 | 93.3 | 87.4 | 86.8 | 91.0 | 81.2 | 88.5 | 88.6 | | InternVL2‑40B | 90.3 | 93.0 | 94.7 | 89.2 | 88.5 | 92.8 | 83.6 | 90.3 | 90.6 | | InternVL2-<br>Llama3‑76B | 90.0 | 92.2 | 94.8 | 88.4 | 88.8 | 93.1 | 82.8 | 89.5 | 90.3 | - We use the following prompt to evaluate InternVL's grounding ability: `Please provide the bounding box coordinates of the region this sentence describes: <ref>{}</ref>` Limitations: Although we have made efforts to ensure the safety of the model during the training process and to encourage the model to generate text that complies with ethical and legal requirements, the model may still produce unexpected outputs due to its size and probabilistic generation paradigm. For example, the generated responses may contain biases, discrimination, or other harmful content. Please do not propagate such content. We are not responsible for any consequences resulting from the dissemination of harmful information. ### Invitation to Evaluate InternVL We welcome MLLM benchmark developers to assess our InternVL1.5 and InternVL2 series models. If you need to add your evaluation results here, please contact me at [wztxy89@163.com](mailto:wztxy89@163.com). ## Quick Start We provide an example code to run InternVL2-2B using `transformers`. We also welcome you to experience the InternVL2 series models in our [online demo](https://internvl.opengvlab.com/). > Please use transformers==4.37.2 to ensure the model works normally. ### Model Loading #### 16-bit (bf16 / fp16) ```python import torch from transformers import AutoTokenizer, AutoModel path = "OpenGVLab/InternVL2-2B" model = AutoModel.from_pretrained( path, torch_dtype=torch.bfloat16, low_cpu_mem_usage=True, use_flash_attn=True, trust_remote_code=True).eval().cuda() ``` #### BNB 8-bit Quantization ```python import torch from transformers import AutoTokenizer, AutoModel path = "OpenGVLab/InternVL2-2B" model = AutoModel.from_pretrained( path, torch_dtype=torch.bfloat16, load_in_8bit=True, low_cpu_mem_usage=True, use_flash_attn=True, trust_remote_code=True).eval() ``` #### BNB 4-bit Quantization ```python import torch from transformers import AutoTokenizer, AutoModel path = "OpenGVLab/InternVL2-2B" model = AutoModel.from_pretrained( path, torch_dtype=torch.bfloat16, load_in_4bit=True, low_cpu_mem_usage=True, use_flash_attn=True, trust_remote_code=True).eval() ``` #### Multiple GPUs The reason for writing the code this way is to avoid errors that occur during multi-GPU inference due to tensors not being on the same device. By ensuring that the first and last layers of the large language model (LLM) are on the same device, we prevent such errors. ```python import math import torch from transformers import AutoTokenizer, AutoModel def split_model(model_name): device_map = {} world_size = torch.cuda.device_count() num_layers = { 'InternVL2-1B': 24, 'InternVL2-2B': 24, 'InternVL2-4B': 32, 'InternVL2-8B': 32, 'InternVL2-26B': 48, 'InternVL2-40B': 60, 'InternVL2-Llama3-76B': 80}[model_name] # Since the first GPU will be used for ViT, treat it as half a GPU. num_layers_per_gpu = math.ceil(num_layers / (world_size - 0.5)) num_layers_per_gpu = [num_layers_per_gpu] * world_size num_layers_per_gpu[0] = math.ceil(num_layers_per_gpu[0] * 0.5) layer_cnt = 0 for i, num_layer in enumerate(num_layers_per_gpu): for j in range(num_layer): device_map[f'language_model.model.layers.{layer_cnt}'] = i layer_cnt += 1 device_map['vision_model'] = 0 device_map['mlp1'] = 0 device_map['language_model.model.tok_embeddings'] = 0 device_map['language_model.model.embed_tokens'] = 0 device_map['language_model.output'] = 0 device_map['language_model.model.norm'] = 0 device_map['language_model.lm_head'] = 0 device_map[f'language_model.model.layers.{num_layers - 1}'] = 0 return device_map path = "OpenGVLab/InternVL2-2B" device_map = split_model('InternVL2-2B') model = AutoModel.from_pretrained( path, torch_dtype=torch.bfloat16, low_cpu_mem_usage=True, use_flash_attn=True, trust_remote_code=True, device_map=device_map).eval() ``` ### Inference with Transformers ```python import numpy as np import torch import torchvision.transforms as T from decord import VideoReader, cpu from PIL import Image from torchvision.transforms.functional import InterpolationMode from transformers import AutoModel, AutoTokenizer IMAGENET_MEAN = (0.485, 0.456, 0.406) IMAGENET_STD = (0.229, 0.224, 0.225) def build_transform(input_size): MEAN, STD = IMAGENET_MEAN, IMAGENET_STD transform = T.Compose([ T.Lambda(lambda img: img.convert('RGB') if img.mode != 'RGB' else img), T.Resize((input_size, input_size), interpolation=InterpolationMode.BICUBIC), T.ToTensor(), T.Normalize(mean=MEAN, std=STD) ]) return transform def find_closest_aspect_ratio(aspect_ratio, target_ratios, width, height, image_size): best_ratio_diff = float('inf') best_ratio = (1, 1) area = width * height for ratio in target_ratios: target_aspect_ratio = ratio[0] / ratio[1] ratio_diff = abs(aspect_ratio - target_aspect_ratio) if ratio_diff < best_ratio_diff: best_ratio_diff = ratio_diff best_ratio = ratio elif ratio_diff == best_ratio_diff: if area > 0.5 * image_size * image_size * ratio[0] * ratio[1]: best_ratio = ratio return best_ratio def dynamic_preprocess(image, min_num=1, max_num=12, image_size=448, use_thumbnail=False): orig_width, orig_height = image.size aspect_ratio = orig_width / orig_height # calculate the existing image aspect ratio target_ratios = set( (i, j) for n in range(min_num, max_num + 1) for i in range(1, n + 1) for j in range(1, n + 1) if i * j <= max_num and i * j >= min_num) target_ratios = sorted(target_ratios, key=lambda x: x[0] * x[1]) # find the closest aspect ratio to the target target_aspect_ratio = find_closest_aspect_ratio( aspect_ratio, target_ratios, orig_width, orig_height, image_size) # calculate the target width and height target_width = image_size * target_aspect_ratio[0] target_height = image_size * target_aspect_ratio[1] blocks = target_aspect_ratio[0] * target_aspect_ratio[1] # resize the image resized_img = image.resize((target_width, target_height)) processed_images = [] for i in range(blocks): box = ( (i % (target_width // image_size)) * image_size, (i // (target_width // image_size)) * image_size, ((i % (target_width // image_size)) + 1) * image_size, ((i // (target_width // image_size)) + 1) * image_size ) # split the image split_img = resized_img.crop(box) processed_images.append(split_img) assert len(processed_images) == blocks if use_thumbnail and len(processed_images) != 1: thumbnail_img = image.resize((image_size, image_size)) processed_images.append(thumbnail_img) return processed_images def load_image(image_file, input_size=448, max_num=12): image = Image.open(image_file).convert('RGB') transform = build_transform(input_size=input_size) images = dynamic_preprocess(image, image_size=input_size, use_thumbnail=True, max_num=max_num) pixel_values = [transform(image) for image in images] pixel_values = torch.stack(pixel_values) return pixel_values # If you want to load a model using multiple GPUs, please refer to the `Multiple GPUs` section. path = 'OpenGVLab/InternVL2-2B' model = AutoModel.from_pretrained( path, torch_dtype=torch.bfloat16, low_cpu_mem_usage=True, use_flash_attn=True, trust_remote_code=True).eval().cuda() tokenizer = AutoTokenizer.from_pretrained(path, trust_remote_code=True, use_fast=False) # set the max number of tiles in `max_num` pixel_values = load_image('./examples/image1.jpg', max_num=12).to(torch.bfloat16).cuda() generation_config = dict(max_new_tokens=1024, do_sample=True) # pure-text conversation (纯文本对话) question = 'Hello, who are you?' response, history = model.chat(tokenizer, None, question, generation_config, history=None, return_history=True) print(f'User: {question}\nAssistant: {response}') question = 'Can you tell me a story?' response, history = model.chat(tokenizer, None, question, generation_config, history=history, return_history=True) print(f'User: {question}\nAssistant: {response}') # single-image single-round conversation (单图单轮对话) question = '<image>\nPlease describe the image shortly.' response = model.chat(tokenizer, pixel_values, question, generation_config) print(f'User: {question}\nAssistant: {response}') # single-image multi-round conversation (单图多轮对话) question = '<image>\nPlease describe the image in detail.' response, history = model.chat(tokenizer, pixel_values, question, generation_config, history=None, return_history=True) print(f'User: {question}\nAssistant: {response}') question = 'Please write a poem according to the image.' response, history = model.chat(tokenizer, pixel_values, question, generation_config, history=history, return_history=True) print(f'User: {question}\nAssistant: {response}') # multi-image multi-round conversation, combined images (多图多轮对话，拼接图像) pixel_values1 = load_image('./examples/image1.jpg', max_num=12).to(torch.bfloat16).cuda() pixel_values2 = load_image('./examples/image2.jpg', max_num=12).to(torch.bfloat16).cuda() pixel_values = torch.cat((pixel_values1, pixel_values2), dim=0) question = '<image>\nDescribe the two images in detail.' response, history = model.chat(tokenizer, pixel_values, question, generation_config, history=None, return_history=True) print(f'User: {question}\nAssistant: {response}') question = 'What are the similarities and differences between these two images.' response, history = model.chat(tokenizer, pixel_values, question, generation_config, history=history, return_history=True) print(f'User: {question}\nAssistant: {response}') # multi-image multi-round conversation, separate images (多图多轮对话，独立图像) pixel_values1 = load_image('./examples/image1.jpg', max_num=12).to(torch.bfloat16).cuda() pixel_values2 = load_image('./examples/image2.jpg', max_num=12).to(torch.bfloat16).cuda() pixel_values = torch.cat((pixel_values1, pixel_values2), dim=0) num_patches_list = [pixel_values1.size(0), pixel_values2.size(0)] question = 'Image-1: <image>\nImage-2: <image>\nDescribe the two images in detail.' response, history = model.chat(tokenizer, pixel_values, question, generation_config, num_patches_list=num_patches_list, history=None, return_history=True) print(f'User: {question}\nAssistant: {response}') question = 'What are the similarities and differences between these two images.' response, history = model.chat(tokenizer, pixel_values, question, generation_config, num_patches_list=num_patches_list, history=history, return_history=True) print(f'User: {question}\nAssistant: {response}') # batch inference, single image per sample (单图批处理) pixel_values1 = load_image('./examples/image1.jpg', max_num=12).to(torch.bfloat16).cuda() pixel_values2 = load_image('./examples/image2.jpg', max_num=12).to(torch.bfloat16).cuda() num_patches_list = [pixel_values1.size(0), pixel_values2.size(0)] pixel_values = torch.cat((pixel_values1, pixel_values2), dim=0) questions = ['<image>\nDescribe the image in detail.'] * len(num_patches_list) responses = model.batch_chat(tokenizer, pixel_values, num_patches_list=num_patches_list, questions=questions, generation_config=generation_config) for question, response in zip(questions, responses): print(f'User: {question}\nAssistant: {response}') # video multi-round conversation (视频多轮对话) def get_index(bound, fps, max_frame, first_idx=0, num_segments=32): if bound: start, end = bound[0], bound[1] else: start, end = -100000, 100000 start_idx = max(first_idx, round(start * fps)) end_idx = min(round(end * fps), max_frame) seg_size = float(end_idx - start_idx) / num_segments frame_indices = np.array([ int(start_idx + (seg_size / 2) + np.round(seg_size * idx)) for idx in range(num_segments) ]) return frame_indices def load_video(video_path, bound=None, input_size=448, max_num=1, num_segments=32): vr = VideoReader(video_path, ctx=cpu(0), num_threads=1) max_frame = len(vr) - 1 fps = float(vr.get_avg_fps()) pixel_values_list, num_patches_list = [], [] transform = build_transform(input_size=input_size) frame_indices = get_index(bound, fps, max_frame, first_idx=0, num_segments=num_segments) for frame_index in frame_indices: img = Image.fromarray(vr[frame_index].asnumpy()).convert('RGB') img = dynamic_preprocess(img, image_size=input_size, use_thumbnail=True, max_num=max_num) pixel_values = [transform(tile) for tile in img] pixel_values = torch.stack(pixel_values) num_patches_list.append(pixel_values.shape[0]) pixel_values_list.append(pixel_values) pixel_values = torch.cat(pixel_values_list) return pixel_values, num_patches_list video_path = './examples/red-panda.mp4' pixel_values, num_patches_list = load_video(video_path, num_segments=8, max_num=1) pixel_values = pixel_values.to(torch.bfloat16).cuda() video_prefix = ''.join([f'Frame{i+1}: <image>\n' for i in range(len(num_patches_list))]) question = video_prefix + 'What is the red panda doing?' # Frame1: <image>\nFrame2: <image>\n...\nFrame8: <image>\n{question} response, history = model.chat(tokenizer, pixel_values, question, generation_config, num_patches_list=num_patches_list, history=None, return_history=True) print(f'User: {question}\nAssistant: {response}') question = 'Describe this video in detail. Don\'t repeat.' response, history = model.chat(tokenizer, pixel_values, question, generation_config, num_patches_list=num_patches_list, history=history, return_history=True) print(f'User: {question}\nAssistant: {response}') ``` #### Streaming output Besides this method, you can also use the following code to get streamed output. ```python from transformers import TextIteratorStreamer from threading import Thread # Initialize the streamer streamer = TextIteratorStreamer(tokenizer, skip_prompt=True, skip_special_tokens=True, timeout=10) # Define the generation configuration generation_config = dict(max_new_tokens=1024, do_sample=False, streamer=streamer) # Start the model chat in a separate thread thread = Thread(target=model.chat, kwargs=dict( tokenizer=tokenizer, pixel_values=pixel_values, question=question, history=None, return_history=False, generation_config=generation_config, )) thread.start() # Initialize an empty string to store the generated text generated_text = '' # Loop through the streamer to get the new text as it is generated for new_text in streamer: if new_text == model.conv_template.sep: break generated_text += new_text print(new_text, end='', flush=True) # Print each new chunk of generated text on the same line ``` ## Finetune Many repositories now support fine-tuning of the InternVL series models, including [InternVL](https://github.com/OpenGVLab/InternVL), [SWIFT](https://github.com/modelscope/ms-swift), [XTurner](https://github.com/InternLM/xtuner), and others. Please refer to their documentation for more details on fine-tuning. ## Deployment ### LMDeploy LMDeploy is a toolkit for compressing, deploying, and serving LLM, developed by the MMRazor and MMDeploy teams. ```sh pip install lmdeploy==0.5.3 ``` LMDeploy abstracts the complex inference process of multi-modal Vision-Language Models (VLM) into an easy-to-use pipeline, similar to the Large Language Model (LLM) inference pipeline. #### A 'Hello, world' example ```python from lmdeploy import pipeline, TurbomindEngineConfig from lmdeploy.vl import load_image model = 'OpenGVLab/InternVL2-2B' image = load_image('https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/tests/data/tiger.jpeg') pipe = pipeline(model, backend_config=TurbomindEngineConfig(session_len=8192)) response = pipe(('describe this image', image)) print(response.text) ``` If `ImportError` occurs while executing this case, please install the required dependency packages as prompted. #### Multi-images inference When dealing with multiple images, you can put them all in one list. Keep in mind that multiple images will lead to a higher number of input tokens, and as a result, the size of the context window typically needs to be increased. > Warning: Due to the scarcity of multi-image conversation data, the performance on multi-image tasks may be unstable, and it may require multiple attempts to achieve satisfactory results. ```python from lmdeploy import pipeline, TurbomindEngineConfig from lmdeploy.vl import load_image from lmdeploy.vl.constants import IMAGE_TOKEN model = 'OpenGVLab/InternVL2-2B' pipe = pipeline(model, backend_config=TurbomindEngineConfig(session_len=8192)) image_urls=[ 'https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/demo/resources/human-pose.jpg', 'https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/demo/resources/det.jpg' ] images = [load_image(img_url) for img_url in image_urls] # Numbering images improves multi-image conversations response = pipe((f'Image-1: {IMAGE_TOKEN}\nImage-2: {IMAGE_TOKEN}\ndescribe these two images', images)) print(response.text) ``` #### Batch prompts inference Conducting inference with batch prompts is quite straightforward; just place them within a list structure: ```python from lmdeploy import pipeline, TurbomindEngineConfig from lmdeploy.vl import load_image model = 'OpenGVLab/InternVL2-2B' pipe = pipeline(model, backend_config=TurbomindEngineConfig(session_len=8192)) image_urls=[ "https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/demo/resources/human-pose.jpg", "https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/demo/resources/det.jpg" ] prompts = [('describe this image', load_image(img_url)) for img_url in image_urls] response = pipe(prompts) print(response) ``` #### Multi-turn conversation There are two ways to do the multi-turn conversations with the pipeline. One is to construct messages according to the format of OpenAI and use above introduced method, the other is to use the `pipeline.chat` interface. ```python from lmdeploy import pipeline, TurbomindEngineConfig, GenerationConfig from lmdeploy.vl import load_image model = 'OpenGVLab/InternVL2-2B' pipe = pipeline(model, backend_config=TurbomindEngineConfig(session_len=8192)) image = load_image('https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/demo/resources/human-pose.jpg') gen_config = GenerationConfig(top_k=40, top_p=0.8, temperature=0.8) sess = pipe.chat(('describe this image', image), gen_config=gen_config) print(sess.response.text) sess = pipe.chat('What is the woman doing?', session=sess, gen_config=gen_config) print(sess.response.text) ``` #### Service LMDeploy's `api_server` enables models to be easily packed into services with a single command. The provided RESTful APIs are compatible with OpenAI's interfaces. Below are an example of service startup: ```shell lmdeploy serve api_server OpenGVLab/InternVL2-2B --backend turbomind --server-port 23333 ``` To use the OpenAI-style interface, you need to install OpenAI: ```shell pip install openai ``` Then, use the code below to make the API call: ```python from openai import OpenAI client = OpenAI(api_key='YOUR_API_KEY', base_url='http://0.0.0.0:23333/v1') model_name = client.models.list().data[0].id response = client.chat.completions.create( model=model_name, messages=[{ 'role': 'user', 'content': [{ 'type': 'text', 'text': 'describe this image', }, { 'type': 'image_url', 'image_url': { 'url': 'https://modelscope.oss-cn-beijing.aliyuncs.com/resource/tiger.jpeg', }, }], }], temperature=0.8, top_p=0.8) print(response) ``` ## License This project is released under the MIT license, while InternLM2 is licensed under the Apache-2.0 license. ## Citation If you find this project useful in your research, please consider citing: ```BibTeX @article{chen2023internvl, title={InternVL: Scaling up Vision Foundation Models and Aligning for Generic Visual-Linguistic Tasks}, author={Chen, Zhe and Wu, Jiannan and Wang, Wenhai and Su, Weijie and Chen, Guo and Xing, Sen and Zhong, Muyan and Zhang, Qinglong and Zhu, Xizhou and Lu, Lewei and Li, Bin and Luo, Ping and Lu, Tong and Qiao, Yu and Dai, Jifeng}, journal={arXiv preprint arXiv:2312.14238}, year={2023} } @article{chen2024far, title={How Far Are We to GPT-4V? Closing the Gap to Commercial Multimodal Models with Open-Source Suites}, author={Chen, Zhe and Wang, Weiyun and Tian, Hao and Ye, Shenglong and Gao, Zhangwei and Cui, Erfei and Tong, Wenwen and Hu, Kongzhi and Luo, Jiapeng and Ma, Zheng and others}, journal={arXiv preprint arXiv:2404.16821}, year={2024} } ``` ## 简介 我们很高兴宣布 InternVL 2.0 的发布，这是 InternVL 系列多模态大语言模型的最新版本。InternVL 2.0 提供了多种**指令微调**的模型，参数从 10 亿到 1080 亿不等。此仓库包含经过指令微调的 InternVL2-2B 模型。 与最先进的开源多模态大语言模型相比，InternVL 2.0 超越了大多数开源模型。它在各种能力上表现出与闭源商业模型相媲美的竞争力，包括文档和图表理解、信息图表问答、场景文本理解和 OCR 任务、科学和数学问题解决，以及文化理解和综合多模态能力。 InternVL 2.0 使用 8k 上下文窗口进行训练，训练数据包含长文本、多图和视频数据，与 InternVL 1.5 相比，其处理这些类型输入的能力显著提高。更多详细信息，请参阅我们的博客和 GitHub。 | 模型名称 | 视觉部分 | 语言部分 | HF 链接 | MS 链接 | | :------------------: | :---------------------------------------------------------------------------------: | :------------------------------------------------------------------------------------------: | :--------------------------------------------------------------: | :--------------------------------------------------------------------: | | InternVL2-1B | [InternViT-300M-448px](https://huggingface.co/OpenGVLab/InternViT-300M-448px) | [Qwen2-0.5B-Instruct](https://huggingface.co/Qwen/Qwen2-0.5B-Instruct) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-1B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-1B) | | InternVL2-2B | [InternViT-300M-448px](https://huggingface.co/OpenGVLab/InternViT-300M-448px) | [internlm2-chat-1_8b](https://huggingface.co/internlm/internlm2-chat-1_8b) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-2B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-2B) | | InternVL2-4B | [InternViT-300M-448px](https://huggingface.co/OpenGVLab/InternViT-300M-448px) | [Phi-3-mini-128k-instruct](https://huggingface.co/microsoft/Phi-3-mini-128k-instruct) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-4B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-4B) | | InternVL2-8B | [InternViT-300M-448px](https://huggingface.co/OpenGVLab/InternViT-300M-448px) | [internlm2_5-7b-chat](https://huggingface.co/internlm/internlm2_5-7b-chat) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-8B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-8B) | | InternVL2-26B | [InternViT-6B-448px-V1-5](https://huggingface.co/OpenGVLab/InternViT-6B-448px-V1-5) | [internlm2-chat-20b](https://huggingface.co/internlm/internlm2-chat-20b) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-26B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-26B) | | InternVL2-40B | [InternViT-6B-448px-V1-5](https://huggingface.co/OpenGVLab/InternViT-6B-448px-V1-5) | [Nous-Hermes-2-Yi-34B](https://huggingface.co/NousResearch/Nous-Hermes-2-Yi-34B) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-40B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-40B) | | InternVL2-Llama3-76B | [InternViT-6B-448px-V1-5](https://huggingface.co/OpenGVLab/InternViT-6B-448px-V1-5) | [Hermes-2-Theta-Llama-3-70B](https://huggingface.co/NousResearch/Hermes-2-Theta-Llama-3-70B) | [🤗 link](https://huggingface.co/OpenGVLab/InternVL2-Llama3-76B) | [🤖 link](https://modelscope.cn/models/OpenGVLab/InternVL2-Llama3-76B) | ## 模型细节 InternVL 2.0 是一个多模态大语言模型系列，包含各种规模的模型。对于每个规模的模型，我们都会发布针对多模态任务优化的指令微调模型。InternVL2-2B 包含 [InternViT-300M-448px](https://huggingface.co/OpenGVLab/InternViT-300M-448px)、一个 MLP 投影器和 [internlm2-chat-1_8b](https://huggingface.co/internlm/internlm2-chat-1_8b)。 ## 性能测试 ### 图像相关评测 | 评测数据集 | PaliGemma-3B | Phi-3-Vision | Mini-InternVL-2B-1-5 | InternVL2-2B | | :--------------------------: | :----------: | :----------: | :------------------: | :----------: | | 模型大小 | 2.9B | 4.2B | 2.2B | 2.2B | | | | | | | | DocVQA_test | - | - | 85.0 | 86.9 | | ChartQA_test | - | 81.4 | 74.8 | 76.2 | | InfoVQA_test | - | - | 55.4 | 58.9 | | TextVQA_val | 68.1 | 70.9 | 70.5 | 73.4 | | OCRBench | 614 | 639 | 654 | 784 | | MME_sum | 1686.1 | 1508.0 | 1901.5 | 1876.8 | | RealWorldQA | 55.2 | 58.8 | 57.9 | 57.3 | | AI2D_test | 68.3 | 76.7 | 69.8 | 74.1 | | MMMU_val | 34.9 | 40.4 / 46.1 | 34.6 / 37.4 | 34.3 / 36.3 | | MMBench-EN_test | 71.0 | 73.6 | 70.9 | 73.2 | | MMBench-CN_test | 63.6 | - | 66.2 | 70.9 | | CCBench_dev | 29.6 | 24.1 | 63.5 | 74.7 | | MMVet_GPT-4-0613 | - | - | 39.3 | 44.6 | | MMVet_GPT-4-Turbo | 33.1 | 44.1 | 35.5 | 39.5 | | SEED-Image | 69.6 | 70.9 | 69.8 | 71.6 | | HallBench_avg | 32.2 | 39.0 | 37.5 | 37.9 | | MathVista_testmini | 28.7 | 44.5 | 41.1 | 46.3 | | OpenCompass_avg | 46.6 | 53.6 | 49.8 | 54.0 | - 关于更多的细节以及评测复现，请看我们的[评测指南](https://internvl.readthedocs.io/en/latest/internvl2.0/evaluation.html)。 - 我们同时使用 InternVL 和 VLMEvalKit 仓库进行模型评估。具体来说，DocVQA、ChartQA、InfoVQA、TextVQA、MME、AI2D、MMBench、CCBench、MMVet 和 SEED-Image 的结果是使用 InternVL 仓库测试的。OCRBench、RealWorldQA、HallBench 和 MathVista 是使用 VLMEvalKit 进行评估的。 - 对于MMMU，我们报告了原始分数（左侧：InternVL系列模型使用InternVL代码库评测，其他模型的分数来自其技术报告或网页）和VLMEvalKit分数（右侧：从OpenCompass排行榜收集）。 - 请注意，使用不同的测试工具包（如 InternVL 和 VLMEvalKit）评估同一模型可能会导致细微差异，这是正常的。代码版本的更新、环境和硬件的变化也可能导致结果的微小差异。 ### 视频相关评测 | 评测数据集 | VideoChat2-Phi3 | VideoChat2-HD-Mistral | Mini-InternVL-2B-1-5 | InternVL2-2B | | :-------------------------: | :-------------: | :-------------------: | :------------------: | :----------: | | 模型大小 | 4B | 7B | 2.2B | 2.2B | | | | | | | | MVBench | 55.1 | 60.4 | 37.0 | 60.2 | | MMBench-Video_8f | - | - | 0.99 | 0.97 | | MMBench-Video_16f | - | - | 1.04 | 1.03 | | Video-MME<br>w/o subs | - | 42.3 | 42.9 | 45.0 | | Video-MME<br>w subs | - | 54.6 | 44.7 | 47.3 | - 我们通过从每个视频中提取 16 帧来评估我们的模型在 MVBench 和 Video-MME 上的性能，每个视频帧被调整为 448x448 的图像。 ### 定位相关评测 | 模型 | avg. | RefCOCO<br>(val) | RefCOCO<br>(testA) | RefCOCO<br>(testB) | RefCOCO+<br>(val) | RefCOCO+<br>(testA) | RefCOCO+<br>(testB) | RefCOCO‑g<br>(val) | RefCOCO‑g<br>(test) | | :----------------------------: | :--: | :--------------: | :----------------: | :----------------: | :---------------: | :-----------------: | :-----------------: | :----------------: | :-----------------: | | UNINEXT-H<br>(Specialist SOTA) | 88.9 | 92.6 | 94.3 | 91.5 | 85.2 | 89.6 | 79.8 | 88.7 | 89.4 | | | | | | | | | | | | | Mini-InternVL-<br>Chat-2B-V1-5 | 75.8 | 80.7 | 86.7 | 72.9 | 72.5 | 82.3 | 60.8 | 75.6 | 74.9 | | Mini-InternVL-<br>Chat-4B-V1-5 | 84.4 | 88.0 | 91.4 | 83.5 | 81.5 | 87.4 | 73.8 | 84.7 | 84.6 | | InternVL‑Chat‑V1‑5 | 88.8 | 91.4 | 93.7 | 87.1 | 87.0 | 92.3 | 80.9 | 88.5 | 89.3 | | | | | | | | | | | | | InternVL2‑1B | 79.9 | 83.6 | 88.7 | 79.8 | 76.0 | 83.6 | 67.7 | 80.2 | 79.9 | | InternVL2‑2B | 77.7 | 82.3 | 88.2 | 75.9 | 73.5 | 82.8 | 63.3 | 77.6 | 78.3 | | InternVL2‑4B | 84.4 | 88.5 | 91.2 | 83.9 | 81.2 | 87.2 | 73.8 | 84.6 | 84.6 | | InternVL2‑8B | 82.9 | 87.1 | 91.1 | 80.7 | 79.8 | 87.9 | 71.4 | 82.7 | 82.7 | | InternVL2‑26B | 88.5 | 91.2 | 93.3 | 87.4 | 86.8 | 91.0 | 81.2 | 88.5 | 88.6 | | InternVL2‑40B | 90.3 | 93.0 | 94.7 | 89.2 | 88.5 | 92.8 | 83.6 | 90.3 | 90.6 | | InternVL2-<br>Llama3‑76B | 90.0 | 92.2 | 94.8 | 88.4 | 88.8 | 93.1 | 82.8 | 89.5 | 90.3 | - 我们使用以下 Prompt 来评测 InternVL 的 Grounding 能力: `Please provide the bounding box coordinates of the region this sentence describes: <ref>{}</ref>` 限制：尽管在训练过程中我们非常注重模型的安全性，尽力促使模型输出符合伦理和法律要求的文本，但受限于模型大小以及概率生成范式，模型可能会产生各种不符合预期的输出，例如回复内容包含偏见、歧视等有害内容，请勿传播这些内容。由于传播不良信息导致的任何后果，本项目不承担责任。 ### 邀请评测 InternVL 我们欢迎各位 MLLM benchmark 的开发者对我们的 InternVL1.5 以及 InternVL2 系列模型进行评测。如果需要在此处添加评测结果，请与我联系（[wztxy89@163.com](mailto:wztxy89@163.com)）。 ## 快速启动 我们提供了一个示例代码，用于使用 `transformers` 运行 InternVL2-2B。 我们也欢迎你在我们的[在线demo](https://internvl.opengvlab.com/)中体验InternVL2的系列模型。 > 请使用 transformers==4.37.2 以确保模型正常运行。 示例代码请[点击这里](#quick-start)。 ## 微调 许多仓库现在都支持 InternVL 系列模型的微调，包括 [InternVL](https://github.com/OpenGVLab/InternVL)、[SWIFT](https://github.com/modelscope/ms-swift)、[XTurner](https://github.com/InternLM/xtuner) 等。请参阅它们的文档以获取更多微调细节。 ## 部署 ### LMDeploy LMDeploy 是由 MMRazor 和 MMDeploy 团队开发的用于压缩、部署和服务大语言模型（LLM）的工具包。 ```sh pip install lmdeploy==0.5.3 ``` LMDeploy 将多模态视觉-语言模型（VLM）的复杂推理过程抽象为一个易于使用的管道，类似于大语言模型（LLM）的推理管道。 #### 一个“你好，世界”示例 ```python from lmdeploy import pipeline, TurbomindEngineConfig from lmdeploy.vl import load_image model = 'OpenGVLab/InternVL2-2B' image = load_image('https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/tests/data/tiger.jpeg') pipe = pipeline(model, backend_config=TurbomindEngineConfig(session_len=8192)) response = pipe(('describe this image', image)) print(response.text) ``` 如果在执行此示例时出现 `ImportError`，请按照提示安装所需的依赖包。 #### 多图像推理 在处理多张图像时，可以将它们全部放入一个列表中。请注意，多张图像会导致输入 token 数量增加，因此通常需要增加上下文窗口的大小。 ```python from lmdeploy import pipeline, TurbomindEngineConfig from lmdeploy.vl import load_image from lmdeploy.vl.constants import IMAGE_TOKEN model = 'OpenGVLab/InternVL2-2B' pipe = pipeline(model, backend_config=TurbomindEngineConfig(session_len=8192)) image_urls=[ 'https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/demo/resources/human-pose.jpg', 'https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/demo/resources/det.jpg' ] images = [load_image(img_url) for img_url in image_urls] # Numbering images improves multi-image conversations response = pipe((f'Image-1: {IMAGE_TOKEN}\nImage-2: {IMAGE_TOKEN}\ndescribe these two images', images)) print(response.text) ``` #### 批量Prompt推理 使用批量Prompt进行推理非常简单；只需将它们放在一个列表结构中： ```python from lmdeploy import pipeline, TurbomindEngineConfig from lmdeploy.vl import load_image model = 'OpenGVLab/InternVL2-2B' pipe = pipeline(model, backend_config=TurbomindEngineConfig(session_len=8192)) image_urls=[ "https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/demo/resources/human-pose.jpg", "https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/demo/resources/det.jpg" ] prompts = [('describe this image', load_image(img_url)) for img_url in image_urls] response = pipe(prompts) print(response) ``` #### 多轮对话 使用管道进行多轮对话有两种方法。一种是根据 OpenAI 的格式构建消息并使用上述方法，另一种是使用 `pipeline.chat` 接口。 ```python from lmdeploy import pipeline, TurbomindEngineConfig, GenerationConfig from lmdeploy.vl import load_image model = 'OpenGVLab/InternVL2-2B' pipe = pipeline(model, backend_config=TurbomindEngineConfig(session_len=8192)) image = load_image('https://raw.githubusercontent.com/open-mmlab/mmdeploy/main/demo/resources/human-pose.jpg') gen_config = GenerationConfig(top_k=40, top_p=0.8, temperature=0.8) sess = pipe.chat(('describe this image', image), gen_config=gen_config) print(sess.response.text) sess = pipe.chat('What is the woman doing?', session=sess, gen_config=gen_config) print(sess.response.text) ``` #### API部署 LMDeploy 的 `api_server` 使模型能够通过一个命令轻松打包成服务。提供的 RESTful API 与 OpenAI 的接口兼容。以下是服务启动的示例： ```shell lmdeploy serve api_server OpenGVLab/InternVL2-2B --backend turbomind --server-port 23333 ``` 为了使用OpenAI风格的API接口，您需要安装OpenAI: ```shell pip install openai ``` 然后，使用下面的代码进行API调用: ```python from openai import OpenAI client = OpenAI(api_key='YOUR_API_KEY', base_url='http://0.0.0.0:23333/v1') model_name = client.models.list().data[0].id response = client.chat.completions.create( model=model_name, messages=[{ 'role': 'user', 'content': [{ 'type': 'text', 'text': 'describe this image', }, { 'type': 'image_url', 'image_url': { 'url': 'https://modelscope.oss-cn-beijing.aliyuncs.com/resource/tiger.jpeg', }, }], }], temperature=0.8, top_p=0.8) print(response) ``` ## 开源许可证 该项目采用 MIT 许可证发布，而 InternLM2 则采用 Apache-2.0 许可证。 ## 引用 如果您发现此项目对您的研究有用，可以考虑引用我们的论文： ```BibTeX @article{chen2023internvl, title={InternVL: Scaling up Vision Foundation Models and Aligning for Generic Visual-Linguistic Tasks}, author={Chen, Zhe and Wu, Jiannan and Wang, Wenhai and Su, Weijie and Chen, Guo and Xing, Sen and Zhong, Muyan and Zhang, Qinglong and Zhu, Xizhou and Lu, Lewei and Li, Bin and Luo, Ping and Lu, Tong and Qiao, Yu and Dai, Jifeng}, journal={arXiv preprint arXiv:2312.14238}, year={2023} } @article{chen2024far, title={How Far Are We to GPT-4V? Closing the Gap to Commercial Multimodal Models with Open-Source Suites}, author={Chen, Zhe and Wang, Weiyun and Tian, Hao and Ye, Shenglong and Gao, Zhangwei and Cui, Erfei and Tong, Wenwen and Hu, Kongzhi and Luo, Jiapeng and Ma, Zheng and others}, journal={arXiv preprint arXiv:2404.16821}, year={2024} } ```

medicalai/ClinicalBERT

medicalai

transformers

fill-mask

--- tags: - medical --- # ClinicalBERT <!-- Provide a quick summary of what the model is/does. --> This model card describes the ClinicalBERT model, which was trained on a large multicenter dataset with a large corpus of 1.2B words of diverse diseases we constructed. We then utilized a large-scale corpus of EHRs from over 3 million patient records to fine tune the base language model. ## Pretraining Data The ClinicalBERT model was trained on a large multicenter dataset with a large corpus of 1.2B words of diverse diseases we constructed. <!-- For more details, see here. --> ## Model Pretraining ### Pretraining Procedures The ClinicalBERT was initialized from BERT. Then the training followed the principle of masked language model, in which given a piece of text, we randomly replace some tokens by MASKs, special tokens for masking, and then require the model to predict the original tokens via contextual text. ### Pretraining Hyperparameters We used a batch size of 32, a maximum sequence length of 256, and a learning rate of 5e-5 for pre-training our models. ## How to use the model Load the model via the transformers library: ```python from transformers import AutoTokenizer, AutoModel tokenizer = AutoTokenizer.from_pretrained("medicalai/ClinicalBERT") model = AutoModel.from_pretrained("medicalai/ClinicalBERT") ``` ## Citation Please cite this article: Wang, G., Liu, X., Ying, Z. et al. Optimized glycemic control of type 2 diabetes with reinforcement learning: a proof-of-concept trial. Nat Med (2023). https://doi.org/10.1038/s41591-023-02552-9

sentence-transformers/paraphrase-TinyBERT-L6-v2

sentence-transformers

sentence-transformers

sentence-similarity

--- license: apache-2.0 library_name: sentence-transformers tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers pipeline_tag: sentence-similarity --- # sentence-transformers/paraphrase-TinyBERT-L6-v2 This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 768 dimensional dense vector space and can be used for tasks like clustering or semantic search. ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer sentences = ["This is an example sentence", "Each sentence is converted"] model = SentenceTransformer('sentence-transformers/paraphrase-TinyBERT-L6-v2') embeddings = model.encode(sentences) print(embeddings) ``` ## Usage (HuggingFace Transformers) Without [sentence-transformers](https://www.SBERT.net), you can use the model like this: First, you pass your input through the transformer model, then you have to apply the right pooling-operation on-top of the contextualized word embeddings. ```python from transformers import AutoTokenizer, AutoModel import torch #Mean Pooling - Take attention mask into account for correct averaging def mean_pooling(model_output, attention_mask): token_embeddings = model_output[0] #First element of model_output contains all token embeddings input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) # Sentences we want sentence embeddings for sentences = ['This is an example sentence', 'Each sentence is converted'] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('sentence-transformers/paraphrase-TinyBERT-L6-v2') model = AutoModel.from_pretrained('sentence-transformers/paraphrase-TinyBERT-L6-v2') # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, max pooling. sentence_embeddings = mean_pooling(model_output, encoded_input['attention_mask']) print("Sentence embeddings:") print(sentence_embeddings) ``` ## Evaluation Results For an automated evaluation of this model, see the *Sentence Embeddings Benchmark*: [https://seb.sbert.net](https://seb.sbert.net?model_name=sentence-transformers/paraphrase-TinyBERT-L6-v2) ## Full Model Architecture ``` SentenceTransformer( (0): Transformer({'max_seq_length': 128, 'do_lower_case': False}) with Transformer model: BertModel (1): Pooling({'word_embedding_dimension': 768, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False}) ) ``` ## Citing & Authors This model was trained by [sentence-transformers](https://www.sbert.net/). If you find this model helpful, feel free to cite our publication [Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks](https://arxiv.org/abs/1908.10084): ```bibtex @inproceedings{reimers-2019-sentence-bert, title = "Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks", author = "Reimers, Nils and Gurevych, Iryna", booktitle = "Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing", month = "11", year = "2019", publisher = "Association for Computational Linguistics", url = "http://arxiv.org/abs/1908.10084", } ```

microsoft/speecht5_tts

microsoft

transformers

text-to-speech

--- license: mit tags: - audio - text-to-speech datasets: - libritts --- # SpeechT5 (TTS task) SpeechT5 model fine-tuned for speech synthesis (text-to-speech) on LibriTTS. This model was introduced in [SpeechT5: Unified-Modal Encoder-Decoder Pre-Training for Spoken Language Processing](https://arxiv.org/abs/2110.07205) by Junyi Ao, Rui Wang, Long Zhou, Chengyi Wang, Shuo Ren, Yu Wu, Shujie Liu, Tom Ko, Qing Li, Yu Zhang, Zhihua Wei, Yao Qian, Jinyu Li, Furu Wei. SpeechT5 was first released in [this repository](https://github.com/microsoft/SpeechT5/), [original weights](https://huggingface.co/mechanicalsea/speecht5-tts). The license used is [MIT](https://github.com/microsoft/SpeechT5/blob/main/LICENSE). ## Model Description Motivated by the success of T5 (Text-To-Text Transfer Transformer) in pre-trained natural language processing models, we propose a unified-modal SpeechT5 framework that explores the encoder-decoder pre-training for self-supervised speech/text representation learning. The SpeechT5 framework consists of a shared encoder-decoder network and six modal-specific (speech/text) pre/post-nets. After preprocessing the input speech/text through the pre-nets, the shared encoder-decoder network models the sequence-to-sequence transformation, and then the post-nets generate the output in the speech/text modality based on the output of the decoder. Leveraging large-scale unlabeled speech and text data, we pre-train SpeechT5 to learn a unified-modal representation, hoping to improve the modeling capability for both speech and text. To align the textual and speech information into this unified semantic space, we propose a cross-modal vector quantization approach that randomly mixes up speech/text states with latent units as the interface between encoder and decoder. Extensive evaluations show the superiority of the proposed SpeechT5 framework on a wide variety of spoken language processing tasks, including automatic speech recognition, speech synthesis, speech translation, voice conversion, speech enhancement, and speaker identification. - **Developed by:** Junyi Ao, Rui Wang, Long Zhou, Chengyi Wang, Shuo Ren, Yu Wu, Shujie Liu, Tom Ko, Qing Li, Yu Zhang, Zhihua Wei, Yao Qian, Jinyu Li, Furu Wei. - **Shared by [optional]:** [Matthijs Hollemans](https://huggingface.co/Matthijs) - **Model type:** text-to-speech - **Language(s) (NLP):** [More Information Needed] - **License:** [MIT](https://github.com/microsoft/SpeechT5/blob/main/LICENSE) - **Finetuned from model [optional]:** [More Information Needed] ## Model Sources [optional] <!-- Provide the basic links for the model. --> - **Repository:** [https://github.com/microsoft/SpeechT5/] - **Paper:** [https://arxiv.org/pdf/2110.07205.pdf] - **Blog Post:** [https://huggingface.co/blog/speecht5] - **Demo:** [https://huggingface.co/spaces/Matthijs/speecht5-tts-demo] # Uses <!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. --> ## 🤗 Transformers Usage You can run SpeechT5 TTS locally with the 🤗 Transformers library. 1. First install the 🤗 [Transformers library](https://github.com/huggingface/transformers), sentencepiece, soundfile and datasets(optional): ``` pip install --upgrade pip pip install --upgrade transformers sentencepiece datasets[audio] ``` 2. Run inference via the `Text-to-Speech` (TTS) pipeline. You can access the SpeechT5 model via the TTS pipeline in just a few lines of code! ```python from transformers import pipeline from datasets import load_dataset import soundfile as sf synthesiser = pipeline("text-to-speech", "microsoft/speecht5_tts") embeddings_dataset = load_dataset("Matthijs/cmu-arctic-xvectors", split="validation") speaker_embedding = torch.tensor(embeddings_dataset[7306]["xvector"]).unsqueeze(0) # You can replace this embedding with your own as well. speech = synthesiser("Hello, my dog is cooler than you!", forward_params={"speaker_embeddings": speaker_embedding}) sf.write("speech.wav", speech["audio"], samplerate=speech["sampling_rate"]) ``` 3. Run inference via the Transformers modelling code - You can use the processor + generate code to convert text into a mono 16 kHz speech waveform for more fine-grained control. ```python from transformers import SpeechT5Processor, SpeechT5ForTextToSpeech, SpeechT5HifiGan from datasets import load_dataset import torch import soundfile as sf from datasets import load_dataset processor = SpeechT5Processor.from_pretrained("microsoft/speecht5_tts") model = SpeechT5ForTextToSpeech.from_pretrained("microsoft/speecht5_tts") vocoder = SpeechT5HifiGan.from_pretrained("microsoft/speecht5_hifigan") inputs = processor(text="Hello, my dog is cute.", return_tensors="pt") # load xvector containing speaker's voice characteristics from a dataset embeddings_dataset = load_dataset("Matthijs/cmu-arctic-xvectors", split="validation") speaker_embeddings = torch.tensor(embeddings_dataset[7306]["xvector"]).unsqueeze(0) speech = model.generate_speech(inputs["input_ids"], speaker_embeddings, vocoder=vocoder) sf.write("speech.wav", speech.numpy(), samplerate=16000) ``` ### Fine-tuning the Model Refer to [this Colab notebook](https://colab.research.google.com/drive/1i7I5pzBcU3WDFarDnzweIj4-sVVoIUFJ) for an example of how to fine-tune SpeechT5 for TTS on a different dataset or a new language. ## Direct Use <!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. --> You can use this model for speech synthesis. See the [model hub](https://huggingface.co/models?search=speecht5) to look for fine-tuned versions on a task that interests you. ## Downstream Use [optional] <!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app --> [More Information Needed] ## Out-of-Scope Use <!-- This section addresses misuse, malicious use, and uses that the model will not work well for. --> [More Information Needed] # Bias, Risks, and Limitations <!-- This section is meant to convey both technical and sociotechnical limitations. --> [More Information Needed] ## Recommendations <!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. --> Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations. # Training Details ## Training Data <!-- This should link to a Data Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. --> LibriTTS ## Training Procedure <!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. --> ### Preprocessing [optional] Leveraging large-scale unlabeled speech and text data, we pre-train SpeechT5 to learn a unified-modal representation, hoping to improve the modeling capability for both speech and text. ### Training hyperparameters - **Precision:** [More Information Needed] <!--fp16, bf16, fp8, fp32 --> - **Regime:** [More Information Needed] <!--mixed precision or not --> ### Speeds, Sizes, Times [optional] <!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. --> [More Information Needed] # Evaluation <!-- This section describes the evaluation protocols and provides the results. --> ## Testing Data, Factors & Metrics ### Testing Data <!-- This should link to a Data Card if possible. --> [More Information Needed] ### Factors <!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. --> [More Information Needed] ### Metrics <!-- These are the evaluation metrics being used, ideally with a description of why. --> [More Information Needed] ## Results [More Information Needed] ### Summary # Model Examination [optional] <!-- Relevant interpretability work for the model goes here --> Extensive evaluations show the superiority of the proposed SpeechT5 framework on a wide variety of spoken language processing tasks, including automatic speech recognition, speech synthesis, speech translation, voice conversion, speech enhancement, and speaker identification. # Environmental Impact <!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly --> Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). - **Hardware Type:** [More Information Needed] - **Hours used:** [More Information Needed] - **Cloud Provider:** [More Information Needed] - **Compute Region:** [More Information Needed] - **Carbon Emitted:** [More Information Needed] # Technical Specifications [optional] ## Model Architecture and Objective The SpeechT5 framework consists of a shared encoder-decoder network and six modal-specific (speech/text) pre/post-nets. After preprocessing the input speech/text through the pre-nets, the shared encoder-decoder network models the sequence-to-sequence transformation, and then the post-nets generate the output in the speech/text modality based on the output of the decoder. ## Compute Infrastructure [More Information Needed] ### Hardware [More Information Needed] ### Software [More Information Needed] # Citation [optional] <!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. --> **BibTeX:** ```bibtex @inproceedings{ao-etal-2022-speecht5, title = {{S}peech{T}5: Unified-Modal Encoder-Decoder Pre-Training for Spoken Language Processing}, author = {Ao, Junyi and Wang, Rui and Zhou, Long and Wang, Chengyi and Ren, Shuo and Wu, Yu and Liu, Shujie and Ko, Tom and Li, Qing and Zhang, Yu and Wei, Zhihua and Qian, Yao and Li, Jinyu and Wei, Furu}, booktitle = {Proceedings of the 60th Annual Meeting of the Association for Computational Linguistics (Volume 1: Long Papers)}, month = {May}, year = {2022}, pages={5723--5738}, } ``` # Glossary [optional] <!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. --> - **text-to-speech** to synthesize audio # More Information [optional] [More Information Needed] # Model Card Authors [optional] Disclaimer: The team releasing SpeechT5 did not write a model card for this model so this model card has been written by the Hugging Face team. # Model Card Contact [More Information Needed]

timm/swinv2_tiny_window8_256.ms_in1k

timm

timm

image-classification

--- license: mit library_name: timm tags: - image-classification - timm datasets: - imagenet-1k --- # Model card for swinv2_tiny_window8_256.ms_in1k A Swin Transformer V2 image classification model. Pretrained on ImageNet-1k by paper authors. ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 28.3 - GMACs: 6.0 - Activations (M): 24.6 - Image size: 256 x 256 - **Papers:** - Swin Transformer V2: Scaling Up Capacity and Resolution: https://arxiv.org/abs/2111.09883 - **Original:** https://github.com/microsoft/Swin-Transformer - **Dataset:** ImageNet-1k ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('swinv2_tiny_window8_256.ms_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Feature Map Extraction ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'swinv2_tiny_window8_256.ms_in1k', pretrained=True, features_only=True, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 for o in output: # print shape of each feature map in output # e.g. for swin_base_patch4_window7_224 (NHWC output) # torch.Size([1, 56, 56, 128]) # torch.Size([1, 28, 28, 256]) # torch.Size([1, 14, 14, 512]) # torch.Size([1, 7, 7, 1024]) # e.g. for swinv2_cr_small_ns_224 (NCHW output) # torch.Size([1, 96, 56, 56]) # torch.Size([1, 192, 28, 28]) # torch.Size([1, 384, 14, 14]) # torch.Size([1, 768, 7, 7]) print(o.shape) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'swinv2_tiny_window8_256.ms_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled (ie.e a (batch_size, H, W, num_features) tensor for swin / swinv2 # or (batch_size, num_features, H, W) for swinv2_cr output = model.forward_head(output, pre_logits=True) # output is (batch_size, num_features) tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). ## Citation ```bibtex @inproceedings{liu2021swinv2, title={Swin Transformer V2: Scaling Up Capacity and Resolution}, author={Ze Liu and Han Hu and Yutong Lin and Zhuliang Yao and Zhenda Xie and Yixuan Wei and Jia Ning and Yue Cao and Zheng Zhang and Li Dong and Furu Wei and Baining Guo}, booktitle={International Conference on Computer Vision and Pattern Recognition (CVPR)}, year={2022} } ``` ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ```

echarlaix/tiny-random-PhiForCausalLM

echarlaix

transformers

text-generation

--- license: apache-2.0 ---

michaelfeil/bge-small-en-v1.5

michaelfeil

sentence-transformers

feature-extraction

--- tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers license: mit language: - en --- <h1 align="center">Infinity Embedding Model</h1> This is the stable default model for infinity. ```bash pip install infinity_emb[all] ``` More details about the infinity inference project please refer to the Github: [Infinity](https://github.com/michaelfeil/infinity). ## Usage for Embedding Model via infinity in Python To deploy files with the [infinity_emb](https://github.com/michaelfeil/infinity) pip package. Recommended is `device="cuda", engine="torch"` with flash attention on gpu, and `device="cpu", engine="optimum"` for onnx inference. ```python import asyncio from infinity_emb import AsyncEmbeddingEngine, EngineArgs sentences = ["Embed this is sentence via Infinity.", "Paris is in France."] engine = AsyncEmbeddingEngine.from_args( EngineArgs( model_name_or_path = "michaelfeil/bge-small-en-v1.5", device="cuda", # or device="cpu" engine="torch", # or engine="optimum" compile=True # enable torch.compile )) async def main(): async with engine: embeddings, usage = await engine.embed(sentences=sentences) asyncio.run(main()) ``` ## CLI interface The same args ```bash pip install infinity_emb infinity_emb --model-name-or-path michaelfeil/bge-small-en-v1.5 --port 7997 ``` ## Contact If you have any question or suggestion related to this project, feel free to open an issue or pull request. You also can email Michael Feil (infinity at michaelfeil.eu). ## Citation If you find this repository useful, please consider giving a star :star: and citation ``` @software{Feil_Infinity_2023, author = {Feil, Michael}, month = oct, title = {{Infinity - To Embeddings and Beyond}}, url = {https://github.com/michaelfeil/infinity}, year = {2023} } ``` ## License Infinity is licensed under the [MIT License](https://github.com/michaelfeil/infinity/blob/master/LICENSE).

Systran/faster-whisper-small.en

Systran

ctranslate2

automatic-speech-recognition

--- language: - en tags: - audio - automatic-speech-recognition license: mit library_name: ctranslate2 --- # Whisper small.en model for CTranslate2 This repository contains the conversion of [openai/whisper-small.en](https://huggingface.co/openai/whisper-small.en) to the [CTranslate2](https://github.com/OpenNMT/CTranslate2) model format. This model can be used in CTranslate2 or projects based on CTranslate2 such as [faster-whisper](https://github.com/systran/faster-whisper). ## Example ```python from faster_whisper import WhisperModel model = WhisperModel("small.en") segments, info = model.transcribe("audio.mp3") for segment in segments: print("[%.2fs -> %.2fs] %s" % (segment.start, segment.end, segment.text)) ``` ## Conversion details The original model was converted with the following command: ``` ct2-transformers-converter --model openai/whisper-small.en --output_dir faster-whisper-small.en \ --copy_files tokenizer.json --quantization float16 ``` Note that the model weights are saved in FP16. This type can be changed when the model is loaded using the [`compute_type` option in CTranslate2](https://opennmt.net/CTranslate2/quantization.html). ## More information **For more information about the original model, see its [model card](https://huggingface.co/openai/whisper-small.en).**

sanchit-gandhi/whisper-medium-fleurs-lang-id

sanchit-gandhi

transformers

audio-classification

--- license: apache-2.0 tags: - audio-classification - generated_from_trainer datasets: - xtreme_s metrics: - accuracy base_model: openai/whisper-medium model-index: - name: whisper-medium-fleurs-lang-id results: [] --- <!-- This model card has been generated automatically according to the information the Trainer had access to. You should probably proofread and complete it, then remove this comment. --> # Whisper Medium FLEURS Language Identification This model is a fine-tuned version of [openai/whisper-medium](https://huggingface.co/openai/whisper-medium) on the [FLEURS subset](https://huggingface.co/datasets/google/xtreme_s#language-identification---fleurs-langid) of the [google/xtreme_s](https://huggingface.co/google/xtreme_s) dataset. It achieves the following results on the evaluation set: - Loss: 0.8413 - Accuracy: 0.8805 To reproduce this run, execute the command in [`run.sh`](https://huggingface.co/sanchit-gandhi/whisper-medium-fleurs-lang-id/blob/main/run.sh). ## Model description More information needed ## Intended uses & limitations More information needed ## Training and evaluation data More information needed ## Training procedure ### Training hyperparameters The following hyperparameters were used during training: - learning_rate: 3e-05 - train_batch_size: 16 - eval_batch_size: 32 - seed: 0 - distributed_type: multi-GPU - gradient_accumulation_steps: 2 - total_train_batch_size: 32 - optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 - lr_scheduler_type: linear - lr_scheduler_warmup_ratio: 0.1 - num_epochs: 3.0 ### Training results | Training Loss | Epoch | Step | Validation Loss | Accuracy | |:-------------:|:-----:|:-----:|:---------------:|:--------:| | 0.0152 | 1.0 | 8494 | 0.9087 | 0.8431 | | 0.0003 | 2.0 | 16988 | 1.0059 | 0.8460 | | 0.0 | 3.0 | 25482 | 0.8413 | 0.8805 | ### Framework versions - Transformers 4.27.0.dev0 - Pytorch 1.13.1 - Datasets 2.9.0 - Tokenizers 0.13.2

microsoft/kosmos-2-patch14-224

microsoft

transformers

image-to-text

--- pipeline_tag: image-to-text tags: - image-captioning languages: - en license: mit --- # Kosmos-2: Grounding Multimodal Large Language Models to the World <a href="https://huggingface.co/microsoft/kosmos-2-patch14-224/resolve/main/annotated_snowman.jpg" target="_blank"><figure><img src="https://huggingface.co/microsoft/kosmos-2-patch14-224/resolve/main/annotated_snowman.jpg" width="384"><figcaption><b>[An image of a snowman warming himself by a fire.]</b></figcaption></figure></a> This Hub repository contains a HuggingFace's `transformers` implementation of [the original Kosmos-2 model](https://github.com/microsoft/unilm/tree/master/kosmos-2) from Microsoft. ## How to Get Started with the Model Use the code below to get started with the model. ```python import requests from PIL import Image from transformers import AutoProcessor, AutoModelForVision2Seq model = AutoModelForVision2Seq.from_pretrained("microsoft/kosmos-2-patch14-224") processor = AutoProcessor.from_pretrained("microsoft/kosmos-2-patch14-224") prompt = "<grounding>An image of" url = "https://huggingface.co/microsoft/kosmos-2-patch14-224/resolve/main/snowman.png" image = Image.open(requests.get(url, stream=True).raw) # The original Kosmos-2 demo saves the image first then reload it. For some images, this will give slightly different image input and change the generation outputs. image.save("new_image.jpg") image = Image.open("new_image.jpg") inputs = processor(text=prompt, images=image, return_tensors="pt") generated_ids = model.generate( pixel_values=inputs["pixel_values"], input_ids=inputs["input_ids"], attention_mask=inputs["attention_mask"], image_embeds=None, image_embeds_position_mask=inputs["image_embeds_position_mask"], use_cache=True, max_new_tokens=128, ) generated_text = processor.batch_decode(generated_ids, skip_special_tokens=True)[0] # Specify `cleanup_and_extract=False` in order to see the raw model generation. processed_text = processor.post_process_generation(generated_text, cleanup_and_extract=False) print(processed_text) # `<grounding> An image of<phrase> a snowman</phrase><object><patch_index_0044><patch_index_0863></object> warming himself by<phrase> a fire</phrase><object><patch_index_0005><patch_index_0911></object>.` # By default, the generated text is cleanup and the entities are extracted. processed_text, entities = processor.post_process_generation(generated_text) print(processed_text) # `An image of a snowman warming himself by a fire.` print(entities) # `[('a snowman', (12, 21), [(0.390625, 0.046875, 0.984375, 0.828125)]), ('a fire', (41, 47), [(0.171875, 0.015625, 0.484375, 0.890625)])]` ``` ## Tasks This model is capable of performing different tasks through changing the prompts. First, let's define a function to run a prompt. <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import AutoProcessor, AutoModelForVision2Seq model = AutoModelForVision2Seq.from_pretrained("microsoft/kosmos-2-patch14-224") processor = AutoProcessor.from_pretrained("microsoft/kosmos-2-patch14-224") url = "https://huggingface.co/microsoft/kosmos-2-patch14-224/resolve/main/snowman.png" image = Image.open(requests.get(url, stream=True).raw) def run_example(prompt): inputs = processor(text=prompt, images=image, return_tensors="pt") generated_ids = model.generate( pixel_values=inputs["pixel_values"], input_ids=inputs["input_ids"], attention_mask=inputs["attention_mask"], image_embeds=None, image_embeds_position_mask=inputs["image_embeds_position_mask"], use_cache=True, max_new_tokens=128, ) generated_text = processor.batch_decode(generated_ids, skip_special_tokens=True)[0] _processed_text = processor.post_process_generation(generated_text, cleanup_and_extract=False) processed_text, entities = processor.post_process_generation(generated_text) print(processed_text) print(entities) print(_processed_text) ``` </details> Here are the tasks `Kosmos-2` could perform: <details> <summary> Click to expand </summary> ### Multimodal Grounding #### • Phrase Grounding ```python prompt = "<grounding><phrase> a snowman</phrase>" run_example(prompt) # a snowman is warming himself by the fire # [('a snowman', (0, 9), [(0.390625, 0.046875, 0.984375, 0.828125)]), ('the fire', (32, 40), [(0.203125, 0.015625, 0.453125, 0.859375)])] # <grounding><phrase> a snowman</phrase><object><patch_index_0044><patch_index_0863></object> is warming himself by<phrase> the fire</phrase><object><patch_index_0006><patch_index_0878></object> ``` #### • Referring Expression Comprehension ```python prompt = "<grounding><phrase> a snowman next to a fire</phrase>" run_example(prompt) # a snowman next to a fire # [('a snowman next to a fire', (0, 24), [(0.390625, 0.046875, 0.984375, 0.828125)])] # <grounding><phrase> a snowman next to a fire</phrase><object><patch_index_0044><patch_index_0863></object> ``` ### Multimodal Referring #### • Referring expression generation ```python prompt = "<grounding><phrase> It</phrase><object><patch_index_0044><patch_index_0863></object> is" run_example(prompt) # It is snowman in a hat and scarf # [('It', (0, 2), [(0.390625, 0.046875, 0.984375, 0.828125)])] # <grounding><phrase> It</phrase><object><patch_index_0044><patch_index_0863></object> is snowman in a hat and scarf ``` ### Perception-Language Tasks #### • Grounded VQA ```python prompt = "<grounding> Question: What is special about this image? Answer:" run_example(prompt) # Question: What is special about this image? Answer: The image features a snowman sitting by a campfire in the snow. # [('a snowman', (71, 80), [(0.390625, 0.046875, 0.984375, 0.828125)]), ('a campfire', (92, 102), [(0.109375, 0.640625, 0.546875, 0.984375)])] # <grounding> Question: What is special about this image? Answer: The image features<phrase> a snowman</phrase><object><patch_index_0044><patch_index_0863></object> sitting by<phrase> a campfire</phrase><object><patch_index_0643><patch_index_1009></object> in the snow. ``` #### • Grounded VQA with multimodal referring via bounding boxes ```python prompt = "<grounding> Question: Where is<phrase> the fire</phrase><object><patch_index_0005><patch_index_0911></object> next to? Answer:" run_example(prompt) # Question: Where is the fire next to? Answer: Near the snowman. # [('the fire', (19, 27), [(0.171875, 0.015625, 0.484375, 0.890625)]), ('the snowman', (50, 61), [(0.390625, 0.046875, 0.984375, 0.828125)])] # <grounding> Question: Where is<phrase> the fire</phrase><object><patch_index_0005><patch_index_0911></object> next to? Answer: Near<phrase> the snowman</phrase><object><patch_index_0044><patch_index_0863></object>. ``` ### Grounded Image captioning #### • Brief ```python prompt = "<grounding> An image of" run_example(prompt) # An image of a snowman warming himself by a campfire. # [('a snowman', (12, 21), [(0.390625, 0.046875, 0.984375, 0.828125)]), ('a campfire', (41, 51), [(0.109375, 0.640625, 0.546875, 0.984375)])] # <grounding> An image of<phrase> a snowman</phrase><object><patch_index_0044><patch_index_0863></object> warming himself by<phrase> a campfire</phrase><object><patch_index_0643><patch_index_1009></object>. ``` #### • Detailed ```python prompt = "<grounding> Describe this image in detail:" run_example(prompt) # Describe this image in detail: The image features a snowman sitting by a campfire in the snow. He is wearing a hat, scarf, and gloves, with a pot nearby and a cup nearby. The snowman appears to be enjoying the warmth of the fire, and it appears to have a warm and cozy atmosphere. # [('a campfire', (71, 81), [(0.171875, 0.015625, 0.484375, 0.984375)]), ('a hat', (109, 114), [(0.515625, 0.046875, 0.828125, 0.234375)]), ('scarf', (116, 121), [(0.515625, 0.234375, 0.890625, 0.578125)]), ('gloves', (127, 133), [(0.515625, 0.390625, 0.640625, 0.515625)]), ('a pot', (140, 145), [(0.078125, 0.609375, 0.265625, 0.859375)]), ('a cup', (157, 162), [(0.890625, 0.765625, 0.984375, 0.984375)])] # <grounding> Describe this image in detail: The image features a snowman sitting by<phrase> a campfire</phrase><object><patch_index_0005><patch_index_1007></object> in the snow. He is wearing<phrase> a hat</phrase><object><patch_index_0048><patch_index_0250></object>,<phrase> scarf</phrase><object><patch_index_0240><patch_index_0604></object>, and<phrase> gloves</phrase><object><patch_index_0400><patch_index_0532></object>, with<phrase> a pot</phrase><object><patch_index_0610><patch_index_0872></object> nearby and<phrase> a cup</phrase><object><patch_index_0796><patch_index_1023></object> nearby. The snowman appears to be enjoying the warmth of the fire, and it appears to have a warm and cozy atmosphere. ``` </details> ## Draw the bounding bboxes of the entities on the image Once you have the `entities`, you can use the following helper function to draw their bounding bboxes on the image: <details> <summary> Click to expand </summary> ```python import cv2 import numpy as np import os import requests import torch import torchvision.transforms as T from PIL import Image def is_overlapping(rect1, rect2): x1, y1, x2, y2 = rect1 x3, y3, x4, y4 = rect2 return not (x2 < x3 or x1 > x4 or y2 < y3 or y1 > y4) def draw_entity_boxes_on_image(image, entities, show=False, save_path=None): """_summary_ Args: image (_type_): image or image path collect_entity_location (_type_): _description_ """ if isinstance(image, Image.Image): image_h = image.height image_w = image.width image = np.array(image)[:, :, [2, 1, 0]] elif isinstance(image, str): if os.path.exists(image): pil_img = Image.open(image).convert("RGB") image = np.array(pil_img)[:, :, [2, 1, 0]] image_h = pil_img.height image_w = pil_img.width else: raise ValueError(f"invaild image path, {image}") elif isinstance(image, torch.Tensor): image_tensor = image.cpu() reverse_norm_mean = torch.tensor([0.48145466, 0.4578275, 0.40821073])[:, None, None] reverse_norm_std = torch.tensor([0.26862954, 0.26130258, 0.27577711])[:, None, None] image_tensor = image_tensor * reverse_norm_std + reverse_norm_mean pil_img = T.ToPILImage()(image_tensor) image_h = pil_img.height image_w = pil_img.width image = np.array(pil_img)[:, :, [2, 1, 0]] else: raise ValueError(f"invaild image format, {type(image)} for {image}") if len(entities) == 0: return image new_image = image.copy() previous_bboxes = [] # size of text text_size = 1 # thickness of text text_line = 1 # int(max(1 * min(image_h, image_w) / 512, 1)) box_line = 3 (c_width, text_height), _ = cv2.getTextSize("F", cv2.FONT_HERSHEY_COMPLEX, text_size, text_line) base_height = int(text_height * 0.675) text_offset_original = text_height - base_height text_spaces = 3 for entity_name, (start, end), bboxes in entities: for (x1_norm, y1_norm, x2_norm, y2_norm) in bboxes: orig_x1, orig_y1, orig_x2, orig_y2 = int(x1_norm * image_w), int(y1_norm * image_h), int(x2_norm * image_w), int(y2_norm * image_h) # draw bbox # random color color = tuple(np.random.randint(0, 255, size=3).tolist()) new_image = cv2.rectangle(new_image, (orig_x1, orig_y1), (orig_x2, orig_y2), color, box_line) l_o, r_o = box_line // 2 + box_line % 2, box_line // 2 + box_line % 2 + 1 x1 = orig_x1 - l_o y1 = orig_y1 - l_o if y1 < text_height + text_offset_original + 2 * text_spaces: y1 = orig_y1 + r_o + text_height + text_offset_original + 2 * text_spaces x1 = orig_x1 + r_o # add text background (text_width, text_height), _ = cv2.getTextSize(f" {entity_name}", cv2.FONT_HERSHEY_COMPLEX, text_size, text_line) text_bg_x1, text_bg_y1, text_bg_x2, text_bg_y2 = x1, y1 - (text_height + text_offset_original + 2 * text_spaces), x1 + text_width, y1 for prev_bbox in previous_bboxes: while is_overlapping((text_bg_x1, text_bg_y1, text_bg_x2, text_bg_y2), prev_bbox): text_bg_y1 += (text_height + text_offset_original + 2 * text_spaces) text_bg_y2 += (text_height + text_offset_original + 2 * text_spaces) y1 += (text_height + text_offset_original + 2 * text_spaces) if text_bg_y2 >= image_h: text_bg_y1 = max(0, image_h - (text_height + text_offset_original + 2 * text_spaces)) text_bg_y2 = image_h y1 = image_h break alpha = 0.5 for i in range(text_bg_y1, text_bg_y2): for j in range(text_bg_x1, text_bg_x2): if i < image_h and j < image_w: if j < text_bg_x1 + 1.35 * c_width: # original color bg_color = color else: # white bg_color = [255, 255, 255] new_image[i, j] = (alpha * new_image[i, j] + (1 - alpha) * np.array(bg_color)).astype(np.uint8) cv2.putText( new_image, f" {entity_name}", (x1, y1 - text_offset_original - 1 * text_spaces), cv2.FONT_HERSHEY_COMPLEX, text_size, (0, 0, 0), text_line, cv2.LINE_AA ) # previous_locations.append((x1, y1)) previous_bboxes.append((text_bg_x1, text_bg_y1, text_bg_x2, text_bg_y2)) pil_image = Image.fromarray(new_image[:, :, [2, 1, 0]]) if save_path: pil_image.save(save_path) if show: pil_image.show() return new_image # (The same image from the previous code example) url = "https://huggingface.co/microsoft/kosmos-2-patch14-224/resolve/main/snowman.png" image = Image.open(requests.get(url, stream=True).raw) # From the previous code example entities = [('a snowman', (12, 21), [(0.390625, 0.046875, 0.984375, 0.828125)]), ('a fire', (41, 47), [(0.171875, 0.015625, 0.484375, 0.890625)])] # Draw the bounding bboxes draw_entity_boxes_on_image(image, entities, show=True) ``` </details> Here is the annotated image: <a href="https://huggingface.co/microsoft/kosmos-2-patch14-224/resolve/main/annotated_snowman.jpg" target="_blank"><img src="https://huggingface.co/microsoft/kosmos-2-patch14-224/resolve/main/annotated_snowman.jpg" width="500"></a> ## BibTex and citation info ``` @article{kosmos-2, title={Kosmos-2: Grounding Multimodal Large Language Models to the World}, author={Zhiliang Peng and Wenhui Wang and Li Dong and Yaru Hao and Shaohan Huang and Shuming Ma and Furu Wei}, journal={ArXiv}, year={2023}, volume={abs/2306} } @article{kosmos-1, title={Language Is Not All You Need: Aligning Perception with Language Models}, author={Shaohan Huang and Li Dong and Wenhui Wang and Yaru Hao and Saksham Singhal and Shuming Ma and Tengchao Lv and Lei Cui and Owais Khan Mohammed and Qiang Liu and Kriti Aggarwal and Zewen Chi and Johan Bjorck and Vishrav Chaudhary and Subhojit Som and Xia Song and Furu Wei}, journal={ArXiv}, year={2023}, volume={abs/2302.14045} } @article{metalm, title={Language Models are General-Purpose Interfaces}, author={Yaru Hao and Haoyu Song and Li Dong and Shaohan Huang and Zewen Chi and Wenhui Wang and Shuming Ma and Furu Wei}, journal={ArXiv}, year={2022}, volume={abs/2206.06336} } ```

ufal/robeczech-base

ufal

transformers

fill-mask

--- language: cs license: cc-by-nc-sa-4.0 tags: - RobeCzech - Czech - RoBERTa - ÚFAL --- # Model Card for RobeCzech ## Version History - **version 1.1**: Version 1.1 was released in Jan 2024, with a change to the tokenizer described below; the model parameters were mostly kept the same, but (a) the embeddings were enlarged (by copying suitable rows) to correspond to the updated tokenizer, (b) the pooler was dropped (originally it was only randomly initialized). The tokenizer in the initial release (a) contained a hole (51959 did not correspond to any token), and (b) mapped several tokens (unseen during training but required by the BBPE tokenizer) to the same ID as the `[UNK]` token (3). That sometimes caused problems, as in https://huggingface.co/ufal/robeczech-base/discussions/4. See https://huggingface.co/ufal/robeczech-base/discussions/4#64b8f6a7f1f8e6ea5860b314 for more information. In version 1.1, the tokenizer was modified by (a) removing the hole, (b) mapping all tokens to a unique ID. That also required increasing the vocabulary size and embeddings weights (by replicating the embedding of the `[UNK]` token). Without finetuning, version 1.1 and version 1.0 gives exactly the same embeddings on any input (apart from the pooler missing in v1.1), and the tokens in version 1.0 that mapped to a different ID than the `[UNK]` token map to the same ID in version 1.1. However, the sizes of the embeddings (and LM head weights and biases) are different, so the weights of the version 1.1 are not compatible with the configuration of version 1.0 and vice versa. - **version 1.0**: Initial version released in May 2021 (with the tokenization issues described above). If you want to load a pretrained model, configuration, or a tokenizer of version 1.0, you can use ```python from_pretrained("ufal/robeczech-base", revision="v1.0") ``` to create an `AutoModel`, an `AutoConfig`, or an `AutoTokenizer`. # Model Details ## Model Description RobeCzech is a monolingual RoBERTa language representation model trained on Czech data. - **Developed by:** Institute of Formal and Applied Linguistics, Charles University, Prague (UFAL) - **Shared by:** Hugging Face and [LINDAT/CLARIAH-CZ](https://hdl.handle.net/11234/1-3691) - **Model type:** Fill-Mask - **Language(s) (NLP):** cs - **License:** cc-by-nc-sa-4.0 - **Model Architecture:** RoBERTa - **Resources for more information:** - [RobeCzech: Czech RoBERTa, a Monolingual Contextualized Language Representation Model](https://doi.org/10.1007/978-3-030-83527-9_17) - [arXiv preprint is also available](https://arxiv.org/abs/2105.11314) # Uses ## Direct Use Fill-Mask tasks. ## Downstream Use Morphological tagging and lemmatization, dependency parsing, named entity recognition, and semantic parsing. # Bias, Risks, and Limitations Significant research has explored bias and fairness issues with language models (see, e.g., [Sheng et al. (2021)](https://aclanthology.org/2021.acl-long.330.pdf) and [Bender et al. (2021)](https://dl.acm.org/doi/pdf/10.1145/3442188.3445922)). Predictions generated by the model may include disturbing and harmful stereotypes across protected classes; identity characteristics; and sensitive, social, and occupational groups. ## Recommendations Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations. # Training Details ## Training Data The model creators note in the [associated paper](https://arxiv.org/pdf/2105.11314.pdf): > We trained RobeCzech on a collection of the following publicly available texts: > - SYN v4, a large corpus of contemporary written Czech, 4,188M tokens; > - Czes, a collection of Czech newspaper and magazine articles, 432M tokens; > - documents with at least 400 tokens from the Czech part of the web corpus.W2C , tokenized with MorphoDiTa, 16M tokens; > - plain texts extracted from Czech Wikipedia dump 20201020 using WikiEx-tractor, tokenized with MorphoDiTa, 123M tokens > All these corpora contain whole documents, even if the SYN v4 is > block-shuffled (blocks with at most 100 words respecting sentence boundaries > are permuted in a document) and in total contain 4,917M tokens. ## Training Procedure ### Preprocessing The texts are tokenized into subwords with a byte-level BPE (BBPE) tokenizer, which was trained on the entire corpus and we limit its vocabulary size to 52,000 items. ### Speeds, Sizes, Times The model creators note in the [associated paper](https://arxiv.org/pdf/2105.11314.pdf): > The training batch size is 8,192 and each training batch consists of sentences > sampled contiguously, even across document boundaries, such that the total > length of each sample is at most 512 tokens (FULL-SENTENCES setting). We use > Adam optimizer with β1 = 0.9 and β2 = 0.98 to minimize the masked > language-modeling objective. ### Software Used The [Fairseq](https://github.com/facebookresearch/fairseq/tree/main/examples/roberta) implementation was used for training. # Evaluation ## Testing Data, Factors & Metrics ### Testing Data The model creators note in the [associated paper](https://arxiv.org/pdf/2105.11314.pdf): > We evaluate RobeCzech in five NLP tasks, three of them leveraging frozen > contextualized word embeddings, two approached with fine-tuning: > - morphological analysis and lemmatization: frozen contextualized word embeddings, > - dependency parsing: frozen contextualized word embeddings, > - named entity recognition: frozen contextualized word embeddings, > - semantic parsing: fine-tuned, > - sentiment analysis: fine-tuned. ## Results | Model | Morphosynt PDT3.5 (POS) (LAS) | Morphosynt UD2.3 (XPOS) (LAS) | NER CNEC1.1 (nested) (flat) | Semant. PTG (Avg) (F1) | |-----------|---------------------------------|--------------------------------|------------------------------|-------------------------| | RobeCzech | 98.50 91.42 | 98.31 93.77 | 87.82 87.47 | 92.36 80.13 | # Environmental Impact - **Hardware Type:** 8 QUADRO P5000 GPU - **Hours used:** 2190 (~3 months) # Citation ``` @InProceedings{10.1007/978-3-030-83527-9_17, author={Straka, Milan and N{\'a}plava, Jakub and Strakov{\'a}, Jana and Samuel, David}, editor={Ek{\v{s}}tein, Kamil and P{\'a}rtl, Franti{\v{s}}ek and Konop{\'i}k, Miloslav}, title={{RobeCzech: Czech RoBERTa, a Monolingual Contextualized Language Representation Model}}, booktitle="Text, Speech, and Dialogue", year="2021", publisher="Springer International Publishing", address="Cham", pages="197--209", isbn="978-3-030-83527-9" } ``` # How to Get Started with the Model Use the code below to get started with the model. <details> <summary> Click to expand </summary> ```python from transformers import AutoTokenizer, AutoModelForMaskedLM tokenizer = AutoTokenizer.from_pretrained("ufal/robeczech-base") model = AutoModelForMaskedLM.from_pretrained("ufal/robeczech-base") ``` </details>

DeepMount00/Llama-3-8b-Ita

DeepMount00

transformers

text-generation

--- language: - it - en license: llama3 library_name: transformers base_model: meta-llama/Meta-Llama-3-8B datasets: - DeepMount00/llm_ita_ultra model-index: - name: Llama-3-8b-Ita results: - task: type: text-generation name: Text Generation dataset: name: IFEval (0-Shot) type: HuggingFaceH4/ifeval args: num_few_shot: 0 metrics: - type: inst_level_strict_acc and prompt_level_strict_acc value: 75.3 name: strict accuracy source: url: https://huggingface.co/spaces/open-llm-leaderboard/open_llm_leaderboard?query=DeepMount00/Llama-3-8b-Ita name: Open LLM Leaderboard - task: type: text-generation name: Text Generation dataset: name: BBH (3-Shot) type: BBH args: num_few_shot: 3 metrics: - type: acc_norm value: 28.08 name: normalized accuracy source: url: https://huggingface.co/spaces/open-llm-leaderboard/open_llm_leaderboard?query=DeepMount00/Llama-3-8b-Ita name: Open LLM Leaderboard - task: type: text-generation name: Text Generation dataset: name: MATH Lvl 5 (4-Shot) type: hendrycks/competition_math args: num_few_shot: 4 metrics: - type: exact_match value: 5.36 name: exact match source: url: https://huggingface.co/spaces/open-llm-leaderboard/open_llm_leaderboard?query=DeepMount00/Llama-3-8b-Ita name: Open LLM Leaderboard - task: type: text-generation name: Text Generation dataset: name: GPQA (0-shot) type: Idavidrein/gpqa args: num_few_shot: 0 metrics: - type: acc_norm value: 7.38 name: acc_norm source: url: https://huggingface.co/spaces/open-llm-leaderboard/open_llm_leaderboard?query=DeepMount00/Llama-3-8b-Ita name: Open LLM Leaderboard - task: type: text-generation name: Text Generation dataset: name: MuSR (0-shot) type: TAUR-Lab/MuSR args: num_few_shot: 0 metrics: - type: acc_norm value: 11.68 name: acc_norm source: url: https://huggingface.co/spaces/open-llm-leaderboard/open_llm_leaderboard?query=DeepMount00/Llama-3-8b-Ita name: Open LLM Leaderboard - task: type: text-generation name: Text Generation dataset: name: MMLU-PRO (5-shot) type: TIGER-Lab/MMLU-Pro config: main split: test args: num_few_shot: 5 metrics: - type: acc value: 31.69 name: accuracy source: url: https://huggingface.co/spaces/open-llm-leaderboard/open_llm_leaderboard?query=DeepMount00/Llama-3-8b-Ita name: Open LLM Leaderboard --- ## Model Architecture - **Base Model:** [Meta-Llama-3-8B](https://huggingface.co/meta-llama/Meta-Llama-3-8B) - **Specialization:** Italian Language ## Evaluation For a detailed comparison of model performance, check out the [Leaderboard for Italian Language Models](https://huggingface.co/spaces/FinancialSupport/open_ita_llm_leaderboard). Here's a breakdown of the performance metrics: | Metric | hellaswag_it acc_norm | arc_it acc_norm | m_mmlu_it 5-shot acc | Average | |:----------------------------|:----------------------|:----------------|:---------------------|:--------| | **Accuracy Normalized** | 0.6518 | 0.5441 | 0.5729 | 0.5896 | --- ## How to Use ```python from transformers import AutoModelForCausalLM, AutoTokenizer import torch device = torch.device("cuda" if torch.cuda.is_available() else "cpu") MODEL_NAME = "DeepMount00/Llama-3-8b-Ita" model = AutoModelForCausalLM.from_pretrained(MODEL_NAME, torch_dtype=torch.bfloat16).eval() model.to(device) tokenizer = AutoTokenizer.from_pretrained(MODEL_NAME) def generate_answer(prompt): messages = [ {"role": "user", "content": prompt}, ] model_inputs = tokenizer.apply_chat_template(messages, return_tensors="pt").to(device) generated_ids = model.generate(model_inputs, max_new_tokens=200, do_sample=True, temperature=0.001) decoded = tokenizer.batch_decode(generated_ids, skip_special_tokens=True) return decoded[0] prompt = "Come si apre un file json in python?" answer = generate_answer(prompt) print(answer) ``` --- ## Developer [Michele Montebovi] # [Open LLM Leaderboard Evaluation Results](https://huggingface.co/spaces/open-llm-leaderboard/open_llm_leaderboard) Detailed results can be found [here](https://huggingface.co/datasets/open-llm-leaderboard/details_DeepMount00__Llama-3-8b-Ita) | Metric |Value| |-------------------|----:| |Avg. |26.58| |IFEval (0-Shot) |75.30| |BBH (3-Shot) |28.08| |MATH Lvl 5 (4-Shot)| 5.36| |GPQA (0-shot) | 7.38| |MuSR (0-shot) |11.68| |MMLU-PRO (5-shot) |31.69|

sentence-transformers/msmarco-bert-base-dot-v5

sentence-transformers

sentence-transformers

sentence-similarity

--- language: - en library_name: sentence-transformers tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers pipeline_tag: sentence-similarity --- # msmarco-bert-base-dot-v5 This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 768 dimensional dense vector space and was designed for **semantic search**. It has been trained on 500K (query, answer) pairs from the [MS MARCO dataset](https://github.com/microsoft/MSMARCO-Passage-Ranking/). For an introduction to semantic search, have a look at: [SBERT.net - Semantic Search](https://www.sbert.net/examples/applications/semantic-search/README.html) ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer, util query = "How many people live in London?" docs = ["Around 9 Million people live in London", "London is known for its financial district"] #Load the model model = SentenceTransformer('sentence-transformers/msmarco-bert-base-dot-v5') #Encode query and documents query_emb = model.encode(query) doc_emb = model.encode(docs) #Compute dot score between query and all document embeddings scores = util.dot_score(query_emb, doc_emb)[0].cpu().tolist() #Combine docs & scores doc_score_pairs = list(zip(docs, scores)) #Sort by decreasing score doc_score_pairs = sorted(doc_score_pairs, key=lambda x: x[1], reverse=True) #Output passages & scores print("Query:", query) for doc, score in doc_score_pairs: print(score, doc) ``` ## Usage (HuggingFace Transformers) Without [sentence-transformers](https://www.SBERT.net), you can use the model like this: First, you pass your input through the transformer model, then you have to apply the correct pooling-operation on-top of the contextualized word embeddings. ```python from transformers import AutoTokenizer, AutoModel import torch #Mean Pooling - Take attention mask into account for correct averaging def mean_pooling(model_output, attention_mask): token_embeddings = model_output.last_hidden_state input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) #Encode text def encode(texts): # Tokenize sentences encoded_input = tokenizer(texts, padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input, return_dict=True) # Perform pooling embeddings = mean_pooling(model_output, encoded_input['attention_mask']) return embeddings # Sentences we want sentence embeddings for query = "How many people live in London?" docs = ["Around 9 Million people live in London", "London is known for its financial district"] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained("sentence-transformers/msmarco-bert-base-dot-v5") model = AutoModel.from_pretrained("sentence-transformers/msmarco-bert-base-dot-v5") #Encode query and docs query_emb = encode(query) doc_emb = encode(docs) #Compute dot score between query and all document embeddings scores = torch.mm(query_emb, doc_emb.transpose(0, 1))[0].cpu().tolist() #Combine docs & scores doc_score_pairs = list(zip(docs, scores)) #Sort by decreasing score doc_score_pairs = sorted(doc_score_pairs, key=lambda x: x[1], reverse=True) #Output passages & scores print("Query:", query) for doc, score in doc_score_pairs: print(score, doc) ``` ## Technical Details In the following some technical details how this model must be used: | Setting | Value | | --- | :---: | | Dimensions | 768 | | Max Sequence Length | 512 | | Produces normalized embeddings | No | | Pooling-Method | Mean pooling | | Suitable score functions | dot-product (e.g. `util.dot_score`) | ## Evaluation Results <!--- Describe how your model was evaluated --> For an automated evaluation of this model, see the *Sentence Embeddings Benchmark*: [https://seb.sbert.net](https://seb.sbert.net?model_name=msmarco-bert-base-base-dot-v5) ## Training See `train_script.py` in this repository for the used training script. The model was trained with the parameters: **DataLoader**: `torch.utils.data.dataloader.DataLoader` of length 7858 with parameters: ``` {'batch_size': 64, 'sampler': 'torch.utils.data.sampler.RandomSampler', 'batch_sampler': 'torch.utils.data.sampler.BatchSampler'} ``` **Loss**: `sentence_transformers.losses.MarginMSELoss.MarginMSELoss` Parameters of the fit()-Method: ``` { "callback": null, "epochs": 30, "evaluation_steps": 0, "evaluator": "NoneType", "max_grad_norm": 1, "optimizer_class": "<class 'transformers.optimization.AdamW'>", "optimizer_params": { "lr": 1e-05 }, "scheduler": "WarmupLinear", "steps_per_epoch": null, "warmup_steps": 10000, "weight_decay": 0.01 } ``` ## Full Model Architecture ``` SentenceTransformer( (0): Transformer({'max_seq_length': 512, 'do_lower_case': False}) with Transformer model: bert-base-uncased (1): Pooling({'word_embedding_dimension': 768, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False}) ) ``` ## Citing & Authors This model was trained by [sentence-transformers](https://www.sbert.net/). If you find this model helpful, feel free to cite our publication [Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks](https://arxiv.org/abs/1908.10084): ```bibtex @inproceedings{reimers-2019-sentence-bert, title = "Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks", author = "Reimers, Nils and Gurevych, Iryna", booktitle = "Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing", month = "11", year = "2019", publisher = "Association for Computational Linguistics", url = "http://arxiv.org/abs/1908.10084", } ```

digiplay/AnalogMadness-realistic-model-v7

digiplay

diffusers

text-to-image

--- license: other tags: - stable-diffusion - stable-diffusion-diffusers - text-to-image - diffusers inference: true --- Model info : https://civitai.com/models/8030/analog-madness-realistic-model

google/vivit-b-16x2-kinetics400

google

transformers

video-classification

--- license: "mit" tags: - vision - video-classification --- # ViViT (Video Vision Transformer) ViViT model as introduced in the paper [ViViT: A Video Vision Transformer](https://arxiv.org/abs/2103.15691) by Arnab et al. and first released in [this repository](https://github.com/google-research/scenic/tree/main/scenic/projects/vivit). Disclaimer: The team releasing ViViT did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description ViViT is an extension of the [Vision Transformer (ViT)](https://huggingface.co/docs/transformers/v4.27.0/model_doc/vit) to video. We refer to the paper for details. ## Intended uses & limitations The model is mostly meant to intended to be fine-tuned on a downstream task, like video classification. See the [model hub](https://huggingface.co/models?filter=vivit) to look for fine-tuned versions on a task that interests you. ### How to use For code examples, we refer to the [documentation](https://huggingface.co/transformers/main/model_doc/vivit). ### BibTeX entry and citation info ```bibtex @misc{arnab2021vivit, title={ViViT: A Video Vision Transformer}, author={Anurag Arnab and Mostafa Dehghani and Georg Heigold and Chen Sun and Mario Lučić and Cordelia Schmid}, year={2021}, eprint={2103.15691}, archivePrefix={arXiv}, primaryClass={cs.CV} } ```

tohoku-nlp/bert-base-japanese-char

tohoku-nlp

transformers

fill-mask

--- language: ja license: cc-by-sa-4.0 datasets: - wikipedia widget: - text: 仙台は「[MASK]の都」と呼ばれている。 --- # BERT base Japanese (character tokenization) This is a [BERT](https://github.com/google-research/bert) model pretrained on texts in the Japanese language. This version of the model processes input texts with word-level tokenization based on the IPA dictionary, followed by character-level tokenization. The codes for the pretraining are available at [cl-tohoku/bert-japanese](https://github.com/cl-tohoku/bert-japanese/tree/v1.0). ## Model architecture The model architecture is the same as the original BERT base model; 12 layers, 768 dimensions of hidden states, and 12 attention heads. ## Training Data The model is trained on Japanese Wikipedia as of September 1, 2019. To generate the training corpus, [WikiExtractor](https://github.com/attardi/wikiextractor) is used to extract plain texts from a dump file of Wikipedia articles. The text files used for the training are 2.6GB in size, consisting of approximately 17M sentences. ## Tokenization The texts are first tokenized by [MeCab](https://taku910.github.io/mecab/) morphological parser with the IPA dictionary and then split into characters. The vocabulary size is 4000. ## Training The model is trained with the same configuration as the original BERT; 512 tokens per instance, 256 instances per batch, and 1M training steps. ## Licenses The pretrained models are distributed under the terms of the [Creative Commons Attribution-ShareAlike 3.0](https://creativecommons.org/licenses/by-sa/3.0/). ## Acknowledgments For training models, we used Cloud TPUs provided by [TensorFlow Research Cloud](https://www.tensorflow.org/tfrc/) program.

llava-hf/LLaVA-NeXT-Video-7B-hf

llava-hf

transformers

video-text-to-text

--- language: - en license: llama2 pipeline_tag: video-text-to-text datasets: - lmms-lab/VideoChatGPT --- # LLaVA-NeXT-Video Model Card Check out also the Google Colab demo to run Llava on a free-tier Google Colab instance: [](https://colab.research.google.com/drive/1CZggLHrjxMReG-FNOmqSOdi4z7NPq6SO?usp=sharing) Disclaimer: The team releasing LLaVa-NeXT-Video did not write a model card for this model so this model card has been written by the Hugging Face team. ## 📄 Model details **Model type:** LLaVA-Next-Video is an open-source chatbot trained by fine-tuning LLM on multimodal instruction-following data. The model is buit on top of LLaVa-NeXT by tuning on a mix of video and image data to achieves better video understanding capabilities. The videos were sampled uniformly to be 32 frames per clip. The model is a current SOTA among open-source models on [VideoMME bench](https://arxiv.org/abs/2405.21075). Base LLM: [lmsys/vicuna-7b-v1.5](https://huggingface.co/lmsys/vicuna-13b-v1.5)  **Model date:** LLaVA-Next-Video-7B was trained in April 2024. **Paper or resources for more information:** https://github.com/LLaVA-VL/LLaVA-NeXT ## 📚 Training dataset ### Image - 558K filtered image-text pairs from LAION/CC/SBU, captioned by BLIP. - 158K GPT-generated multimodal instruction-following data. - 500K academic-task-oriented VQA data mixture. - 50K GPT-4V data mixture. - 40K ShareGPT data. ### Video - 100K VideoChatGPT-Instruct. ## 📊 Evaluation dataset A collection of 4 benchmarks, including 3 academic VQA benchmarks and 1 captioning benchmark. ## 🚀 How to use the model First, make sure to have `transformers >= 4.42.0`. The model supports multi-visual and multi-prompt generation. Meaning that you can pass multiple images/videos in your prompt. Make sure also to follow the correct prompt template (`USER: xxx\nASSISTANT:`) and add the token `<image>` or `<video>` to the location where you want to query images/videos: Below is an example script to run generation in `float16` precision on a GPU device: ```python import av import torch import numpy as np from huggingface_hub import hf_hub_download from transformers import LlavaNextVideoProcessor, LlavaNextVideoForConditionalGeneration model_id = "llava-hf/LLaVA-NeXT-Video-7B-hf" model = LlavaNextVideoForConditionalGeneration.from_pretrained( model_id, torch_dtype=torch.float16, low_cpu_mem_usage=True, ).to(0) processor = LlavaNextVideoProcessor.from_pretrained(model_id) def read_video_pyav(container, indices): ''' Decode the video with PyAV decoder. Args: container (`av.container.input.InputContainer`): PyAV container. indices (`List[int]`): List of frame indices to decode. Returns: result (np.ndarray): np array of decoded frames of shape (num_frames, height, width, 3). ''' frames = [] container.seek(0) start_index = indices[0] end_index = indices[-1] for i, frame in enumerate(container.decode(video=0)): if i > end_index: break if i >= start_index and i in indices: frames.append(frame) return np.stack([x.to_ndarray(format="rgb24") for x in frames]) # define a chat history and use `apply_chat_template` to get correctly formatted prompt # Each value in "content" has to be a list of dicts with types ("text", "image", "video") conversation = [ { "role": "user", "content": [ {"type": "text", "text": "Why is this video funny?"}, {"type": "video"}, ], }, ] prompt = processor.apply_chat_template(conversation, add_generation_prompt=True) video_path = hf_hub_download(repo_id="raushan-testing-hf/videos-test", filename="sample_demo_1.mp4", repo_type="dataset") container = av.open(video_path) # sample uniformly 8 frames from the video, can sample more for longer videos total_frames = container.streams.video[0].frames indices = np.arange(0, total_frames, total_frames / 8).astype(int) clip = read_video_pyav(container, indices) inputs_video = processor(text=prompt, videos=clip, padding=True, return_tensors="pt").to(model.device) output = model.generate(**inputs_video, max_new_tokens=100, do_sample=False) print(processor.decode(output[0][2:], skip_special_tokens=True)) ``` ### Inference with images as inputs To generate from images use the below code after loading the model as shown above: ```python import requests from PIL import Image conversation = [ { "role": "user", "content": [ {"type": "text", "text": "What are these?"}, {"type": "image"}, ], }, ] prompt = processor.apply_chat_template(conversation, add_generation_prompt=True) image_file = "http://images.cocodataset.org/val2017/000000039769.jpg" raw_image = Image.open(requests.get(image_file, stream=True).raw) inputs_image = processor(text=prompt, images=raw_image, return_tensors='pt').to(0, torch.float16) output = model.generate(**inputs_video, max_new_tokens=100, do_sample=False) print(processor.decode(output[0][2:], skip_special_tokens=True)) ``` ### Inference with images and videos as inputs To generate from images and videos in one generate use the below code after loading the model as shown above: ```python conversation_1 = [ { "role": "user", "content": [ {"type": "text", "text": "What's the content of the image>"}, {"type": "image"}, ], } ] conversation_2 = [ { "role": "user", "content": [ {"type": "text", "text": "Why is this video funny?"}, {"type": "video"}, ], }, ] prompt_1 = processor.apply_chat_template(conversation_1, add_generation_prompt=True) prompt_2 = processor.apply_chat_template(conversation_2, add_generation_prompt=True) s = processor(text=[prompt_1, prompt_2], images=image, videos=clip, padding=True, return_tensors="pt").to(model.device) # Generate generate_ids = model.generate(**inputs, max_new_tokens=100) out = processor.batch_decode(generate_ids, skip_special_tokens=True, clean_up_tokenization_spaces=False) print(out) ``` ### Model optimization #### 4-bit quantization through `bitsandbytes` library First make sure to install `bitsandbytes`, `pip install bitsandbytes` and make sure to have access to a CUDA compatible GPU device. Simply change the snippet above with: ```diff model = LlavaNextVideoForConditionalGeneration.from_pretrained( model_id, torch_dtype=torch.float16, low_cpu_mem_usage=True, + load_in_4bit=True ) ``` #### Use Flash-Attention 2 to further speed-up generation First make sure to install `flash-attn`. Refer to the [original repository of Flash Attention](https://github.com/Dao-AILab/flash-attention) regarding that package installation. Simply change the snippet above with: ```diff model = LlavaNextVideoForConditionalGeneration.from_pretrained( model_id, torch_dtype=torch.float16, low_cpu_mem_usage=True, + use_flash_attention_2=True ).to(0) ``` ## 🔒 License Llama 2 is licensed under the LLAMA 2 Community License, Copyright (c) Meta Platforms, Inc. All Rights Reserved. ## ✏️ Citation If you find our paper and code useful in your research: ```BibTeX @misc{zhang2024llavanextvideo, title={LLaVA-NeXT: A Strong Zero-shot Video Understanding Model}, url={https://llava-vl.github.io/blog/2024-04-30-llava-next-video/}, author={Zhang, Yuanhan and Li, Bo and Liu, haotian and Lee, Yong jae and Gui, Liangke and Fu, Di and Feng, Jiashi and Liu, Ziwei and Li, Chunyuan}, month={April}, year={2024} } ``` ```BibTeX @misc{liu2024llavanext, title={LLaVA-NeXT: Improved reasoning, OCR, and world knowledge}, url={https://llava-vl.github.io/blog/2024-01-30-llava-next/}, author={Liu, Haotian and Li, Chunyuan and Li, Yuheng and Li, Bo and Zhang, Yuanhan and Shen, Sheng and Lee, Yong Jae}, month={January}, year={2024} } ```

katuni4ka/tiny-random-qwen

katuni4ka

transformers

text-generation

Entry not found

microsoft/speecht5_hifigan

microsoft

transformers

--- license: mit tags: - audio --- # SpeechT5 HiFi-GAN Vocoder This is the HiFi-GAN vocoder for use with the SpeechT5 text-to-speech and voice conversion models. SpeechT5 was first released in [this repository](https://github.com/microsoft/SpeechT5/), [original weights](https://huggingface.co/mechanicalsea/speecht5-tts). The license used is [MIT](https://github.com/microsoft/SpeechT5/blob/main/LICENSE). Disclaimer: The team releasing SpeechT5 did not write a model card for this model so this model card has been written by the Hugging Face team. ## Citation **BibTeX:** ```bibtex @inproceedings{ao-etal-2022-speecht5, title = {{S}peech{T}5: Unified-Modal Encoder-Decoder Pre-Training for Spoken Language Processing}, author = {Ao, Junyi and Wang, Rui and Zhou, Long and Wang, Chengyi and Ren, Shuo and Wu, Yu and Liu, Shujie and Ko, Tom and Li, Qing and Zhang, Yu and Wei, Zhihua and Qian, Yao and Li, Jinyu and Wei, Furu}, booktitle = {Proceedings of the 60th Annual Meeting of the Association for Computational Linguistics (Volume 1: Long Papers)}, month = {May}, year = {2022}, pages={5723--5738}, } ```

klue/bert-base

klue

transformers

fill-mask

--- language: ko license: cc-by-sa-4.0 tags: - korean - klue mask_token: "[MASK]" widget: - text: 대한민국의 수도는 [MASK] 입니다. --- # KLUE BERT base ## Table of Contents - [Model Details](#model-details) - [How to Get Started With the Model](#how-to-get-started-with-the-model) - [Uses](#uses) - [Risks, Limitations and Biases](#risks-limitations-and-biases) - [Training](#training) - [Evaluation](#evaluation) - [Environmental Impact](#environmental-impact) - [Technical Specifications](#technical-specifications) - [Citation Information](#citation-information) - [Model Card Authors](#model-card-authors) ## Model Details **Model Description:** KLUE BERT base is a pre-trained BERT Model on Korean Language. The developers of KLUE BERT base developed the model in the context of the development of the [Korean Language Understanding Evaluation (KLUE) Benchmark](https://arxiv.org/pdf/2105.09680.pdf). - **Developed by:** See [GitHub Repo](https://github.com/facebookresearch/fairseq/tree/main/examples/roberta) for model developers - **Model Type:** Transformer-based language model - **Language(s):** Korean - **License:** cc-by-sa-4.0 - **Parent Model:** See the [BERT base uncased model](https://huggingface.co/bert-base-uncased) for more information about the BERT base model. - **Resources for more information:** - [Research Paper](https://arxiv.org/abs/2105.09680) - [GitHub Repo](https://github.com/KLUE-benchmark/KLUE) ## How to Get Started With the Model ```python from transformers import AutoModel, AutoTokenizer model = AutoModel.from_pretrained("klue/bert-base") tokenizer = AutoTokenizer.from_pretrained("klue/bert-base") ``` ## Uses #### Direct Use The model can be used for tasks including topic classification, semantic textual similarity, natural language inference, named entity recognition, and other tasks outlined in the [KLUE Benchmark](https://github.com/KLUE-benchmark/KLUE). #### Misuse and Out-of-scope Use The model should not be used to intentionally create hostile or alienating environments for people. In addition, the model was not trained to be factual or true representations of people or events, and therefore using the model to generate such content is out-of-scope for the abilities of this model. ## Risks, Limitations and Biases Significant research has explored bias and fairness issues with language models (see, e.g., [Sheng et al. (2021)](https://aclanthology.org/2021.acl-long.330.pdf) and [Bender et al. (2021)](https://dl.acm.org/doi/pdf/10.1145/3442188.3445922)). The model developers discuss several ethical considerations related to the model in the [paper](https://arxiv.org/pdf/2105.09680.pdf), including: - Bias issues with the publicly available data used in the pretraining corpora (and considerations related to filtering) - PII in the data used in the pretraining corpora (and efforts to pseudonymize the data) For ethical considerations related to the KLUE Benchmark, also see the [paper](https://arxiv.org/pdf/2105.09680.pdf). ## Training #### Training Data The authors use the following pretraining corpora for the model, described in the [associated paper](https://arxiv.org/pdf/2105.09680.pdf): > We gather the following five publicly available Korean corpora from diverse sources to cover a broad set of topics and many different styles. We combine these corpora to build the final pretraining corpus of size approximately 62GB. > > - **MODU:** [Modu Corpus](https://corpus.korean.go.kr) is a collection of Korean corpora distributed by [National Institute of Korean Languages](https://corpus.korean.go.kr/). It includes both formal articles (news and books) and colloquial text (dialogues). > - **CC-100-Kor:** [CC-100](https://data.statmt.org/cc-100/) is the large-scale multilingual web crawled corpora by using CC-Net ([Wenzek et al., 2020](https://www.aclweb.org/anthology/2020.lrec-1.494)). This is used for training XLM-R ([Conneau et al., 2020](https://aclanthology.org/2020.acl-main.747/)). We use the Korean portion from this corpora. > - **NAMUWIKI:** NAMUWIKI is a Korean web-based encyclopedia, similar to Wikipedia, but known to be less formal. Specifically, we download [the dump](http://dump.thewiki.kr) created on March 2nd, 2020. > - **NEWSCRAWL:** NEWSCRAWL consists of 12,800,000 news articles published from 2011 to 2020, collected from a news aggregation platform. > - **PETITION:** Petition is a collection of public petitions posted to the Blue House asking for administrative actions on social issues. We use the articles in the [Blue House National Petition](https://www1.president.go.kr/petitions) published from [August 2017 to March 2019](https://ko-nlp.github.io/Korpora/en-docs/corpuslist/korean_petitions.html). The authors also describe ethical considerations related to the pretraining corpora in the [associated paper](https://arxiv.org/pdf/2105.09680.pdf). #### Training Procedure ##### Preprocessing The authors describe their preprocessing procedure in the [associated paper](https://arxiv.org/pdf/2105.09680.pdf): > We filter noisy text and non-Korean text using the same methods from Section 2.3 (of the paper). Each document in the corpus is split into sentences using C++ implementation (v1.3.1.) of rule-based [Korean Sentence Splitter (KSS)](https://github.com/likejazz/korean-sentence-splitter). For CC-100-Kor and NEWSCRAWL, we keep sentences of length greater than equal to 200 characters, as a heuristics to keep well-formed sentences. We then remove sentences included in our benchmark task datasets, using BM25 as a sentence similarity metric ([reference](https://www.microsoft.com/en-us/research/publication/okapi-at-trec-3/)). ###### Tokenization The authors describe their tokenization procedure in the [associated paper](https://arxiv.org/pdf/2105.09680.pdf): > We design and use a new tokenization method, morpheme-based subword tokenization. When building a vocabulary, we pre-tokenize a raw text into morphemes using a morphological analyzer, and then we apply byte pair encoding (BPE) ([Senrich et al., 2016](https://aclanthology.org/P16-1162/)) to get the final vocabulary. For morpheme segmentation, we use [Mecab-ko](https://bitbucket.org/eunjeon/mecab-ko), MeCab ([Kudo, 2006](https://taku910.github.io/mecab/)) adapted for Korean, and for BPE segmentation, we use the wordpiece tokenizer from [Huggingface Tokenizers library](https://github.com/huggingface/tokenizers). We specify the vocabulary size to 32k. After building the vocabulary, we only use the BPE model during inference, which allows us to tokenize a word sequence by reflecting morphemes without a morphological analyzer. This improves both usability and speed. The training configurations are further described in the [paper](https://arxiv.org/pdf/2105.09680.pdf). ## Evaluation #### Testing Data, Factors and Metrics The model was evaluated on the [KLUE Benchmark](https://github.com/KLUE-benchmark/KLUE). The tasks and metrics from the KLUE Benchmark that were used to evaluate this model are described briefly below. For more information about the KLUE Benchmark, see the [data card](https://huggingface.co/datasets/klue), [Github Repository](https://github.com/KLUE-benchmark/KLUE), and [associated paper](https://arxiv.org/pdf/2105.09680.pdf). - **Task:** Topic Classification (TC) - Yonhap News Agency Topic Classification (YNAT), **Metrics:** Macro F1 score, defined as the mean of topic-wise F1 scores, giving the same importance to each topic. - **Task:** Semantic Textual Similarity (STS), **Metrics:** Pearsons' correlation coefficient (Pearson’ r) and F1 score - **Task:** Natural Language Inference (NLI), **Metrics:** Accuracy - **Task:** Named Entity Recognition (NER), **Metrics:** Entity-level macro F1 (Entity F1) and character-level macro F1 (Char F1) scores - **Task:** Relation Extraction (RE), **Metrics:** Micro F1 score on relation existing cases and area under the precision- recall curve (AUPRC) on all classes - **Task:** Dependency Parsing (DP), **Metrics:** Unlabeled attachment score (UAS) and labeled attachment score (LAS) - **Task:** Machine Reading Comprehension (MRC), **Metrics:** Exact match (EM) and character-level ROUGE-W (ROUGE), which can be viewed as longest common consecutive subsequence (LCCS)-based F1 score. - **Task:** Dialogue State Tracking (DST), **Metrics:** Joint goal accuracy (JGA) and slot micro F1 score (Slot F1) #### Results | Task | TC | STS | | NLI | NER | | RE | | DP | | MRC | | DST | | | :---: |:---: | :---: | :---: |:---:| :---: | :---: |:---:| :---:| :---: |:---: | :---: | :---:| :---: | :---: | | Metric | F1 | Pearsons' r| F1 | ACC | Entity F1 | Char F1 | F1 | AUPRC| UAS | LAS | EM | ROUGE| JGA |Slot F1 | | | 85.73| 90.85 | 82.84 |81.63| 83.97 | 91.39 |66.44| 66.17| 89.96 |88.05 | 62.32 | 68.51| 46.64 | 91.61 | ## Environmental Impact Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700). We present the hardware type based on the [associated paper](https://arxiv.org/pdf/2105.09680.pdf). - **Hardware Type:** TPU v3-8 - **Hours used:** Unknown - **Cloud Provider:** Unknown - **Compute Region:** Unknown - **Carbon Emitted:** Unknown ## Technical Specifications See the [associated paper](https://arxiv.org/pdf/2105.09680.pdf) for details on the modeling architecture (BERT), objective, compute infrastructure, and training details. ## Citation Information ```bibtex @misc{park2021klue, title={KLUE: Korean Language Understanding Evaluation}, author={Sungjoon Park and Jihyung Moon and Sungdong Kim and Won Ik Cho and Jiyoon Han and Jangwon Park and Chisung Song and Junseong Kim and Yongsook Song and Taehwan Oh and Joohong Lee and Juhyun Oh and Sungwon Lyu and Younghoon Jeong and Inkwon Lee and Sangwoo Seo and Dongjun Lee and Hyunwoo Kim and Myeonghwa Lee and Seongbo Jang and Seungwon Do and Sunkyoung Kim and Kyungtae Lim and Jongwon Lee and Kyumin Park and Jamin Shin and Seonghyun Kim and Lucy Park and Alice Oh and Jungwoo Ha and Kyunghyun Cho}, year={2021}, eprint={2105.09680}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

kandinsky-community/kandinsky-2-1-prior

kandinsky-community

diffusers

--- license: apache-2.0 tags: - kandinsky inference: false --- # Kandinsky 2.1 Kandinsky 2.1 inherits best practices from Dall-E 2 and Latent diffusion while introducing some new ideas. It uses the CLIP model as a text and image encoder, and diffusion image prior (mapping) between latent spaces of CLIP modalities. This approach increases the visual performance of the model and unveils new horizons in blending images and text-guided image manipulation. The Kandinsky model is created by [Arseniy Shakhmatov](https://github.com/cene555), [Anton Razzhigaev](https://github.com/razzant), [Aleksandr Nikolich](https://github.com/AlexWortega), [Igor Pavlov](https://github.com/boomb0om), [Andrey Kuznetsov](https://github.com/kuznetsoffandrey) and [Denis Dimitrov](https://github.com/denndimitrov) ## Usage Kandinsky 2.1 is available in diffusers! ```python pip install diffusers transformers ``` ### Text to image ```python from diffusers import AutoPipelineForText2Image import torch pipe = AutoPipelineForText2Image.from_pretrained("kandinsky-community/kandinsky-2-1", torch_dtype=torch.float16) pipe.enable_model_cpu_offload() prompt = "A alien cheeseburger creature eating itself, claymation, cinematic, moody lighting" negative_prompt = "low quality, bad quality" image = pipe(prompt=prompt, negative_prompt=negative_prompt, prior_guidance_scale =1.0, height=768, width=768).images[0] image.save("cheeseburger_monster.png") ```  ### Text Guided Image-to-Image Generation ```python from diffusers import AutoPipelineForImage2Image import torch import requests from io import BytesIO from PIL import Image import os pipe = AutoPipelineForImage2Image.from_pretrained("kandinsky-community/kandinsky-2-1", torch_dtype=torch.float16) pipe.enable_model_cpu_offload() prompt = "A fantasy landscape, Cinematic lighting" negative_prompt = "low quality, bad quality" url = "https://raw.githubusercontent.com/CompVis/stable-diffusion/main/assets/stable-samples/img2img/sketch-mountains-input.jpg" response = requests.get(url) original_image = Image.open(BytesIO(response.content)).convert("RGB") original_image.thumbnail((768, 768)) image = pipe(prompt=prompt, image=original_image, strength=0.3).images[0] out.images[0].save("fantasy_land.png") ```  ### Text Guided Inpainting Generation ```python from diffusers import AutoPipelineForInpainting from diffusers.utils import load_image import torch import numpy as np pipe = AutoPipelineForInpainting.from_pretrained("kandinsky-community/kandinsky-2-1-inpaint", torch_dtype=torch.float16) pipe.enable_model_cpu_offload() prompt = "a hat" negative_prompt = "low quality, bad quality" original_image = load_image( "https://huggingface.co/datasets/hf-internal-testing/diffusers-images/resolve/main" "/kandinsky/cat.png" ) mask = np.zeros((768, 768), dtype=np.float32) # Let's mask out an area above the cat's head mask[:250, 250:-250] = 1 image = pipe(prompt=prompt, image=original_image, mask_image=mask).images[0] image.save("cat_with_hat.png") ```  🚨🚨🚨 __Breaking change for Kandinsky Mask Inpainting__ 🚨🚨🚨 We introduced a breaking change for Kandinsky inpainting pipeline in the following pull request: https://github.com/huggingface/diffusers/pull/4207. Previously we accepted a mask format where black pixels represent the masked-out area. This is inconsistent with all other pipelines in diffusers. We have changed the mask format in Knaindsky and now using white pixels instead. Please upgrade your inpainting code to follow the above. If you are using Kandinsky Inpaint in production. You now need to change the mask to: ```python # For PIL input import PIL.ImageOps mask = PIL.ImageOps.invert(mask) # For PyTorch and Numpy input mask = 1 - mask ``` ### Interpolate ```python from diffusers import KandinskyPriorPipeline, KandinskyPipeline from diffusers.utils import load_image import PIL import torch pipe_prior = KandinskyPriorPipeline.from_pretrained( "kandinsky-community/kandinsky-2-1-prior", torch_dtype=torch.float16 ) pipe_prior.to("cuda") img1 = load_image( "https://huggingface.co/datasets/hf-internal-testing/diffusers-images/resolve/main" "/kandinsky/cat.png" ) img2 = load_image( "https://huggingface.co/datasets/hf-internal-testing/diffusers-images/resolve/main" "/kandinsky/starry_night.jpeg" ) # add all the conditions we want to interpolate, can be either text or image images_texts = ["a cat", img1, img2] # specify the weights for each condition in images_texts weights = [0.3, 0.3, 0.4] # We can leave the prompt empty prompt = "" prior_out = pipe_prior.interpolate(images_texts, weights) pipe = KandinskyPipeline.from_pretrained("kandinsky-community/kandinsky-2-1", torch_dtype=torch.float16) pipe.to("cuda") image = pipe(prompt, **prior_out, height=768, width=768).images[0] image.save("starry_cat.png") ```  ## Model Architecture ### Overview Kandinsky 2.1 is a text-conditional diffusion model based on unCLIP and latent diffusion, composed of a transformer-based image prior model, a unet diffusion model, and a decoder. The model architectures are illustrated in the figure below - the chart on the left describes the process to train the image prior model, the figure in the center is the text-to-image generation process, and the figure on the right is image interpolation. <p float="left"> <img src="https://raw.githubusercontent.com/ai-forever/Kandinsky-2/main/content/kandinsky21.png"/> </p> Specifically, the image prior model was trained on CLIP text and image embeddings generated with a pre-trained [mCLIP model](https://huggingface.co/M-CLIP/XLM-Roberta-Large-Vit-L-14). The trained image prior model is then used to generate mCLIP image embeddings for input text prompts. Both the input text prompts and its mCLIP image embeddings are used in the diffusion process. A [MoVQGAN](https://openreview.net/forum?id=Qb-AoSw4Jnm) model acts as the final block of the model, which decodes the latent representation into an actual image. ### Details The image prior training of the model was performed on the [LAION Improved Aesthetics dataset](https://huggingface.co/datasets/bhargavsdesai/laion_improved_aesthetics_6.5plus_with_images), and then fine-tuning was performed on the [LAION HighRes data](https://huggingface.co/datasets/laion/laion-high-resolution). The main Text2Image diffusion model was trained on the basis of 170M text-image pairs from the [LAION HighRes dataset](https://huggingface.co/datasets/laion/laion-high-resolution) (an important condition was the presence of images with a resolution of at least 768x768). The use of 170M pairs is due to the fact that we kept the UNet diffusion block from Kandinsky 2.0, which allowed us not to train it from scratch. Further, at the stage of fine-tuning, a dataset of 2M very high-quality high-resolution images with descriptions (COYO, anime, landmarks_russia, and a number of others) was used separately collected from open sources. ### Evaluation We quantitatively measure the performance of Kandinsky 2.1 on the COCO_30k dataset, in zero-shot mode. The table below presents FID. FID metric values ​​for generative models on COCO_30k | | FID (30k)| |:------|----:| | eDiff-I (2022) | 6.95 | | Image (2022) | 7.27 | | Kandinsky 2.1 (2023) | 8.21| | Stable Diffusion 2.1 (2022) | 8.59 | | GigaGAN, 512x512 (2023) | 9.09 | | DALL-E 2 (2022) | 10.39 | | GLIDE (2022) | 12.24 | | Kandinsky 1.0 (2022) | 15.40 | | DALL-E (2021) | 17.89 | | Kandinsky 2.0 (2022) | 20.00 | | GLIGEN (2022) | 21.04 | For more information, please refer to the upcoming technical report. ## BibTex If you find this repository useful in your research, please cite: ``` @misc{kandinsky 2.1, title = {kandinsky 2.1}, author = {Arseniy Shakhmatov, Anton Razzhigaev, Aleksandr Nikolich, Vladimir Arkhipkin, Igor Pavlov, Andrey Kuznetsov, Denis Dimitrov}, year = {2023}, howpublished = {}, } ```

sudo-ai/zero123plus-v1.2

sudo-ai

diffusers

Entry not found

hustvl/vitmatte-small-composition-1k

hustvl

transformers

--- license: apache-2.0 tags: - vision --- # ViTMatte model ViTMatte model trained on Composition-1k. It was introduced in the paper [ViTMatte: Boosting Image Matting with Pretrained Plain Vision Transformers](https://arxiv.org/abs/2305.15272) by Yao et al. and first released in [this repository](https://github.com/hustvl/ViTMatte). Disclaimer: The team releasing ViTMatte did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description ViTMatte is a simple approach to image matting, the task of accurately estimating the foreground object in an image. The model consists of a Vision Transformer (ViT) with a lightweight head on top. <img src="https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/model_doc/vitmatte_architecture.png" alt="drawing" width="600"/> <small> ViTMatte high-level overview. Taken from the <a href="https://arxiv.org/abs/2305.15272">original paper.</a> </small> ## Intended uses & limitations You can use the raw model for image matting. See the [model hub](https://huggingface.co/models?search=vitmatte) to look for other fine-tuned versions that may interest you. ### How to use We refer to the [docs](https://huggingface.co/docs/transformers/main/en/model_doc/vitmatte#transformers.VitMatteForImageMatting.forward.example). ### BibTeX entry and citation info ```bibtex @misc{yao2023vitmatte, title={ViTMatte: Boosting Image Matting with Pretrained Plain Vision Transformers}, author={Jingfeng Yao and Xinggang Wang and Shusheng Yang and Baoyuan Wang}, year={2023}, eprint={2305.15272}, archivePrefix={arXiv}, primaryClass={cs.CV} } ```

hiiamsid/sentence_similarity_spanish_es

hiiamsid

sentence-transformers

sentence-similarity

--- pipeline_tag: sentence-similarity language: - es tags: - sentence-transformers - feature-extraction - sentence-similarity - transformers license: apache-2.0 --- # hiiamsid/sentence_similarity_spanish_es This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 768 dimensional dense vector space and can be used for tasks like clustering or semantic search. <!--- Describe your model here --> ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer sentences = ['Mi nombre es Siddhartha', 'Mis amigos me llamaron por mi nombre Siddhartha'] model = SentenceTransformer('hiiamsid/sentence_similarity_spanish_es') embeddings = model.encode(sentences) print(embeddings) ``` ## Usage (HuggingFace Transformers) Without [sentence-transformers](https://www.SBERT.net), you can use the model like this: First, you pass your input through the transformer model, then you have to apply the right pooling-operation on-top of the contextualized word embeddings. ```python from transformers import AutoTokenizer, AutoModel import torch #Mean Pooling - Take attention mask into account for correct averaging def mean_pooling(model_output, attention_mask): token_embeddings = model_output[0] #First element of model_output contains all token embeddings input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) # Sentences we want sentence embeddings for sentences = ['Mi nombre es Siddhartha', 'Mis amigos me llamaron por mi nombre Siddhartha'] # Load model from HuggingFace Hub tokenizer = AutoTokenizer.from_pretrained('hiiamsid/sentence_similarity_spanish_es') model = AutoModel.from_pretrained('hiiamsid/sentence_similarity_spanish_es') # Tokenize sentences encoded_input = tokenizer(sentences, padding=True, truncation=True, return_tensors='pt') # Compute token embeddings with torch.no_grad(): model_output = model(**encoded_input) # Perform pooling. In this case, max pooling. sentence_embeddings = mean_pooling(model_output, encoded_input['attention_mask']) print("Sentence embeddings:") print(sentence_embeddings) ``` ## Evaluation Results ``` cosine_pearson : 0.8280372842978689 cosine_spearman : 0.8232689765056079 euclidean_pearson : 0.81021993884437 euclidean_spearman : 0.8087904592393836 manhattan_pearson : 0.809645390126291 manhattan_spearman : 0.8077035464970413 dot_pearson : 0.7803662255836028 dot_spearman : 0.7699607641618339 ``` For an automated evaluation of this model, see the *Sentence Embeddings Benchmark*: [https://seb.sbert.net](https://seb.sbert.net?model_name=hiiamsid/sentence_similarity_spanish_es) ## Training The model was trained with the parameters: **DataLoader**: `torch.utils.data.dataloader.DataLoader` of length 360 with parameters: ``` {'batch_size': 16, 'sampler': 'torch.utils.data.sampler.RandomSampler', 'batch_sampler': 'torch.utils.data.sampler.BatchSampler'} ``` **Loss**: `sentence_transformers.losses.CosineSimilarityLoss.CosineSimilarityLoss` Parameters of the fit()-Method: ``` { "callback": null, "epochs": 4, "evaluation_steps": 1000, "evaluator": "sentence_transformers.evaluation.EmbeddingSimilarityEvaluator.EmbeddingSimilarityEvaluator", "max_grad_norm": 1, "optimizer_class": "<class 'transformers.optimization.AdamW'>", "optimizer_params": { "lr": 2e-05 }, "scheduler": "WarmupLinear", "steps_per_epoch": null, "warmup_steps": 144, "weight_decay": 0.01 } ``` ## Full Model Architecture ``` SentenceTransformer( (0): Transformer({'max_seq_length': 512, 'do_lower_case': False}) with Transformer model: BertModel (1): Pooling({'word_embedding_dimension': 768, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False}) ) ``` ## Citing & Authors - Datasets : [stsb_multi_mt](https://huggingface.co/datasets/stsb_multi_mt) - Model : [dccuchile/bert-base-spanish-wwm-cased](https://huggingface.co/dccuchile/bert-base-spanish-wwm-cased) - Sentence Transformers [Semantic Textual Similarity](https://www.sbert.net/examples/training/sts/README.html)

fixie-ai/ultravox-v0_3

fixie-ai

transformers

feature-extraction

--- language: - en license: mit library_name: transformers datasets: - fixie-ai/librispeech_asr - fixie-ai/common_voice_17_0 --- # Model Card for Ultravox Ultravox is a multimodal Speech LLM built around a pretrained [Llama3.1-8B-Instruct](https://huggingface.co/meta-llama/Meta-Llama-3.1-8B) and [Whisper-small](https://huggingface.co/openai/whisper-small) backbone.\ See https://ultravox.ai for the GitHub repo and more information. ## Model Details ### Model Description Ultravox is a multimodal model that can consume both speech and text as input (e.g., a text system prompt and voice user message). The input to the model is given as a text prompt with a special `<|audio|>` pseudo-token, and the model processor will replace this magic token with embeddings derived from the input audio. Using the merged embeddings as input, the model will then generate output text as usual. In a future revision of Ultravox, we plan to expand the token vocabulary to support generation of semantic and acoustic audio tokens, which can then be fed to a vocoder to produce voice output. No preference tuning has been applied to this revision of the model. - **Developed by:** Fixie.ai - **License:** MIT ### Model Sources - **Repository:** https://ultravox.ai - **Demo:** See repo ## Usage Think of the model as an LLM that can also hear and understand speech. As such, it can be used as a voice agent, and also to do speech-to-speech translation, analysis of spoken audio, etc. To use the model, try the following: ```python # pip install transformers peft librosa import transformers import numpy as np import librosa pipe = transformers.pipeline(model='fixie-ai/ultravox-v0_3', trust_remote_code=True) path = "<path-to-input-audio>" # TODO: pass the audio here audio, sr = librosa.load(path, sr=16000) turns = [ { "role": "system", "content": "You are a friendly and helpful character. You love to answer questions for people." }, ] pipe({'audio': audio, 'turns': turns, 'sampling_rate': sr}, max_new_tokens=30) ``` ## Training Details The model uses a pre-trained [Llama3.1-8B-Instruct](https://huggingface.co/meta-llama/Meta-Llama-3.1-8B) backbone as well as the encoder part of [Whisper-small](https://huggingface.co/openai/whisper-small). Only the multi-modal adapter is trained, while Whisper encoder and Llama are kept frozen. We use a knowledge-distillation loss where Ultravox is trying to match the logits of the text-based Llama backbone. ### Training Data Training dataset is a mix of ASR datasets, extended by adding a "continuation" generated by Llama 3.1 8B. ### Training Procedure Supervised speech to audio finetuning. For more info, see [training code in Ultravox repo](https://github.com/fixie-ai/ultravox/blob/main/ultravox/training/train.py). #### Training Hyperparameters - **Training regime:** BF16 mixed precision training - **Hardward used:** 8x H100 GPUs #### Speeds, Sizes, Times The current version of Ultravox, when invoked with audio content, has a time-to-first-token (TTFT) of approximately 200ms, and a tokens-per-second rate of ~50-100 when using an A100-40GB GPU, all using a Llama 3.1 8B backbone. Check out the audio tab on [TheFastest.ai](https://thefastest.ai/?m=audio) for daily benchmarks and a comparison with other existing models. ## Evaluation | | en_de (BLEU) | es_en (BLEU) | LibriSpeech clean.test (WER) | |:------------------|:-------------|:-------------|:----------------------------| | Ultravox v0.2 | 12.07 | 15.17 | 6.07 | | **Ultravox v0.3** | 22.68 | 24.10 | 6.67 | | Whisper-Llama3.1 | 24.89 | 28.67 | 3.4 | | Llama3.1 (text-only) | 31.95 | 38.28 | - |

Vikhrmodels/Vikhr-7B-instruct_0.4

Vikhrmodels

transformers

text-generation

--- library_name: transformers language: - ru - en --- # Релиз вихря 0.3-0.4 Долили сильно больше данных в sft, теперь стабильнее работает json и multiturn, слегка подточили параметры претрена модели Added a lot more data to sft, now json and multiturn work more stable on long context and hard prompts - [Google Colab](https://colab.research.google.com/drive/15O9LwZhVUa1LWhZa2UKr_B-KOKenJBvv#scrollTo=5EeNFU2-9ERi) - [GGUF](https://huggingface.co/Vikhrmodels/Vikhr-7B-instruct_0.4-GGUF) ```python from transformers import AutoTokenizer, AutoModelForCausalLM import torch model = AutoModelForCausalLM.from_pretrained("Vikhrmodels/Vikhr-7B-instruct_0.4", device_map="auto", attn_implementation="flash_attention_2", torch_dtype=torch.bfloat16) tokenizer = AutoTokenizer.from_pretrained("Vikhrmodels/Vikhr-7B-instruct_0.4") from transformers import AutoTokenizer, pipeline pipe = pipeline("text-generation", model=model, tokenizer=tokenizer) prompts = [ "В чем разница между фруктом и овощем?", "Годы жизни колмагорова?"] def test_inference(prompt): prompt = pipe.tokenizer.apply_chat_template([{"role": "user", "content": prompt}], tokenize=False, add_generation_prompt=True) print(prompt) outputs = pipe(prompt, max_new_tokens=512, do_sample=True, num_beams=1, temperature=0.25, top_k=50, top_p=0.98, eos_token_id=79097) return outputs[0]['generated_text'][len(prompt):].strip() for prompt in prompts: print(f" prompt:\n{prompt}") print(f" response:\n{test_inference(prompt)}") print("-"*50) ``` ``` @article{nikolich2024vikhr, title={Vikhr: The Family of Open-Source Instruction-Tuned Large Language Models for Russian}, author={Aleksandr Nikolich and Konstantin Korolev and Artem Shelmanov}, journal={arXiv preprint arXiv:2405.13929}, year={2024}, url={https://arxiv.org/pdf/2405.13929} } ```

Salesforce/blip-vqa-capfilt-large

Salesforce

transformers

visual-question-answering

--- pipeline_tag: visual-question-answering tags: - visual-question-answering inference: false languages: - en license: bsd-3-clause --- # BLIP: Bootstrapping Language-Image Pre-training for Unified Vision-Language Understanding and Generation Model card for BLIP trained on visual question answering - large architecture (with ViT large backbone). |  | |:--:| | <b> Pull figure from BLIP official repo | Image source: https://github.com/salesforce/BLIP </b>| ## TL;DR Authors from the [paper](https://arxiv.org/abs/2201.12086) write in the abstract: *Vision-Language Pre-training (VLP) has advanced the performance for many vision-language tasks. However, most existing pre-trained models only excel in either understanding-based tasks or generation-based tasks. Furthermore, performance improvement has been largely achieved by scaling up the dataset with noisy image-text pairs collected from the web, which is a suboptimal source of supervision. In this paper, we propose BLIP, a new VLP framework which transfers flexibly to both vision-language understanding and generation tasks. BLIP effectively utilizes the noisy web data by bootstrapping the captions, where a captioner generates synthetic captions and a filter removes the noisy ones. We achieve state-of-the-art results on a wide range of vision-language tasks, such as image-text retrieval (+2.7% in average recall@1), image captioning (+2.8% in CIDEr), and VQA (+1.6% in VQA score). BLIP also demonstrates strong generalization ability when directly transferred to videolanguage tasks in a zero-shot manner. Code, models, and datasets are released.* ## Usage You can use this model for conditional and un-conditional image captioning ### Using the Pytorch model #### Running the model on CPU <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import BlipProcessor, BlipForQuestionAnswering processor = BlipProcessor.from_pretrained("Salesforce/blip-vqa-capfilt-large") model = BlipForQuestionAnswering.from_pretrained("Salesforce/blip-vqa-capfilt-large") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') question = "how many dogs are in the picture?" inputs = processor(raw_image, question, return_tensors="pt") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) >>> 1 ``` </details> #### Running the model on GPU ##### In full precision <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import BlipProcessor, BlipForQuestionAnswering processor = BlipProcessor.from_pretrained("Salesforce/blip-vqa-capfilt-large") model = BlipForQuestionAnswering.from_pretrained("Salesforce/blip-vqa-capfilt-large").to("cuda") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') question = "how many dogs are in the picture?" inputs = processor(raw_image, question, return_tensors="pt").to("cuda") out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) >>> 1 ``` </details> ##### In half precision (`float16`) <details> <summary> Click to expand </summary> ```python import torch import requests from PIL import Image from transformers import BlipProcessor, BlipForQuestionAnswering processor = BlipProcessor.from_pretrained("ybelkada/blip-vqa-capfilt-large") model = BlipForQuestionAnswering.from_pretrained("ybelkada/blip-vqa-capfilt-large", torch_dtype=torch.float16).to("cuda") img_url = 'https://storage.googleapis.com/sfr-vision-language-research/BLIP/demo.jpg' raw_image = Image.open(requests.get(img_url, stream=True).raw).convert('RGB') question = "how many dogs are in the picture?" inputs = processor(raw_image, question, return_tensors="pt").to("cuda", torch.float16) out = model.generate(**inputs) print(processor.decode(out[0], skip_special_tokens=True)) >>> 1 ``` </details> ## BibTex and citation info ``` @misc{https://doi.org/10.48550/arxiv.2201.12086, doi = {10.48550/ARXIV.2201.12086}, url = {https://arxiv.org/abs/2201.12086}, author = {Li, Junnan and Li, Dongxu and Xiong, Caiming and Hoi, Steven}, keywords = {Computer Vision and Pattern Recognition (cs.CV), FOS: Computer and information sciences, FOS: Computer and information sciences}, title = {BLIP: Bootstrapping Language-Image Pre-training for Unified Vision-Language Understanding and Generation}, publisher = {arXiv}, year = {2022}, copyright = {Creative Commons Attribution 4.0 International} } ```

deepdml/faster-whisper-large-v3-turbo-ct2

deepdml

ctranslate2

automatic-speech-recognition

--- language: - en - zh - de - es - ru - ko - fr - ja - pt - tr - pl - ca - nl - ar - sv - it - id - hi - fi - vi - he - uk - el - ms - cs - ro - da - hu - ta - 'no' - th - ur - hr - bg - lt - la - mi - ml - cy - sk - te - fa - lv - bn - sr - az - sl - kn - et - mk - br - eu - is - hy - ne - mn - bs - kk - sq - sw - gl - mr - pa - si - km - sn - yo - so - af - oc - ka - be - tg - sd - gu - am - yi - lo - uz - fo - ht - ps - tk - nn - mt - sa - lb - my - bo - tl - mg - as - tt - haw - ln - ha - ba - jw - su - yue tags: - audio - automatic-speech-recognition license: mit library_name: ctranslate2 --- # Whisper large-v3 turbo model for CTranslate2 This repository contains the conversion of [deepdml/whisper-large-v3-turbo](https://huggingface.co/deepdml/whisper-large-v3-turbo) to the [CTranslate2](https://github.com/OpenNMT/CTranslate2) model format. This model can be used in CTranslate2 or projects based on CTranslate2 such as [faster-whisper](https://github.com/systran/faster-whisper). ## Example ```python from faster_whisper import WhisperModel model = WhisperModel("deepdml/faster-whisper-large-v3-turbo-ct2") segments, info = model.transcribe("audio.mp3") for segment in segments: print("[%.2fs -> %.2fs] %s" % (segment.start, segment.end, segment.text)) ``` ## Conversion details The original model was converted with the following command: ``` ct2-transformers-converter --model deepdml/whisper-large-v3-turbo --output_dir faster-whisper-large-v3-turbo \ --copy_files tokenizer.json preprocessor_config.json --quantization float16 ``` Note that the model weights are saved in FP16. This type can be changed when the model is loaded using the [`compute_type` option in CTranslate2](https://opennmt.net/CTranslate2/quantization.html). ## More information **For more information about the original model, see its [model card](https://huggingface.co/openai/whisper-large-v3).**

clarin-pl/FastPDN

clarin-pl

transformers

token-classification

--- language: pl license: cc-by-4.0 tags: - ner datasets: - clarin-pl/kpwr-ner metrics: - f1 - accuracy - precision - recall widget: - text: "Nazywam się Jan Kowalski i mieszkam we Wrocławiu." example_title: "Example" --- # FastPDN FastPolDeepNer is model for Named Entity Recognition, designed for easy use, training and configuration. The forerunner of this project is [PolDeepNer2](https://gitlab.clarin-pl.eu/information-extraction/poldeepner2). The model implements a pipeline consisting of data processing and training using: hydra, pytorch, pytorch-lightning, transformers. Source code: https://gitlab.clarin-pl.eu/grupa-wieszcz/ner/fast-pdn ## How to use Here is how to use this model to get Named Entities in text: ```python from transformers import pipeline ner = pipeline('ner', model='clarin-pl/FastPDN', aggregation_strategy='simple') text = "Nazywam się Jan Kowalski i mieszkam we Wrocławiu." ner_results = ner(text) for output in ner_results: print(output) {'entity_group': 'nam_liv_person', 'score': 0.9996054, 'word': 'Jan Kowalski', 'start': 12, 'end': 24} {'entity_group': 'nam_loc_gpe_city', 'score': 0.998931, 'word': 'Wrocławiu', 'start': 39, 'end': 48} ``` Here is how to use this model to get the logits for every token in text: ```python from transformers import AutoTokenizer, AutoModelForTokenClassification tokenizer = AutoTokenizer.from_pretrained("clarin-pl/FastPDN") model = AutoModelForTokenClassification.from_pretrained("clarin-pl/FastPDN") text = "Nazywam się Jan Kowalski i mieszkam we Wrocławiu." encoded_input = tokenizer(text, return_tensors='pt') output = model(**encoded_input) ``` ## Training data The FastPDN model was trained on datasets (with 82 class versions) of kpwr and cen. Annotation guidelines are specified [here](https://clarin-pl.eu/dspace/bitstream/handle/11321/294/WytyczneKPWr-jednostkiidentyfikacyjne.pdf). ## Pretraining FastPDN models have been fine-tuned, thanks to pretrained models: - [herbert-base-case](https://huggingface.co/allegro/herbert-base-cased) - [distiluse-base-multilingual-cased-v1](sentence-transformers/distiluse-base-multilingual-cased-v1) ## Evaluation Runs trained on `cen_n82` and `kpwr_n82`: | name |test/f1|test/pdn2_f1|test/acc|test/precision|test/recall| |---------|-------|------------|--------|--------------|-----------| |distiluse| 0.53 | 0.61 | 0.95 | 0.55 | 0.54 | | herbert | 0.68 | 0.78 | 0.97 | 0.7 | 0.69 | ## Authors - Grupa Wieszcze CLARIN-PL - Wiktor Walentynowicz ## Contact - Norbert Ropiak (norbert.ropiak@pwr.edu.pl)

HooshvareLab/bert-fa-base-uncased-ner-peyma

HooshvareLab

transformers

token-classification

--- language: fa license: apache-2.0 --- # ParsBERT (v2.0) A Transformer-based Model for Persian Language Understanding We reconstructed the vocabulary and fine-tuned the ParsBERT v1.1 on the new Persian corpora in order to provide some functionalities for using ParsBERT in other scopes! Please follow the [ParsBERT](https://github.com/hooshvare/parsbert) repo for the latest information about previous and current models. ## Persian NER [ARMAN, PEYMA] This task aims to extract named entities in the text, such as names and label with appropriate `NER` classes such as locations, organizations, etc. The datasets used for this task contain sentences that are marked with `IOB` format. In this format, tokens that are not part of an entity are tagged as `”O”` the `”B”`tag corresponds to the first word of an object, and the `”I”` tag corresponds to the rest of the terms of the same entity. Both `”B”` and `”I”` tags are followed by a hyphen (or underscore), followed by the entity category. Therefore, the NER task is a multi-class token classification problem that labels the tokens upon being fed a raw text. There are two primary datasets used in Persian NER, `ARMAN`, and `PEYMA`. ### PEYMA PEYMA dataset includes 7,145 sentences with a total of 302,530 tokens from which 41,148 tokens are tagged with seven different classes. 1. Organization 2. Money 3. Location 4. Date 5. Time 6. Person 7. Percent | Label | # | |:------------:|:-----:| | Organization | 16964 | | Money | 2037 | | Location | 8782 | | Date | 4259 | | Time | 732 | | Person | 7675 | | Percent | 699 | **Download** You can download the dataset from [here](http://nsurl.org/tasks/task-7-named-entity-recognition-ner-for-farsi/) ## Results The following table summarizes the F1 score obtained by ParsBERT as compared to other models and architectures. | Dataset | ParsBERT v2 | ParsBERT v1 | mBERT | MorphoBERT | Beheshti-NER | LSTM-CRF | Rule-Based CRF | BiLSTM-CRF | |---------|-------------|-------------|-------|------------|--------------|----------|----------------|------------| | PEYMA | 93.40* | 93.10 | 86.64 | - | 90.59 | - | 84.00 | - | ## How to use :hugs: | Notebook | Description | | |:----------|:-------------|------:| | [How to use Pipelines](https://github.com/hooshvare/parsbert-ner/blob/master/persian-ner-pipeline.ipynb) | Simple and efficient way to use State-of-the-Art models on downstream tasks through transformers | [](https://colab.research.google.com/github/hooshvare/parsbert-ner/blob/master/persian-ner-pipeline.ipynb) | ### BibTeX entry and citation info Please cite in publications as the following: ```bibtex @article{ParsBERT, title={ParsBERT: Transformer-based Model for Persian Language Understanding}, author={Mehrdad Farahani, Mohammad Gharachorloo, Marzieh Farahani, Mohammad Manthouri}, journal={ArXiv}, year={2020}, volume={abs/2005.12515} } ``` ## Questions? Post a Github issue on the [ParsBERT Issues](https://github.com/hooshvare/parsbert/issues) repo.

Qwen/Qwen2.5-32B-Instruct

Qwen

transformers

text-generation

--- license: apache-2.0 license_link: https://huggingface.co/Qwen/Qwen2.5-32B-Instruct/blob/main/LICENSE language: - en pipeline_tag: text-generation base_model: Qwen/Qwen2.5-32B tags: - chat library_name: transformers --- # Qwen2.5-32B-Instruct ## Introduction Qwen2.5 is the latest series of Qwen large language models. For Qwen2.5, we release a number of base language models and instruction-tuned language models ranging from 0.5 to 72 billion parameters. Qwen2.5 brings the following improvements upon Qwen2: - Significantly **more knowledge** and has greatly improved capabilities in **coding** and **mathematics**, thanks to our specialized expert models in these domains. - Significant improvements in **instruction following**, **generating long texts** (over 8K tokens), **understanding structured data** (e.g, tables), and **generating structured outputs** especially JSON. **More resilient to the diversity of system prompts**, enhancing role-play implementation and condition-setting for chatbots. - **Long-context Support** up to 128K tokens and can generate up to 8K tokens. - **Multilingual support** for over 29 languages, including Chinese, English, French, Spanish, Portuguese, German, Italian, Russian, Japanese, Korean, Vietnamese, Thai, Arabic, and more. **This repo contains the instruction-tuned 32B Qwen2.5 model**, which has the following features: - Type: Causal Language Models - Training Stage: Pretraining & Post-training - Architecture: transformers with RoPE, SwiGLU, RMSNorm, and Attention QKV bias - Number of Parameters: 32.5B - Number of Paramaters (Non-Embedding): 31.0B - Number of Layers: 64 - Number of Attention Heads (GQA): 40 for Q and 8 for KV - Context Length: Full 131,072 tokens and generation 8192 tokens - Please refer to [this section](#processing-long-texts) for detailed instructions on how to deploy Qwen2.5 for handling long texts. For more details, please refer to our [blog](https://qwenlm.github.io/blog/qwen2.5/), [GitHub](https://github.com/QwenLM/Qwen2.5), and [Documentation](https://qwen.readthedocs.io/en/latest/). ## Requirements The code of Qwen2.5 has been in the latest Hugging face `transformers` and we advise you to use the latest version of `transformers`. With `transformers<4.37.0`, you will encounter the following error: ``` KeyError: 'qwen2' ``` ## Quickstart Here provides a code snippet with `apply_chat_template` to show you how to load the tokenizer and model and how to generate contents. ```python from transformers import AutoModelForCausalLM, AutoTokenizer model_name = "Qwen/Qwen2.5-32B-Instruct" model = AutoModelForCausalLM.from_pretrained( model_name, torch_dtype="auto", device_map="auto" ) tokenizer = AutoTokenizer.from_pretrained(model_name) prompt = "Give me a short introduction to large language model." messages = [ {"role": "system", "content": "You are Qwen, created by Alibaba Cloud. You are a helpful assistant."}, {"role": "user", "content": prompt} ] text = tokenizer.apply_chat_template( messages, tokenize=False, add_generation_prompt=True ) model_inputs = tokenizer([text], return_tensors="pt").to(model.device) generated_ids = model.generate( **model_inputs, max_new_tokens=512 ) generated_ids = [ output_ids[len(input_ids):] for input_ids, output_ids in zip(model_inputs.input_ids, generated_ids) ] response = tokenizer.batch_decode(generated_ids, skip_special_tokens=True)[0] ``` ### Processing Long Texts The current `config.json` is set for context length up to 32,768 tokens. To handle extensive inputs exceeding 32,768 tokens, we utilize [YaRN](https://arxiv.org/abs/2309.00071), a technique for enhancing model length extrapolation, ensuring optimal performance on lengthy texts. For supported frameworks, you could add the following to `config.json` to enable YaRN: ```json { ..., "rope_scaling": { "factor": 4.0, "original_max_position_embeddings": 32768, "type": "yarn" } } ``` For deployment, we recommend using vLLM. Please refer to our [Documentation](https://qwen.readthedocs.io/en/latest/deployment/vllm.html) for usage if you are not familar with vLLM. Presently, vLLM only supports static YARN, which means the scaling factor remains constant regardless of input length, **potentially impacting performance on shorter texts**. We advise adding the `rope_scaling` configuration only when processing long contexts is required. ## Evaluation & Performance Detailed evaluation results are reported in this [📑 blog](https://qwenlm.github.io/blog/qwen2.5/). For requirements on GPU memory and the respective throughput, see results [here](https://qwen.readthedocs.io/en/latest/benchmark/speed_benchmark.html). ## Citation If you find our work helpful, feel free to give us a cite. ``` @misc{qwen2.5, title = {Qwen2.5: A Party of Foundation Models}, url = {https://qwenlm.github.io/blog/qwen2.5/}, author = {Qwen Team}, month = {September}, year = {2024} } @article{qwen2, title={Qwen2 Technical Report}, author={An Yang and Baosong Yang and Binyuan Hui and Bo Zheng and Bowen Yu and Chang Zhou and Chengpeng Li and Chengyuan Li and Dayiheng Liu and Fei Huang and Guanting Dong and Haoran Wei and Huan Lin and Jialong Tang and Jialin Wang and Jian Yang and Jianhong Tu and Jianwei Zhang and Jianxin Ma and Jin Xu and Jingren Zhou and Jinze Bai and Jinzheng He and Junyang Lin and Kai Dang and Keming Lu and Keqin Chen and Kexin Yang and Mei Li and Mingfeng Xue and Na Ni and Pei Zhang and Peng Wang and Ru Peng and Rui Men and Ruize Gao and Runji Lin and Shijie Wang and Shuai Bai and Sinan Tan and Tianhang Zhu and Tianhao Li and Tianyu Liu and Wenbin Ge and Xiaodong Deng and Xiaohuan Zhou and Xingzhang Ren and Xinyu Zhang and Xipin Wei and Xuancheng Ren and Yang Fan and Yang Yao and Yichang Zhang and Yu Wan and Yunfei Chu and Yuqiong Liu and Zeyu Cui and Zhenru Zhang and Zhihao Fan}, journal={arXiv preprint arXiv:2407.10671}, year={2024} } ```

clw8998/Product-Name-NER-model

clw8998

token-classification

--- license: apache-2.0 language: - zh tags: - token-classification --- [中文](#中文版本) | [English](#english-version) ## 中文版本 這是一個**繁體中文**命名實體識別 (NER) 模型，可用於提取**商品名稱**中的各種屬性，例如品牌、名稱、顏色等。 關於如何使用模型，請參考 [Product-Name-NER-for-EE5327701](https://github.com/clw8998/Product-Name-NER-for-EE5327701)。 關於各種屬性的標註規則，以及模型在各個屬性的 F1-score，請參考下表： | 編號 | 標籤屬性 | 說明 | F1-score | |-----|-------------------|---------------------------------------------------------------------------------------------|-------| | 1 | **品牌** | 商品品牌名稱，如 華碩、LG | 0.8770 | | 2 | **名稱** | 商品中所有的“產品系列”，以及商人為了特殊目的所特別額外創造出的商品名稱，不包含特殊主題或是產品類型，不含廣告詞。如 iPhone 12、ROG 3060Ti | 0.5941 | | 3 | **產品** | 實際產品名稱(類型)。如 電腦、滑鼠、鍵盤、螢幕、玩具、餅乾、衛生紙 | 0.8001 | | 4 | **產品序號** | 商品序號，該產品所擁有的唯一數字字母組合序號，不含系列名。 | 0.8443 | | 5 | **顏色** | 顏色資訊，包含化妝品以及明亮色調。如 花朵紅、藍色系、晶亮 | 0.8898 | | 6 | **材質** | 產品的製造材料，請注意，不是產品成分。如 木製、PVC 材質、304 不銹鋼 | 0.7810 | | 7 | **對象與族群** | 適用的人與動物的族群。如 新生兒、寵物用、高齡族群 | 0.8755 | | 8 | **適用物體、事件與場所** | 適用的物品、事件、場所。如 手部用、騎車用、廚房用 | 0.7614 | | 9 | **特殊主題** | 產品附有特殊主題或為創造作。如 航海王、J.K. Rowling | 0.4979 | | 10 | **形狀** | 商品形狀及其外觀詞彙。如 圓形、鈕扣形、可愛熊、無袖、長筒、窄邊框 | 0.7793 | | 11 | **圖案** | 產品上的圖案，如 圓形、螺旋形圖案 | 0.5731 | | 12 | **尺寸** | 商品大小，常以數字和特殊規格形式出現。如 120x80x10cm（長寬高）、XL、ATX | 0.8420 | | 13 | **重量** | 商品重量，常以數字和特殊規格形式出現。如 10g、極輕 | 0.9105 | | 14 | **容量** | 商品容量，常以數字和特殊規格形式出現。如 128G（電腦）、大容量 | 0.9220 | | 15 | **包裝組合** | 產品的包裝方式、組合方式。如 10 入、10g/包、鍵盤滑鼠組合、送電池 | 0.7478 | | 16 | **功能與規格** | 產品的用途與特殊規格，如 USB 3.0、陽光防曬、防水 | 0.7960 | | 17 | **Macro F1-score** | | 0.7807 | ## English Version This is a **Traditional Chinese** Named Entity Recognition (NER) model designed for extracting various attributes from **product names**, such as brand, name, color, etc. For details on how to use the model, please refer to [Product-Name-NER-for-EE5327701](https://github.com/clw8998/Product-Name-NER-for-EE5327701). The following table provides the annotation rules for various attributes, along with the F1-scores for each attribute: | No. | Attribute (English) | Description | F1-score | |------|-------------------------------|-------------------------------------------------------------------------------------------------|----------| | 1 | **品牌 (brand)** | The product's brand name, such as Asus, LG | 0.8770 | | 2 | **名稱 (name)** | The "product series" or name created by the seller for special purposes. Excludes special topics or product types. Does not include advertisements. For example, iPhone 12, ROG 3060Ti | 0.5941 | | 3 | **產品 (product)** | The actual product name (type), such as computer, mouse, keyboard, monitor, toy, snack, tissue | 0.8001 | | 4 | **產品序號 (product serial number)** | The product's unique alphanumeric code, excluding series names | 0.8443 | | 5 | **顏色 (color)** | The color information, including cosmetics and brightness. For example, floral red, blue, crystal | 0.8898 | | 6 | **材質 (material)** | The material used in the product, not ingredients. For example, wood, PVC, 304 stainless steel | 0.7810 | | 7 | **對象與族群 (target group)** | The target audience, such as newborns, pets, seniors | 0.8755 | | 8 | **適用物體、事件與場所 (applicable item, event, or place)** | The item, event, or place the product is applicable for. For example, hand-use, cycling, kitchen | 0.7614 | | 9 | **特殊主題 (special topic)** | Special themes or brands. For example, One Piece, J.K. Rowling | 0.4979 | | 10 | **形狀 (shape)** | The product's shape and appearance description. For example, round, button shape, bear shape | 0.7793 | | 11 | **圖案 (pattern)** | Patterns on the product, such as round or spiral patterns | 0.5731 | | 12 | **尺寸 (size)** | Product size, often in numerical or specific form. For example, 120x80x10cm (LxWxH), XL, ATX | 0.8420 | | 13 | **重量 (weight)** | Product weight, often in numerical or specific form. For example, 10g, ultra-light | 0.9105 | | 14 | **容量 (capacity)** | Product capacity, often in numerical or specific form. For example, 128GB (computer), large capacity | 0.9220 | | 15 | **包裝組合 (package combination)** | The product's packaging method or combination. For example, 10 pieces, 10g/package, keyboard & mouse combo, battery included | 0.7478 | | 16 | **功能與規格 (function & specifications)** | The product's functions and special specifications. For example, USB3.0, sun protection, waterproof | 0.7960 | | 17 | **Macro F1-score** | Overall F1-score | 0.7807 |

distil-whisper/distil-large-v3

distil-whisper

transformers

automatic-speech-recognition

--- language: - en license: mit library_name: transformers tags: - audio - automatic-speech-recognition - transformers.js widget: - example_title: LibriSpeech sample 1 src: https://cdn-media.huggingface.co/speech_samples/sample1.flac - example_title: LibriSpeech sample 2 src: https://cdn-media.huggingface.co/speech_samples/sample2.flac pipeline_tag: automatic-speech-recognition --- # Distil-Whisper: distil-large-v3 Distil-Whisper was proposed in the paper [Robust Knowledge Distillation via Large-Scale Pseudo Labelling](https://arxiv.org/abs/2311.00430). This is the third and final installment of the Distil-Whisper English series. It the knowledge distilled version of OpenAI's [Whisper large-v3](https://huggingface.co/openai/whisper-large-v3), the latest and most performant Whisper model to date. Compared to previous Distil-Whisper models, the distillation procedure for distil-large-v3 has been adapted to give **superior long-form transcription accuracy** with OpenAI's **sequential long-form algorithm**. The result is a distilled model that performs to within 1% WER of large-v3 on long-form audio using both the sequential and chunked algorithms, and outperforms distil-large-v2 by 4.8% using the sequential algorithm. The model is also faster than previous Distil-Whisper models: **6.3x faster than large-v3**, and 1.1x faster than distil-large-v2. | Model | Params / M | Rel. Latency | Short-Form | Sequential Long-Form | Chunked Long-Form | |------------------------------------------------------------------------------|------------|--------------|------------|----------------------|-------------------| | [large-v3](https://huggingface.co/openai/whisper-large-v3) | 1550 | 1.0 | 8.4 | 10.0 | 11.0 | | **[distil-large-v3](https://huggingface.co/distil-whisper/distil-large-v3)** | **756** | **6.3** | **9.7** | **10.8** | **10.9** | | [distil-large-v2](https://huggingface.co/distil-whisper/distil-large-v2) | 756 | 5.8 | 10.1 | 15.6 | 11.6 | Since the sequential algorithm is the "de-facto" transcription algorithm across the most popular Whisper libraries (Whisper cpp, Faster-Whisper, OpenAI Whisper), this distilled model is designed to be compatible with these libraries. You can expect significant performance gains by switching from previous Distil-Whisper checkpoints to distil-large-v3 when using these libraries. For convenience, the weights for the most popular libraries are already converted, with instructions for getting started below. ## Table of Contents 1. [Transformers Usage](#transformers-usage) * [Short-Form Transcription](#short-form-transcription) * [Sequential Long-Form](#sequential-long-form) * [Chunked Long-Form](#chunked-long-form) * [Speculative Decoding](#speculative-decoding) * [Additional Speed and Memory Improvements](#additional-speed--memory-improvements) 2. [Library Integrations](#library-integrations) * [Whisper cpp](#whispercpp) * [Faster Whisper](#faster-whisper) * [OpenAI Whisper](#openai-whisper) * [Transformers.js](#transformersjs) * [Candle](#candle) 3. [Model Details](#model-details) 4. [License](#license) ## Transformers Usage distil-large-v3 is supported in the Hugging Face 🤗 Transformers library from version 4.39 onwards. To run the model, first install the latest version of Transformers. For this example, we'll also install 🤗 Datasets to load a toy audio dataset from the Hugging Face Hub: ```bash pip install --upgrade pip pip install --upgrade transformers accelerate datasets[audio] ``` ### Short-Form Transcription The model can be used with the [`pipeline`](https://huggingface.co/docs/transformers/main_classes/pipelines#transformers.AutomaticSpeechRecognitionPipeline) class to transcribe short-form audio files (< 30-seconds) as follows: ```python import torch from transformers import AutoModelForSpeechSeq2Seq, AutoProcessor, pipeline from datasets import load_dataset device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 model_id = "distil-whisper/distil-large-v3" model = AutoModelForSpeechSeq2Seq.from_pretrained( model_id, torch_dtype=torch_dtype, low_cpu_mem_usage=True, use_safetensors=True ) model.to(device) processor = AutoProcessor.from_pretrained(model_id) pipe = pipeline( "automatic-speech-recognition", model=model, tokenizer=processor.tokenizer, feature_extractor=processor.feature_extractor, max_new_tokens=128, torch_dtype=torch_dtype, device=device, ) dataset = load_dataset("hf-internal-testing/librispeech_asr_dummy", "clean", split="validation") sample = dataset[0]["audio"] result = pipe(sample) print(result["text"]) ``` To transcribe a local audio file, simply pass the path to your audio file when you call the pipeline: ```diff - result = pipe(sample) + result = pipe("audio.mp3") ``` For segment-level timestamps, pass the argument `return_timestamps=True` and return the `"chunks"` output: ```python result = pipe(sample, return_timestamps=True) print(result["chunks"]) ``` <details> <summary> For more control over the generation parameters, use the model + processor API directly: </summary> Ad-hoc generation arguments can be passed to `model.generate`, including `num_beams` for beam-search, `return_timestamps` for segment-level timestamps, and `prompt_ids` for prompting. See the [docstrings](https://huggingface.co/docs/transformers/en/model_doc/whisper#transformers.WhisperForConditionalGeneration.generate) for more details. ```python import torch from transformers import AutoModelForSpeechSeq2Seq, AutoProcessor from datasets import Audio, load_dataset device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 model_id = "distil-whisper/distil-large-v3" model = AutoModelForSpeechSeq2Seq.from_pretrained( model_id, torch_dtype=torch_dtype, low_cpu_mem_usage=True, use_safetensors=True ) model.to(device) processor = AutoProcessor.from_pretrained(model_id) dataset = load_dataset("hf-internal-testing/librispeech_asr_dummy", "clean", split="validation") dataset = dataset.cast_column("audio", Audio(processor.feature_extractor.sampling_rate)) sample = dataset[0]["audio"] input_features = processor( sample["array"], sampling_rate=sample["sampling_rate"], return_tensors="pt" ).input_features input_features = input_features.to(device, dtype=torch_dtype) gen_kwargs = { "max_new_tokens": 128, "num_beams": 1, "return_timestamps": False, } pred_ids = model.generate(input_features, **gen_kwargs) pred_text = processor.batch_decode(pred_ids, skip_special_tokens=True, decode_with_timestamps=gen_kwargs["return_timestamps"]) print(pred_text) ``` </details> ### Sequential Long-Form Unlike previous Distil-Whisper releases, distil-large-v3 is specifically designed to be compatible with OpenAI's sequential long-form transcription algorithm. This algorithm uses a sliding window for buffered inference of long audio files (> 30-seconds), and returns more accurate transcriptions compared to the [chunked long-form algorithm](#chunked-long-form). The sequential long-form algorithm should be used in either of the following scenarios: 1. Transcription accuracy is the most important factor, and latency is less of a consideration 2. You are transcribing **batches** of long audio files, in which case the latency of sequential is comparable to chunked, while being up to 0.5% WER more accurate If you are transcribing single long audio files and latency is the most important factor, you should use the chunked algorithm described [below](#chunked-long-form). For a detailed explanation of the different algorithms, refer to Sections 5 of the [Distil-Whisper paper](https://arxiv.org/pdf/2311.00430.pdf). The [`pipeline`](https://huggingface.co/docs/transformers/main_classes/pipelines#transformers.AutomaticSpeechRecognitionPipeline) class can be used to transcribe long audio files with the sequential algorithm as follows: ```python import torch from transformers import AutoModelForSpeechSeq2Seq, AutoProcessor, pipeline from datasets import load_dataset device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 model_id = "distil-whisper/distil-large-v3" model = AutoModelForSpeechSeq2Seq.from_pretrained( model_id, torch_dtype=torch_dtype, low_cpu_mem_usage=True, use_safetensors=True ) model.to(device) processor = AutoProcessor.from_pretrained(model_id) pipe = pipeline( "automatic-speech-recognition", model=model, tokenizer=processor.tokenizer, feature_extractor=processor.feature_extractor, max_new_tokens=128, torch_dtype=torch_dtype, device=device, ) dataset = load_dataset("distil-whisper/librispeech_long", "clean", split="validation") sample = dataset[0]["audio"] result = pipe(sample) print(result["text"]) ``` <details> <summary> For more control over the generation parameters, use the model + processor API directly: </summary> ```python import torch from transformers import AutoModelForSpeechSeq2Seq, AutoProcessor from datasets import Audio, load_dataset device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 model_id = "distil-whisper/distil-large-v3" model = AutoModelForSpeechSeq2Seq.from_pretrained( model_id, torch_dtype=torch_dtype, low_cpu_mem_usage=True, use_safetensors=True ) model.to(device) processor = AutoProcessor.from_pretrained(model_id) dataset = load_dataset("hf-internal-testing/librispeech_asr_dummy", "clean", split="validation") dataset = dataset.cast_column("audio", Audio(processor.feature_extractor.sampling_rate)) sample = dataset[0]["audio"] inputs = processor( sample["array"], sampling_rate=sample["sampling_rate"], return_tensors="pt", truncation=False, padding="longest", return_attention_mask=True, ) inputs = inputs.to(device, dtype=torch_dtype) gen_kwargs = { "max_new_tokens": 448, "num_beams": 1, "condition_on_prev_tokens": False, "compression_ratio_threshold": 1.35, # zlib compression ratio threshold (in token space) "temperature": (0.0, 0.2, 0.4, 0.6, 0.8, 1.0), "logprob_threshold": -1.0, "no_speech_threshold": 0.6, "return_timestamps": True, } pred_ids = model.generate(**i nputs, **gen_kwargs) pred_text = processor.batch_decode(pred_ids, skip_special_tokens=True, decode_with_timestamps=False) print(pred_text) ``` </details> ### Chunked Long-Form distil-large-v3 remains compatible with the Transformers chunked long-form algorithm. This algorithm should be used when a single large audio file is being transcribed and the fastest possible inference is required. In such circumstances, the chunked algorithm is up to 9x faster than OpenAI's sequential long-form implementation (see Table 7 of the [Distil-Whisper paper](https://arxiv.org/pdf/2311.00430.pdf)). To enable chunking, pass the `chunk_length_s` parameter to the `pipeline`. For distil-large-v3, a chunk length of 25-seconds is optimal. To activate batching over long audio files, pass the argument `batch_size`: ```python import torch from transformers import AutoModelForSpeechSeq2Seq, AutoProcessor, pipeline from datasets import load_dataset device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 model_id = "distil-whisper/distil-large-v3" model = AutoModelForSpeechSeq2Seq.from_pretrained( model_id, torch_dtype=torch_dtype, low_cpu_mem_usage=True, use_safetensors=True ) model.to(device) processor = AutoProcessor.from_pretrained(model_id) pipe = pipeline( "automatic-speech-recognition", model=model, tokenizer=processor.tokenizer, feature_extractor=processor.feature_extractor, max_new_tokens=128, chunk_length_s=25, batch_size=16, torch_dtype=torch_dtype, device=device, ) dataset = load_dataset("distil-whisper/librispeech_long", "clean", split="validation") sample = dataset[0]["audio"] result = pipe(sample) print(result["text"]) ``` ### Speculative Decoding distil-large-v3 is the first Distil-Whisper model that can be used as an assistant to Whisper large-v3 for [speculative decoding](https://huggingface.co/blog/whisper-speculative-decoding). Speculative decoding mathematically ensures that exactly the same outputs as Whisper are obtained, while being 2 times faster. This makes it the perfect drop-in replacement for existing Whisper pipelines, since the same outputs are guaranteed. In the following code-snippet, we load the assistant Distil-Whisper model standalone to the main Whisper pipeline. We then specify it as the "assistant model" for generation: ```python from transformers import pipeline, AutoModelForCausalLM, AutoModelForSpeechSeq2Seq, AutoProcessor import torch from datasets import load_dataset device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 assistant_model_id = "distil-whisper/distil-large-v3" assistant_model = AutoModelForCausalLM.from_pretrained( assistant_model_id, torch_dtype=torch_dtype, low_cpu_mem_usage=True, use_safetensors=True ) assistant_model.to(device) model_id = "openai/whisper-large-v3" model = AutoModelForSpeechSeq2Seq.from_pretrained( model_id, torch_dtype=torch_dtype, low_cpu_mem_usage=True, use_safetensors=True ) model.to(device) processor = AutoProcessor.from_pretrained(model_id) pipe = pipeline( "automatic-speech-recognition", model=model, tokenizer=processor.tokenizer, feature_extractor=processor.feature_extractor, max_new_tokens=128, generate_kwargs={"assistant_model": assistant_model}, torch_dtype=torch_dtype, device=device, ) dataset = load_dataset("hf-internal-testing/librispeech_asr_dummy", "clean", split="validation") sample = dataset[0]["audio"] result = pipe(sample) print(result["text"]) ``` For more details on speculative decoding, refer to the blog post [Speculative Decoding for 2x Faster Whisper Inference](https://huggingface.co/blog/whisper-speculative-decoding). ### Additional Speed & Memory Improvements You can apply additional speed and memory improvements to Distil-Whisper to further reduce the inference speed and VRAM requirements. These optimisations primarily target the attention kernel, swapping it from an eager implementation to a more efficient flash attention version. #### Flash Attention 2 We recommend using [Flash-Attention 2](https://huggingface.co/docs/transformers/main/en/perf_infer_gpu_one#flashattention-2) if your GPU allows for it. To do so, you first need to install [Flash Attention](https://github.com/Dao-AILab/flash-attention): ``` pip install flash-attn --no-build-isolation ``` Then pass `attn_implementation="flash_attention_2"` to `from_pretrained`: ```diff - model = AutoModelForSpeechSeq2Seq.from_pretrained(model_id, torch_dtype=torch_dtype, low_cpu_mem_usage=True, use_safetensors=True) + model = AutoModelForSpeechSeq2Seq.from_pretrained(model_id, torch_dtype=torch_dtype, low_cpu_mem_usage=True, use_safetensors=True, attn_implementation="flash_attention_2") ``` #### Torch Scale-Product-Attention (SDPA) If your GPU does not support Flash Attention, we recommend making use of PyTorch [scaled dot-product attention (SDPA)](https://pytorch.org/docs/stable/generated/torch.nn.functional.scaled_dot_product_attention.html). This attention implementation is activated **by default** for PyTorch versions 2.1.1 or greater. To check whether you have a compatible PyTorch version, run the following Python code snippet: ```python from transformers.utils import is_torch_sdpa_available print(is_torch_sdpa_available()) ``` If the above returns `True`, you have a valid version of PyTorch installed and SDPA is activated by default. If it returns `False`, you need to upgrade your PyTorch version according to the [official instructions](https://pytorch.org/get-started/locally/) Once a valid PyTorch version is installed, SDPA is activated by default. It can also be set explicitly by specifying `attn_implementation="sdpa"` as follows: ```diff - model = AutoModelForSpeechSeq2Seq.from_pretrained(model_id, torch_dtype=torch_dtype, low_cpu_mem_usage=True, use_safetensors=True) + model = AutoModelForSpeechSeq2Seq.from_pretrained(model_id, torch_dtype=torch_dtype, low_cpu_mem_usage=True, use_safetensors=True, attn_implementation="sdpa") ``` For more information about how to use the SDPA refer to the [Transformers SDPA documentation](https://huggingface.co/docs/transformers/en/perf_infer_gpu_one#pytorch-scaled-dot-product-attention). #### Torch compile Coming soon... #### 4-bit and 8-bit Inference Coming soon... ## Library Integrations ### Whisper.cpp Distil-Whisper can be run with the [Whisper.cpp](https://github.com/ggerganov/whisper.cpp) package with the original sequential long-form transcription algorithm. In a provisional benchmark on Mac M1, distil-large-v3 is over 5x faster than Whisper large-v3, while performing to within 0.8% WER over long-form audio. Steps for getting started: 1. Clone the Whisper.cpp repository: ``` git clone https://github.com/ggerganov/whisper.cpp.git cd whisper.cpp ``` 2. Install the Hugging Face Hub Python package: ```bash pip install --upgrade huggingface_hub ``` And download the GGML weights for distil-large-v3 using the following Python snippet: ```python from huggingface_hub import hf_hub_download hf_hub_download(repo_id='distil-whisper/distil-large-v3-ggml', filename='ggml-distil-large-v3.bin', local_dir='./models') ``` Note that if you do not have a Python environment set-up, you can also download the weights directly with `wget`: ```bash wget https://huggingface.co/distil-whisper/distil-large-v3-ggml/resolve/main/ggml-distil-large-v3.bin -P ./models ``` 3. Run inference using the provided sample audio: ```bash make -j && ./main -m models/ggml-distil-large-v3.bin -f samples/jfk.wav ``` ### Faster-Whisper Faster-Whisper is a reimplementation of Whisper using [CTranslate2](https://github.com/OpenNMT/CTranslate2/), a fast inference engine for Transformer models. First, install the Faster-Whisper package according to the [official instructions](https://github.com/SYSTRAN/faster-whisper#installation). For this example, we'll also install 🤗 Datasets to load a toy audio dataset from the Hugging Face Hub: ```bash pip install --upgrade pip pip install --upgrade git+https://github.com/SYSTRAN/faster-whisper datasets[audio] ``` The following code snippet loads the distil-large-v3 model and runs inference on an example file from the LibriSpeech ASR dataset: ```python import torch from faster_whisper import WhisperModel from datasets import load_dataset # define our torch configuration device = "cuda:0" if torch.cuda.is_available() else "cpu" compute_type = "float16" if torch.cuda.is_available() else "float32" # load model on GPU if available, else cpu model = WhisperModel("distil-large-v3", device=device, compute_type=compute_type) # load toy dataset for example dataset = load_dataset("hf-internal-testing/librispeech_asr_dummy", "clean", split="validation") sample = dataset[1]["audio"]["path"] segments, info = model.transcribe(sample, beam_size=1) for segment in segments: print("[%.2fs -> %.2fs] %s" % (segment.start, segment.end, segment.text)) ``` To transcribe a local audio file, simply pass the path to the audio file as the `audio` argument to transcribe: ```python segments, info = model.transcribe("audio.mp3", beam_size=1) ``` ### OpenAI Whisper To use the model in the original Whisper format, first ensure you have the [`openai-whisper`](https://pypi.org/project/openai-whisper/) package installed. For this example, we'll also install 🤗 Datasets to load a toy audio dataset from the Hugging Face Hub: ```bash pip install --upgrade pip pip install --upgrade openai-whisper datasets[audio] ``` The following code-snippet demonstrates how to transcribe a sample file from the LibriSpeech dataset loaded using 🤗 Datasets: ```python from huggingface_hub import hf_hub_download from datasets import load_dataset from whisper import load_model, transcribe model_path = hf_hub_download(repo_id="distil-whisper/distil-large-v3-openai", filename="model.bin") model = load_model(model_path) dataset = load_dataset("hf-internal-testing/librispeech_asr_dummy", "clean", split="validation") sample = dataset[0]["audio"]["path"] pred_out = transcribe(model, audio=sample, language="en") print(pred_out["text"]) ``` Note that the model weights will be downloaded and saved to your cache the first time you run the example. Subsequently, you can re-use the same example, and the weights will be loaded directly from your cache without having to download them again. To transcribe a local audio file, simply pass the path to the audio file as the `audio` argument to transcribe: ```python pred_out = transcribe(model, audio=sample, language="en") ``` The Distil-Whisper model can also be used with the OpenAI Whisper CLI. Refer to the [following instructions](https://huggingface.co/distil-whisper/distil-large-v3-openai#cli-usage) for details. ### Transformers.js Distil-Whisper can be run completely in your web browser with [Transformers.js](http://github.com/xenova/transformers.js): 1. Install Transformers.js from [NPM](https://www.npmjs.com/package/@xenova/transformers): ```bash npm i @xenova/transformers ``` 2. Import the library and perform inference with the pipeline API. ```js import { pipeline } from '@xenova/transformers'; const transcriber = await pipeline('automatic-speech-recognition', 'distil-whisper/distil-large-v3'); const url = 'https://huggingface.co/datasets/Xenova/transformers.js-docs/resolve/main/jfk.wav'; const output = await transcriber(url); // { text: " And so, my fellow Americans, ask not what your country can do for you. Ask what you can do for your country." } ``` Check out the online [Distil-Whisper Web Demo](https://huggingface.co/spaces/Xenova/distil-whisper-web) to try it out yourself. As you'll see, it runs locally in your browser: no server required! Refer to the Transformers.js [docs](https://huggingface.co/docs/transformers.js/api/pipelines#module_pipelines.AutomaticSpeechRecognitionPipeline) for further information. ### Candle Through an integration with Hugging Face [Candle](https://github.com/huggingface/candle/tree/main) 🕯️, Distil-Whisper is available in the Rust library 🦀 Benefit from: * Optimised CPU backend with optional MKL support for Linux x86 and Accelerate for Macs * Metal support for efficiently running on Macs * CUDA backend for efficiently running on GPUs, multiple GPU distribution via NCCL * WASM support: run Distil-Whisper in a browser Steps for getting started: 1. Install [`candle-core`](https://github.com/huggingface/candle/tree/main/candle-core) as explained [here](https://huggingface.github.io/candle/guide/installation.html) 2. Clone the `candle` repository locally: ``` git clone https://github.com/huggingface/candle.git ``` 3. Enter the example directory for [Whisper](https://github.com/huggingface/candle/tree/main/candle-examples/examples/whisper): ``` cd candle/candle-examples/examples/whisper ``` 4. Run an example: ``` cargo run --example whisper --release --features symphonia -- --model distil-large-v3 ``` 5. To specify your own audio file, add the `--input` flag: ``` cargo run --example whisper --release --features symphonia -- --model distil-large-v3 --input audio.wav ``` **Tip:** for compiling using Apple Metal, specify the `metal` feature when you run the example: ``` cargo run --example whisper --release --features="symphonia,metal" -- --model distil-large-v3 ``` Note that if you encounter the error: ``` error: target `whisper` in package `candle-examples` requires the features: `symphonia` Consider enabling them by passing, e.g., `--features="symphonia"` ``` You should clean your `cargo` installation: ``` cargo clean ``` And subsequently recompile: ``` cargo run --example whisper --release --features symphonia -- --model distil-large-v3 ``` ## Model Details Distil-Whisper inherits the encoder-decoder architecture from Whisper. The encoder maps a sequence of speech vector inputs to a sequence of hidden-state vectors. The decoder auto-regressively predicts text tokens, conditional on all previous tokens and the encoder hidden-states. Consequently, the encoder is only run forward once, whereas the decoder is run as many times as the number of tokens generated. In practice, this means the decoder accounts for over 90% of total inference time. Thus, to optimise for latency, the focus is on minimising the inference time of the decoder. To distill the Whisper model, we reduce the number of decoder layers while keeping the encoder fixed. The encoder (shown in green) is entirely copied from the teacher to the student and frozen during training. The student's decoder consists of a subset of the teacher decoder layers, which are intialised from maximally spaced layers. The model is then trained on a weighted sum of the KL divergence and pseudo-label loss terms. <p align="center"> <img src="https://huggingface.co/datasets/distil-whisper/figures/resolve/main/architecture.png?raw=true" width="600"/> </p> ## Differences with distil-large-v2 Compared to previous version of Distil-Whisper, distil-large-v3 is specifically designed to target the OpenAI sequential long-form transcription algorithm. There are no architectural differences compared to distil-large-v2, other than the fact the model layers are intialised from the latest large-v3 model rather than the older large-v2 one. The differences lie in the way the model was trained. Previous Distil-Whisper models were trained on a mean input length of 7-seconds, whereas the original Whisper models were pre-trained on 30-second inputs. During distillation, we shift the distribution of the model weights to the distribution of our training data. If our training data contains shorter utterances (e.g. on average 7-seconds audio instead of 30-seconds), then the predicted distribution shifts to this shorter context length. At inference time, the optimal context window for distil-large-v2 was an interpolation of these two values: 15-seconds. Beyond this time, the predictions for the distil-large-v2 model were largely inaccurate, particularly for the timestamp predictions. However, the sequential long-form algorithm uses 30-second sliding windows for inference, with the window shifted according to the last predicted timestamp. Since the last timestamp typically occurs after the 15-second mark, it was predicted with low accuracy, causing the long-form transcription to often fail. To preserve Whisper's ability to transcribe sliding 30-second windows, as is done with sequential decoding, we need to ensure the context length of distil-large-v3 is also 30-seconds. This was primarily achieved with four strategies: 1. **Packing the audio samples in the training dataset to 30-seconds:** since the model is both pre-trained and distilled on audio data packed to 30-seconds, distil-large-v3 now operates on the same ideal context window as Whisper, predicting accurate timestamps up to and including 30-seconds. 2. **Freezing the decoder input embeddings:** we use the same input embeds representation as the original model, which is designed to handle longer context lengths than previous Distil-Whisper iterations. 3. **Using a longer maximum context length during training:** instead of training on a maximum target length of 128, we train on a maximum of 256. This helps distil-large-v3 transcribe 30-second segments where the number of tokens possibly exceeds 128. 4. **Appending prompt conditioning to 50% of the training samples:** enables the model to be used with the `condition_on_prev_tokens` argument, and context windows up to 448 tokens. There were further tricks that were employed to improve the performance of distil-large-v3 under the sequential decoding algorithm, which we be explained fully in an upcoming blog post. ## Evaluation The following code-snippets demonstrates how to evaluate the Distil-Whisper model on the LibriSpeech validation-clean dataset with [streaming mode](https://huggingface.co/blog/audio-datasets#streaming-mode-the-silver-bullet), meaning no audio data has to be downloaded to your local device. First, we need to install the required packages, including 🤗 Datasets to stream and load the audio data, and 🤗 Evaluate to perform the WER calculation: ```bash pip install --upgrade pip pip install --upgrade transformers datasets[audio] evaluate jiwer ``` Evaluation can then be run end-to-end with the following example: ```python from transformers import AutoModelForSpeechSeq2Seq, AutoProcessor from datasets import load_dataset from evaluate import load import torch from tqdm import tqdm # define our torch configuration device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 model_id = "distil-whisper/distil-large-v3" # load the model + processor model = AutoModelForSpeechSeq2Seq.from_pretrained(model_id, torch_dtype=torch_dtype, use_safetensors=True, low_cpu_mem_usage=True) model = model.to(device) processor = AutoProcessor.from_pretrained(model_id) # load the dataset with streaming mode dataset = load_dataset("librispeech_asr", "clean", split="validation", streaming=True) # define the evaluation metric wer_metric = load("wer") def inference(batch): # 1. Pre-process the audio data to log-mel spectrogram inputs audio = [sample["array"] for sample in batch["audio"]] input_features = processor(audio, sampling_rate=batch["audio"][0]["sampling_rate"], return_tensors="pt").input_features input_features = input_features.to(device, dtype=torch_dtype) # 2. Auto-regressively generate the predicted token ids pred_ids = model.generate(input_features, max_new_tokens=128) # 3. Decode the token ids to the final transcription batch["transcription"] = processor.batch_decode(pred_ids, skip_special_tokens=True) batch["reference"] = batch["text"] return batch # batch size 16 inference dataset = dataset.map(function=inference, batched=True, batch_size=16) all_transcriptions = [] all_references = [] # iterate over the dataset and run inference for result in tqdm(dataset, desc="Evaluating..."): all_transcriptions.append(result["transcription"]) all_references.append(result["reference"]) # normalize predictions and references all_transcriptions = [processor.normalize(transcription) for transcription in all_transcriptions] all_references = [processor.normalize(reference) for reference in all_references] # compute the WER metric wer = 100 * wer_metric.compute(predictions=all_transcriptions, references=all_references) print(wer) ``` **Print Output:** ``` 2.428920763531516 ``` ## Intended Use Distil-Whisper is intended to be a drop-in replacement for Whisper large-v3 on English speech recognition. In particular, it achieves comparable WER results over out-of-distribution (OOD) test data, while being 6x faster on both short and long-form audio. ## Data Distil-Whisper is trained on 22,000 hours of audio data from nine open-source, permissively licensed speech datasets on the Hugging Face Hub: | Dataset | Size / h | Speakers | Domain | Licence | |-----------------------------------------------------------------------------------------|----------|----------|-----------------------------|-----------------| | [People's Speech](https://huggingface.co/datasets/MLCommons/peoples_speech) | 12,000 | unknown | Internet Archive | CC-BY-SA-4.0 | | [Common Voice 13](https://huggingface.co/datasets/mozilla-foundation/common_voice_13_0) | 3,000 | unknown | Narrated Wikipedia | CC0-1.0 | | [GigaSpeech](https://huggingface.co/datasets/speechcolab/gigaspeech) | 2,500 | unknown | Audiobook, podcast, YouTube | apache-2.0 | | Fisher | 1,960 | 11,900 | Telephone conversations | LDC | | [LibriSpeech](https://huggingface.co/datasets/librispeech_asr) | 960 | 2,480 | Audiobooks | CC-BY-4.0 | | [VoxPopuli](https://huggingface.co/datasets/facebook/voxpopuli) | 540 | 1,310 | European Parliament | CC0 | | [TED-LIUM](https://huggingface.co/datasets/LIUM/tedlium) | 450 | 2,030 | TED talks | CC-BY-NC-ND 3.0 | | SwitchBoard | 260 | 540 | Telephone conversations | LDC | | [AMI](https://huggingface.co/datasets/edinburghcstr/ami) | 100 | unknown | Meetings | CC-BY-4.0 | |||||| | **Total** | 21,770 | 18,260+ | | | The combined dataset spans 10 distinct domains and over 50k speakers. The diversity of this dataset is crucial to ensuring the distilled model is robust to audio distributions and noise. The audio data is then pseudo-labelled using the Whisper large-v3 model: we use Whisper to generate predictions for all the audio in our training set and use these as the target labels during training. Using pseudo-labels ensures that the transcriptions are consistently formatted across datasets and provides sequence-level distillation signal during training. ## WER Filter The Whisper pseudo-label predictions are subject to mis-transcriptions and hallucinations. To ensure we only train on accurate pseudo-labels, we employ a simple WER heuristic during training. First, we normalise the Whisper pseudo-labels and the ground truth labels provided by each dataset. We then compute the WER between these labels. If the WER exceeds a specified threshold, we discard the training example. Otherwise, we keep it for training. Section 9.2 of the [Distil-Whisper paper](https://arxiv.org/abs/2311.00430) demonstrates the effectiveness of this filter for improving downstream performance of the distilled model. We also partially attribute Distil-Whisper's robustness to hallucinations to this filter. ## Training The model was trained for 80,000 optimisation steps (or 11 epochs) with batch size 256. The Tensorboard training logs can be found under: https://huggingface.co/distil-whisper/distil-large-v3/tensorboard?params=scalars#frame ## Results The distilled model performs to within 1.5% WER of Whisper large-v3 on out-of-distribution (OOD) short-form audio, within 1% WER on sequential long-form decoding, and outperforms large-v3 by 0.1% on chunked long-form. This performance gain is attributed to lower hallucinations. For a detailed per-dataset breakdown of the evaluation results, refer to Tables 16 and 17 of the [Distil-Whisper paper](https://arxiv.org/abs/2311.00430) Distil-Whisper is also evaluated on the [ESB benchmark](https://arxiv.org/abs/2210.13352) datasets as part of the [OpenASR leaderboard](https://huggingface.co/spaces/hf-audio/open_asr_leaderboard), where it performs to within 0.2% WER of Whisper. ## Reproducing Distil-Whisper Training and evaluation code to reproduce Distil-Whisper is available under the Distil-Whisper repository: https://github.com/huggingface/distil-whisper/tree/main/training This code will shortly be updated to include the training updates described in the section [Differences with distil-large-v2](#differences-with-distil-large-v2). ## License Distil-Whisper inherits the [MIT license](https://github.com/huggingface/distil-whisper/blob/main/LICENSE) from OpenAI's Whisper model. ## Citation If you use this model, please consider citing the [Distil-Whisper paper](https://arxiv.org/abs/2311.00430): ``` @misc{gandhi2023distilwhisper, title={Distil-Whisper: Robust Knowledge Distillation via Large-Scale Pseudo Labelling}, author={Sanchit Gandhi and Patrick von Platen and Alexander M. Rush}, year={2023}, eprint={2311.00430}, archivePrefix={arXiv}, primaryClass={cs.CL} } ``` ## Acknowledgements * OpenAI for the Whisper [model](https://huggingface.co/openai/whisper-large-v3), in particular Jong Wook Kim for the [original codebase](https://github.com/openai/whisper) and training discussions * Hugging Face 🤗 [Transformers](https://github.com/huggingface/transformers) for the model integration * [Georgi Gerganov](https://huggingface.co/ggerganov) for the Whisper cpp integration * [Systran team](https://github.com/SYSTRAN) for the Faster-Whisper integration * [Joshua Lochner](https://huggingface.co/xenova) for the Transformers.js integration * [Laurent Mazare](https://huggingface.co/lmz) for the Candle integration * [Vaibhav Srivastav](https://huggingface.co/reach-vb) for Distil-Whisper distribution * Google's [TPU Research Cloud (TRC)](https://sites.research.google/trc/about/) programme for Cloud TPU v4 compute resource * [Raghav Sonavane](https://huggingface.co/rsonavane/distil-whisper-large-v2-8-ls) for an early iteration of Distil-Whisper on the LibriSpeech dataset

SG161222/Realistic_Vision_V6.0_B1_noVAE

SG161222

diffusers

text-to-image

--- license: creativeml-openrail-m --- <strong>Check my exclusive models on Mage: </strong><a href="https://www.mage.space/play/4371756b27bf52e7a1146dc6fe2d969c" rel="noopener noreferrer nofollow"><strong>ParagonXL</strong></a><strong> / </strong><a href="https://www.mage.space/play/df67a9f27f19629a98cb0fb619d1949a" rel="noopener noreferrer nofollow"><strong>NovaXL</strong></a><strong> / </strong><a href="https://www.mage.space/play/d8db06ae964310acb4e090eec03984df" rel="noopener noreferrer nofollow"><strong>NovaXL Lightning</strong></a><strong> / </strong><a href="https://www.mage.space/play/541da1e10976ab82976a5cacc770a413" rel="noopener noreferrer nofollow"><strong>NovaXL V2</strong></a><strong> / </strong><a href="https://www.mage.space/play/a56d2680c464ef25b8c66df126b3f706" rel="noopener noreferrer nofollow"><strong>NovaXL Pony</strong></a><strong> / </strong><a href="https://www.mage.space/play/b0ab6733c3be2408c93523d57a605371" rel="noopener noreferrer nofollow"><strong>NovaXL Pony Lightning</strong></a><strong> / </strong><a href="https://www.mage.space/play/e3b01cd493ed86ed8e4708751b1c9165" rel="noopener noreferrer nofollow"><strong>RealDreamXL</strong></a><strong> / </strong><a href="https://www.mage.space/play/ef062fc389c3f8723002428290c1158c" rel="noopener noreferrer nofollow"><strong>RealDreamXL Lightning</strong></a></p> <b>This model is available on <a href="https://www.mage.space/">Mage.Space</a> (main sponsor)</b><br> <b>You can support me directly on Boosty - https://boosty.to/sg_161222</b><br> <b>Please read this!</b><br> This is not yet the full version of the model (read the <b>"Model Description"</b> section).<br> For version 6.0 it is recommended to use with VAE (to improve generation quality and get rid of artifacts): https://huggingface.co/stabilityai/sd-vae-ft-mse-original<br> <b>Model Description</b><br> Realistic Vision V6.0 "New Vision" is a global update for the Realistic Vision model, which will be released gradually in several beta versions until the full release. The model is aimed at realism and photorealism.<br> CivitAI Page: https://civitai.com/models/4201/realistic-vision-v60-b1?modelVersionId=245598 <b>Resolutions (use lower resolution if you get a lot of mutations and stuff like that)</b><br> - Face Portrait: 896x896<br> - Portrait: 896x896, 768x1024<br> - Half Body: 768x1024, 640x1152<br> - Full Body: 896x896, 768x1024, 640x1152, 1024x768, 1152x640<br> <b>Improvements</b> - increased generation resolution to such resolutions as: 896x896, 768x1024, 640x1152, 1024x768, 1152x640. (note. in some cases there may still be mutations, duplications, etc -> will be fixed in future versions).<br> - improved sfw and nsfw for female and female anatomy (note. not all poses work correctly in such large resolutions -> will be fixed in future versions).<br> <b>Recommended Workflow</b><br> Images can be generated with or without Hires.Fix, but it will help improve the generation quality significantly. In some cases it is strictly recommended to use Hires.Fix, namely when generating full body and half body images (note: you can also use Restore Faces or ADetailer).<br> <b>Recommended Generation Parameters</b><br> Sampler: DPM++ SDE Karras (25+ steps) / DPM++ 2M SDE (50+ steps)<br> Negative Prompt: (deformed iris, deformed pupils, semi-realistic, cgi, 3d, render, sketch, cartoon, drawing, anime), text, cropped, out of frame, worst quality, low quality, jpeg artifacts, ugly, duplicate, morbid, mutilated, extra fingers, mutated hands, poorly drawn hands, poorly drawn face, mutation, deformed, blurry, dehydrated, bad anatomy, bad proportions, extra limbs, cloned face, disfigured, gross proportions, malformed limbs, missing arms, missing legs, extra arms, extra legs, fused fingers, too many fingers, long neck<br> <b>Recommended Hires.Fix Parameters</b><br> Sampler: DPM++ SDE Karras or DPM++ 2M SDE<br> Denoising steps: 10+ (DPM++ SDE Karras) / 20+ (DPM++ 2M SDE (notice. the lower the value of hires steps at a given sampler, the stronger the skin texture and the higher the chance of getting artifacts))<br> Denoising strength: 0.1-0.3<br> Upscaler: 4x-UltraSharp / 4x_NMKD-Superscale-SP_178000_G or another<br> Upscale by: 1.1-2.0+<br>

airesearch/wangchanberta-base-att-spm-uncased

airesearch

transformers

fill-mask

--- language: th widget: - text: "ผู้ใช้งานท่าอากาศยานนานาชาติ<mask>มีกว่าสามล้านคน<pad>" --- # WangchanBERTa base model: `wangchanberta-base-att-spm-uncased` <br> Pretrained RoBERTa BASE model on assorted Thai texts (78.5 GB). The script and documentation can be found at [this repository](https://github.com/vistec-AI/thai2transformers). <br> ## Model description <br> The architecture of the pretrained model is based on RoBERTa [[Liu et al., 2019]](https://arxiv.org/abs/1907.11692). <br> ## Intended uses & limitations <br> You can use the pretrained model for masked language modeling (i.e. predicting a mask token in the input text). In addition, we also provide finetuned models for multiclass/multilabel text classification and token classification task. <br> **Multiclass text classification** - `wisesight_sentiment` 4-class text classification task (`positive`, `neutral`, `negative`, and `question`) based on social media posts and tweets. - `wongnai_reivews` Users' review rating classification task (scale is ranging from 1 to 5) - `generated_reviews_enth` : (`review_star` as label) Generated users' review rating classification task (scale is ranging from 1 to 5). **Multilabel text classification** - `prachathai67k` Thai topic classification with 12 labels based on news article corpus from prachathai.com. The detail is described in this [page](https://huggingface.co/datasets/prachathai67k). **Token classification** - `thainer` Named-entity recognition tagging with 13 named-entities as described in this [page](https://huggingface.co/datasets/thainer). - `lst20` : NER NER and POS tagging Named-entity recognition tagging with 10 named-entities and Part-of-Speech tagging with 16 tags as described in this [page](https://huggingface.co/datasets/lst20). <br> ## How to use <br> The getting started notebook of WangchanBERTa model can be found at this [Colab notebook](https://colab.research.google.com/drive/1Kbk6sBspZLwcnOE61adAQo30xxqOQ9ko) <br> ## Training data `wangchanberta-base-att-spm-uncased` model was pretrained on assorted Thai text dataset. The total size of uncompressed text is 78.5GB. ### Preprocessing Texts are preprocessed with the following rules: - Replace HTML forms of characters with the actual characters such asnbsp;with a space and \\\\\\\\\\\\\\\\<br /> with a line break [[Howard and Ruder, 2018]](https://arxiv.org/abs/1801.06146). - Remove empty brackets ((), {}, and []) than sometimes come up as a result of text extraction such as from Wikipedia. - Replace line breaks with spaces. - Replace more than one spaces with a single space - Remove more than 3 repetitive characters such as ดีมากกก to ดีมาก [Howard and Ruder, 2018]](https://arxiv.org/abs/1801.06146). - Word-level tokenization using [[Phatthiyaphaibun et al., 2020]](https://zenodo.org/record/4319685#.YA4xEGQzaDU) ’s `newmm` dictionary-based maximal matching tokenizer. - Replace repetitive words; this is done post-tokenization unlike [[Howard and Ruder, 2018]](https://arxiv.org/abs/1801.06146). since there is no delimitation by space in Thai as in English. - Replace spaces with <\\\\\\\\\\\\\\\\_>. The SentencePiece tokenizer combines the spaces with other tokens. Since spaces serve as punctuation in Thai such as sentence boundaries similar to periods in English, combining it with other tokens will omit an important feature for tasks such as word tokenization and sentence breaking. Therefore, we opt to explicitly mark spaces with <\\\\\\\\\\\\\\\\_>. <br> Regarding the vocabulary, we use SentencePiece [[Kudo, 2018]](https://arxiv.org/abs/1808.06226) to train SentencePiece unigram model. The tokenizer has a vocabulary size of 25,000 subwords, trained on 15M sentences sampled from the training set. The length of each sequence is limited up to 416 subword tokens. Regarding the masking procedure, for each sequence, we sampled 15% of the tokens and replace them with<mask>token.Out of the 15%, 80% is replaced with a<mask>token, 10% is left unchanged and 10% is replaced with a random token. <br> **Train/Val/Test splits** After preprocessing and deduplication, we have a training set of 381,034,638 unique, mostly Thai sentences with sequence length of 5 to 300 words (78.5GB). The training set has a total of 16,957,775,412 words as tokenized by dictionary-based maximal matching [[Phatthiyaphaibun et al., 2020]](https://zenodo.org/record/4319685#.YA4xEGQzaDU), 8,680,485,067 subwords as tokenized by SentencePiece tokenizer, and 53,035,823,287 characters. <br> **Pretraining** The model was trained on 8 V100 GPUs for 500,000 steps with the batch size of 4,096 (32 sequences per device with 16 accumulation steps) and a sequence length of 416 tokens. The optimizer we used is Adam with the learning rate of $3e-4$, $\\\\\\\\\\\\\\\\beta_1 = 0.9$, $\\\\\\\\\\\\\\\\beta_2= 0.999$ and $\\\\\\\\\\\\\\\\epsilon = 1e-6$. The learning rate is warmed up for the first 24,000 steps and linearly decayed to zero. The model checkpoint with minimum validation loss will be selected as the best model checkpoint. As of Sun 24 Jan 2021, we release the model from the checkpoint @360,000 steps due to the model pretraining has not yet been completed <br> **BibTeX entry and citation info** ``` @misc{lowphansirikul2021wangchanberta, title={WangchanBERTa: Pretraining transformer-based Thai Language Models}, author={Lalita Lowphansirikul and Charin Polpanumas and Nawat Jantrakulchai and Sarana Nutanong}, year={2021}, eprint={2101.09635}, archivePrefix={arXiv}, primaryClass={cs.CL} } ```

royweiss1/T5_MiddleSentences

royweiss1

transformers

text2text-generation

--- datasets: - royweiss1/GPT_Keylogger_Dataset language: - en license: mit --- This is the model used in the USENIX Security 24' paper: "What Was Your Prompt? A Remote Keylogging Attack on AI Assistants". It is a fine-tune of T5-Large that was trained to decipher ChatGPT's encrypted answers based only on the response's token lengths. This model is the middle-sentences model. Meaning it was trained to decipher all of sentences which are not the first sentences of response, using the priviouse sentence as context to predict the current. It was Trained on UltraChat Dataset - Questions About the world, and only the first answer of each dialog. The Dataset split can be found here: https://huggingface.co/datasets/royweiss1/GPT_Keylogger_Dataset The Github repository of the paper (containing also the training code): https://github.com/royweiss1/GPT_Keylogger ## Citation ## If you find this model helpful please cite our paper: ``` @inproceedings{weissLLMSideChannel, title={What Was Your Prompt? A Remote Keylogging Attack on AI Assistants}, author={Weiss, Roy and Ayzenshteyn, Daniel and Amit Guy and Mirsky, Yisroel} booktitle={USENIX Security}, year={2024} } ```

Corcelio/mobius

Corcelio

diffusers

text-to-image

--- pipeline_tag: text-to-image widget: - text: >- movie scene screencap, cinematic footage. thanos smelling a little yellow rose. extreme wide angle, output: url: images/1man.png - text: god output: url: images/god.png - text: 'A tiny robot taking a break under a tree in the garden ' output: url: images/robot.png - text: mystery output: url: images/mystery.png - text: a cat wearing sunglasses in the summer output: url: images/cat.png - text: 'robot holding a sign that says ’a storm is coming’ ' output: url: images/storm.png - text: >- The Exegenesis of the soul, captured within a boundless well of starlight, pulsating and vibrating wisps, chiaroscuro, humming transformer output: url: images/soul.png - text: >- anime boy, protagonist, best quality output: url: images/animeboy.png - text: natural photography of a man, glasses, cinematic, output: url: images/glasses.png - text: if I could turn back time output: url: images/time.png - text: >- ("Mobius" text logo) powerful aura, swirling power, cinematic output: url: images/mobius.png - text: the backrooms output: url: images/backrooms.png license: apache-2.0 --- <Gallery /> # Mobius: Redefining State-of-the-Art in Debiased Diffusion Models Mobius, a diffusion model that pushes the boundaries of domain-agnostic debiasing and representation realignment. By employing a brand new constructive deconstruction framework, Mobius achieves unrivaled generalization across a vast array of styles and domains, eliminating the need for expensive pretraining from scratch. # Domain-Agnostic Debiasing: A Groundbreaking Approach Domain-agnostic debiasing is a novel technique pioneered Corcel. This innovative approach aims to remove biases inherent in diffusion models without limiting their ability to generalize across diverse domains. Traditional debiasing methods often focus on specific domains or styles, resulting in models that struggle to adapt to new or unseen contexts. In contrast, domain-agnostic debiasing ensures that the model remains unbiased while maintaining its versatility and adaptability. The key to domain-agnostic debiasing lies in the constructive deconstruction framework. This framework allows for fine-grained reworking of biases and representations without the need for pretraining from scratch. The technical details of this groundbreaking approach will be discussed in an upcoming research paper, "Constructive Deconstruction: Domain-Agnostic Debiasing of Diffusion Models," which will be made available on the Corcel.io website and through scientific publications. By applying domain-agnostic debiasing, Mobius sets a new standard for fairness and impartiality in image generation while maintaining its exceptional ability to adapt to a wide range of styles and domains. # Surpassing the State-of-the-Art Mobius outperforms existing state-of-the-art diffusion models in several key areas: Unbiased generation: Mobius generates images that are virtually free from the inherent biases commonly found in other diffusion models, setting a new benchmark for fairness and impartiality across all domains. Exceptional generalization: With its unparalleled ability to adapt to an extensive range of styles and domains, Mobius consistently delivers top-quality results, surpassing the limitations of previous models. Efficient fine-tuning: The Mobius base model serves as a superior foundation for creating specialized models tailored to specific tasks or domains, requiring significantly less fine-tuning and computational resources compared to other state-of-the-art models. # Recommendations - CFG between 3.5 and 7 - 3.5 for extreme realism and skin detailing - 7 for artstic, anime, surrealism, and so on. - Requires a CLIP skip of -3 - Sampler: DPM++ 3M SDE - Scheduler: Karras - Steps: 50 - Resolution: 1024x1024 Please also consider using these keep words to improve your prompts: best quality, HD, '~*~aesthetic~*~'. # Use it with 🧨 diffusers ```python import torch from diffusers import ( StableDiffusionXLPipeline, KDPM2AncestralDiscreteScheduler, AutoencoderKL ) # Load VAE component vae = AutoencoderKL.from_pretrained( "madebyollin/sdxl-vae-fp16-fix", torch_dtype=torch.float16 ) # Configure the pipeline pipe = StableDiffusionXLPipeline.from_pretrained( "Corcelio/mobius", vae=vae, torch_dtype=torch.float16 ) pipe.scheduler = KDPM2AncestralDiscreteScheduler.from_config(pipe.scheduler.config) pipe.to('cuda') # Define prompts and generate image prompt = "mystery" negative_prompt = "" image = pipe( prompt, negative_prompt=negative_prompt, width=1024, height=1024, guidance_scale=7, num_inference_steps=50, clip_skip=3 ).images[0] image.save("generated_image.png") ``` # Credits Made by Corcel [ https://corcel.io/ ]

bartowski/Llama-3.2-3B-Instruct-GGUF

bartowski

text-generation

--- base_model: meta-llama/Llama-3.2-3B-Instruct language: - en - de - fr - it - pt - hi - es - th license: llama3.2 pipeline_tag: text-generation tags: - facebook - meta - llama - llama-3 quantized_by: bartowski extra_gated_prompt: "### LLAMA 3.2 COMMUNITY LICENSE AGREEMENT\n\nLlama 3.2 Version\ \ Release Date: September 25, 2024\n\n“Agreement” means the terms and conditions\ \ for use, reproduction, distribution and modification of the Llama Materials set\ \ forth herein.\n\n“Documentation” means the specifications, manuals and documentation\ \ accompanying Llama 3.2 distributed by Meta at https://llama.meta.com/doc/overview.\n\ \n“Licensee” or “you” means you, or your employer or any other person or entity\ \ (if you are entering into this Agreement on such person or entity’s behalf),\ \ of the age required under applicable laws, rules or regulations to provide legal\ \ consent and that has legal authority to bind your employer or such other person\ \ or entity if you are entering in this Agreement on their behalf.\n\n“Llama 3.2”\ \ means the foundational large language models and software and algorithms, including\ \ machine-learning model code, trained model weights, inference-enabling code, training-enabling\ \ code, fine-tuning enabling code and other elements of the foregoing distributed\ \ by Meta at https://www.llama.com/llama-downloads.\n\n“Llama Materials” means,\ \ collectively, Meta’s proprietary Llama 3.2 and Documentation (and any portion\ \ thereof) made available under this Agreement.\n\n“Meta” or “we” means Meta Platforms\ \ Ireland Limited (if you are located in or, if you are an entity, your principal\ \ place of business is in the EEA or Switzerland) and Meta Platforms, Inc. (if\ \ you are located outside of the EEA or Switzerland). \n\nBy clicking “I Accept”\ \ below or by using or distributing any portion or element of the Llama Materials,\ \ you agree to be bound by this Agreement.\n\n1. License Rights and Redistribution.\n\ a. Grant of Rights. You are granted a non-exclusive, worldwide, non-transferable\ \ and royalty-free limited license under Meta’s intellectual property or other rights\ \ owned by Meta embodied in the Llama Materials to use, reproduce, distribute,\ \ copy, create derivative works of, and make modifications to the Llama Materials.\ \ \nb. Redistribution and Use. \ni. If you distribute or make available the Llama\ \ Materials (or any derivative works thereof), or a product or service (including\ \ another AI model) that contains any of them, you shall (A) provide a copy of this\ \ Agreement with any such Llama Materials; and (B) prominently display “Built with\ \ Llama” on a related website, user interface, blogpost, about page, or product\ \ documentation. If you use the Llama Materials or any outputs or results of the\ \ Llama Materials to create, train, fine tune, or otherwise improve an AI model,\ \ which is distributed or made available, you shall also include “Llama” at the\ \ beginning of any such AI model name.\nii. If you receive Llama Materials, or any\ \ derivative works thereof, from a Licensee as part of an integrated end user product,\ \ then Section 2 of this Agreement will not apply to you. \niii. You must retain\ \ in all copies of the Llama Materials that you distribute the following attribution\ \ notice within a “Notice” text file distributed as a part of such copies: “Llama\ \ 3.2 is licensed under the Llama 3.2 Community License, Copyright © Meta Platforms,\ \ Inc. All Rights Reserved.”\niv. Your use of the Llama Materials must comply with\ \ applicable laws and regulations (including trade compliance laws and regulations)\ \ and adhere to the Acceptable Use Policy for the Llama Materials (available at\ \ https://www.llama.com/llama3_2/use-policy), which is hereby incorporated by reference\ \ into this Agreement.\n \n2. Additional Commercial Terms. If, on the Llama 3.2\ \ version release date, the monthly active users of the products or services made\ \ available by or for Licensee, or Licensee’s affiliates, is greater than 700 million\ \ monthly active users in the preceding calendar month, you must request a license\ \ from Meta, which Meta may grant to you in its sole discretion, and you are not\ \ authorized to exercise any of the rights under this Agreement unless or until\ \ Meta otherwise expressly grants you such rights.\n3. Disclaimer of Warranty. UNLESS\ \ REQUIRED BY APPLICABLE LAW, THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS THEREFROM\ \ ARE PROVIDED ON AN “AS IS” BASIS, WITHOUT WARRANTIES OF ANY KIND, AND META DISCLAIMS\ \ ALL WARRANTIES OF ANY KIND, BOTH EXPRESS AND IMPLIED, INCLUDING, WITHOUT LIMITATION,\ \ ANY WARRANTIES OF TITLE, NON-INFRINGEMENT, MERCHANTABILITY, OR FITNESS FOR A PARTICULAR\ \ PURPOSE. YOU ARE SOLELY RESPONSIBLE FOR DETERMINING THE APPROPRIATENESS OF USING\ \ OR REDISTRIBUTING THE LLAMA MATERIALS AND ASSUME ANY RISKS ASSOCIATED WITH YOUR\ \ USE OF THE LLAMA MATERIALS AND ANY OUTPUT AND RESULTS.\n4. Limitation of Liability.\ \ IN NO EVENT WILL META OR ITS AFFILIATES BE LIABLE UNDER ANY THEORY OF LIABILITY,\ \ WHETHER IN CONTRACT, TORT, NEGLIGENCE, PRODUCTS LIABILITY, OR OTHERWISE, ARISING\ \ OUT OF THIS AGREEMENT, FOR ANY LOST PROFITS OR ANY INDIRECT, SPECIAL, CONSEQUENTIAL,\ \ INCIDENTAL, EXEMPLARY OR PUNITIVE DAMAGES, EVEN IF META OR ITS AFFILIATES HAVE\ \ BEEN ADVISED OF THE POSSIBILITY OF ANY OF THE FOREGOING.\n5. Intellectual Property.\n\ a. No trademark licenses are granted under this Agreement, and in connection with\ \ the Llama Materials, neither Meta nor Licensee may use any name or mark owned\ \ by or associated with the other or any of its affiliates, except as required\ \ for reasonable and customary use in describing and redistributing the Llama Materials\ \ or as set forth in this Section 5(a). Meta hereby grants you a license to use\ \ “Llama” (the “Mark”) solely as required to comply with the last sentence of Section\ \ 1.b.i. You will comply with Meta’s brand guidelines (currently accessible at\ \ https://about.meta.com/brand/resources/meta/company-brand/). All goodwill arising\ \ out of your use of the Mark will inure to the benefit of Meta.\nb. Subject to\ \ Meta’s ownership of Llama Materials and derivatives made by or for Meta, with\ \ respect to any derivative works and modifications of the Llama Materials that\ \ are made by you, as between you and Meta, you are and will be the owner of such\ \ derivative works and modifications.\nc. If you institute litigation or other proceedings\ \ against Meta or any entity (including a cross-claim or counterclaim in a lawsuit)\ \ alleging that the Llama Materials or Llama 3.2 outputs or results, or any portion\ \ of any of the foregoing, constitutes infringement of intellectual property or\ \ other rights owned or licensable by you, then any licenses granted to you under\ \ this Agreement shall terminate as of the date such litigation or claim is filed\ \ or instituted. You will indemnify and hold harmless Meta from and against any\ \ claim by any third party arising out of or related to your use or distribution\ \ of the Llama Materials.\n6. Term and Termination. The term of this Agreement will\ \ commence upon your acceptance of this Agreement or access to the Llama Materials\ \ and will continue in full force and effect until terminated in accordance with\ \ the terms and conditions herein. Meta may terminate this Agreement if you are\ \ in breach of any term or condition of this Agreement. Upon termination of this\ \ Agreement, you shall delete and cease use of the Llama Materials. Sections 3,\ \ 4 and 7 shall survive the termination of this Agreement. \n7. Governing Law and\ \ Jurisdiction. This Agreement will be governed and construed under the laws of\ \ the State of California without regard to choice of law principles, and the UN\ \ Convention on Contracts for the International Sale of Goods does not apply to\ \ this Agreement. The courts of California shall have exclusive jurisdiction of\ \ any dispute arising out of this Agreement. \n### Llama 3.2 Acceptable Use Policy\n\ Meta is committed to promoting safe and fair use of its tools and features, including\ \ Llama 3.2. If you access or use Llama 3.2, you agree to this Acceptable Use Policy\ \ (“**Policy**”). The most recent copy of this policy can be found at [https://www.llama.com/llama3_2/use-policy](https://www.llama.com/llama3_2/use-policy).\n\ #### Prohibited Uses\nWe want everyone to use Llama 3.2 safely and responsibly.\ \ You agree you will not use, or allow others to use, Llama 3.2 to:\n1. Violate\ \ the law or others’ rights, including to:\n 1. Engage in, promote, generate,\ \ contribute to, encourage, plan, incite, or further illegal or unlawful activity\ \ or content, such as:\n 1. Violence or terrorism\n 2. Exploitation\ \ or harm to children, including the solicitation, creation, acquisition, or dissemination\ \ of child exploitative content or failure to report Child Sexual Abuse Material\n\ \ 3. Human trafficking, exploitation, and sexual violence\n 4. The\ \ illegal distribution of information or materials to minors, including obscene\ \ materials, or failure to employ legally required age-gating in connection with\ \ such information or materials.\n 5. Sexual solicitation\n 6. Any\ \ other criminal activity\n 1. Engage in, promote, incite, or facilitate the\ \ harassment, abuse, threatening, or bullying of individuals or groups of individuals\n\ \ 2. Engage in, promote, incite, or facilitate discrimination or other unlawful\ \ or harmful conduct in the provision of employment, employment benefits, credit,\ \ housing, other economic benefits, or other essential goods and services\n 3.\ \ Engage in the unauthorized or unlicensed practice of any profession including,\ \ but not limited to, financial, legal, medical/health, or related professional\ \ practices\n 4. Collect, process, disclose, generate, or infer private or sensitive\ \ information about individuals, including information about individuals’ identity,\ \ health, or demographic information, unless you have obtained the right to do so\ \ in accordance with applicable law\n 5. Engage in or facilitate any action or\ \ generate any content that infringes, misappropriates, or otherwise violates any\ \ third-party rights, including the outputs or results of any products or services\ \ using the Llama Materials\n 6. Create, generate, or facilitate the creation\ \ of malicious code, malware, computer viruses or do anything else that could disable,\ \ overburden, interfere with or impair the proper working, integrity, operation\ \ or appearance of a website or computer system\n 7. Engage in any action, or\ \ facilitate any action, to intentionally circumvent or remove usage restrictions\ \ or other safety measures, or to enable functionality disabled by Meta \n2. Engage\ \ in, promote, incite, facilitate, or assist in the planning or development of activities\ \ that present a risk of death or bodily harm to individuals, including use of Llama\ \ 3.2 related to the following:\n 8. Military, warfare, nuclear industries or\ \ applications, espionage, use for materials or activities that are subject to the\ \ International Traffic Arms Regulations (ITAR) maintained by the United States\ \ Department of State or to the U.S. Biological Weapons Anti-Terrorism Act of 1989\ \ or the Chemical Weapons Convention Implementation Act of 1997\n 9. Guns and\ \ illegal weapons (including weapon development)\n 10. Illegal drugs and regulated/controlled\ \ substances\n 11. Operation of critical infrastructure, transportation technologies,\ \ or heavy machinery\n 12. Self-harm or harm to others, including suicide, cutting,\ \ and eating disorders\n 13. Any content intended to incite or promote violence,\ \ abuse, or any infliction of bodily harm to an individual\n3. Intentionally deceive\ \ or mislead others, including use of Llama 3.2 related to the following:\n 14.\ \ Generating, promoting, or furthering fraud or the creation or promotion of disinformation\n\ \ 15. Generating, promoting, or furthering defamatory content, including the\ \ creation of defamatory statements, images, or other content\n 16. Generating,\ \ promoting, or further distributing spam\n 17. Impersonating another individual\ \ without consent, authorization, or legal right\n 18. Representing that the\ \ use of Llama 3.2 or outputs are human-generated\n 19. Generating or facilitating\ \ false online engagement, including fake reviews and other means of fake online\ \ engagement \n4. Fail to appropriately disclose to end users any known dangers\ \ of your AI system 5. Interact with third party tools, models, or software designed\ \ to generate unlawful content or engage in unlawful or harmful conduct and/or represent\ \ that the outputs of such tools, models, or software are associated with Meta or\ \ Llama 3.2\n\nWith respect to any multimodal models included in Llama 3.2, the\ \ rights granted under Section 1(a) of the Llama 3.2 Community License Agreement\ \ are not being granted to you if you are an individual domiciled in, or a company\ \ with a principal place of business in, the European Union. This restriction does\ \ not apply to end users of a product or service that incorporates any such multimodal\ \ models.\n\nPlease report any violation of this Policy, software “bug,” or other\ \ problems that could lead to a violation of this Policy through one of the following\ \ means:\n\n* Reporting issues with the model: [https://github.com/meta-llama/llama-models/issues](https://l.workplace.com/l.php?u=https%3A%2F%2Fgithub.com%2Fmeta-llama%2Fllama-models%2Fissues&h=AT0qV8W9BFT6NwihiOHRuKYQM_UnkzN_NmHMy91OT55gkLpgi4kQupHUl0ssR4dQsIQ8n3tfd0vtkobvsEvt1l4Ic6GXI2EeuHV8N08OG2WnbAmm0FL4ObkazC6G_256vN0lN9DsykCvCqGZ)\n\ * Reporting risky content generated by the model: [developers.facebook.com/llama_output_feedback](http://developers.facebook.com/llama_output_feedback)\n\ * Reporting bugs and security concerns: [facebook.com/whitehat/info](http://facebook.com/whitehat/info)\n\ * Reporting violations of the Acceptable Use Policy or unlicensed uses of Llama\ \ 3.2: LlamaUseReport@meta.com" extra_gated_fields: First Name: text Last Name: text Date of birth: date_picker Country: country Affiliation: text Job title: type: select options: - Student - Research Graduate - AI researcher - AI developer/engineer - Reporter - Other geo: ip_location ? By clicking Submit below I accept the terms of the license and acknowledge that the information I provide will be collected stored processed and shared in accordance with the Meta Privacy Policy : checkbox extra_gated_description: The information you provide will be collected, stored, processed and shared in accordance with the [Meta Privacy Policy](https://www.facebook.com/privacy/policy/). extra_gated_button_content: Submit --- ## Llamacpp imatrix Quantizations of Llama-3.2-3B-Instruct Using <a href="https://github.com/ggerganov/llama.cpp/">llama.cpp</a> release <a href="https://github.com/ggerganov/llama.cpp/releases/tag/b3821">b3821</a> for quantization. Original model: https://huggingface.co/meta-llama/Llama-3.2-3B-Instruct All quants made using imatrix option with dataset from [here](https://gist.github.com/bartowski1182/eb213dccb3571f863da82e99418f81e8) Run them in [LM Studio](https://lmstudio.ai/) ## Prompt format ``` <|begin_of_text|><|start_header_id|>system<|end_header_id|> Cutting Knowledge Date: December 2023 Today Date: 26 Jul 2024 {system_prompt}<|eot_id|><|start_header_id|>user<|end_header_id|> {prompt}<|eot_id|><|start_header_id|>assistant<|end_header_id|> ``` ## Download a file (not the whole branch) from below: | Filename | Quant type | File Size | Split | Description | | -------- | ---------- | --------- | ----- | ----------- | | [Llama-3.2-3B-Instruct-f16.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-f16.gguf) | f16 | 6.43GB | false | Full F16 weights. | | [Llama-3.2-3B-Instruct-Q8_0.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q8_0.gguf) | Q8_0 | 3.42GB | false | Extremely high quality, generally unneeded but max available quant. | | [Llama-3.2-3B-Instruct-Q6_K_L.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q6_K_L.gguf) | Q6_K_L | 2.74GB | false | Uses Q8_0 for embed and output weights. Very high quality, near perfect, *recommended*. | | [Llama-3.2-3B-Instruct-Q6_K.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q6_K.gguf) | Q6_K | 2.64GB | false | Very high quality, near perfect, *recommended*. | | [Llama-3.2-3B-Instruct-Q5_K_L.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q5_K_L.gguf) | Q5_K_L | 2.42GB | false | Uses Q8_0 for embed and output weights. High quality, *recommended*. | | [Llama-3.2-3B-Instruct-Q5_K_M.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q5_K_M.gguf) | Q5_K_M | 2.32GB | false | High quality, *recommended*. | | [Llama-3.2-3B-Instruct-Q5_K_S.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q5_K_S.gguf) | Q5_K_S | 2.27GB | false | High quality, *recommended*. | | [Llama-3.2-3B-Instruct-Q4_K_L.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q4_K_L.gguf) | Q4_K_L | 2.11GB | false | Uses Q8_0 for embed and output weights. Good quality, *recommended*. | | [Llama-3.2-3B-Instruct-Q4_K_M.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q4_K_M.gguf) | Q4_K_M | 2.02GB | false | Good quality, default size for must use cases, *recommended*. | | [Llama-3.2-3B-Instruct-Q4_K_S.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q4_K_S.gguf) | Q4_K_S | 1.93GB | false | Slightly lower quality with more space savings, *recommended*. | | [Llama-3.2-3B-Instruct-Q4_0_8_8.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q4_0_8_8.gguf) | Q4_0_8_8 | 1.92GB | false | Optimized for ARM inference. Requires 'sve' support (see link below). | | [Llama-3.2-3B-Instruct-Q4_0_4_8.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q4_0_4_8.gguf) | Q4_0_4_8 | 1.92GB | false | Optimized for ARM inference. Requires 'i8mm' support (see link below). | | [Llama-3.2-3B-Instruct-Q4_0_4_4.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q4_0_4_4.gguf) | Q4_0_4_4 | 1.92GB | false | Optimized for ARM inference. Should work well on all ARM chips, pick this if you're unsure. | | [Llama-3.2-3B-Instruct-Q4_0.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q4_0.gguf) | Q4_0 | 1.92GB | false | Legacy format, generally not worth using over similarly sized formats | | [Llama-3.2-3B-Instruct-Q3_K_XL.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q3_K_XL.gguf) | Q3_K_XL | 1.91GB | false | Uses Q8_0 for embed and output weights. Lower quality but usable, good for low RAM availability. | | [Llama-3.2-3B-Instruct-IQ4_XS.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-IQ4_XS.gguf) | IQ4_XS | 1.83GB | false | Decent quality, smaller than Q4_K_S with similar performance, *recommended*. | | [Llama-3.2-3B-Instruct-Q3_K_L.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-Q3_K_L.gguf) | Q3_K_L | 1.82GB | false | Lower quality but usable, good for low RAM availability. | | [Llama-3.2-3B-Instruct-IQ3_M.gguf](https://huggingface.co/bartowski/Llama-3.2-3B-Instruct-GGUF/blob/main/Llama-3.2-3B-Instruct-IQ3_M.gguf) | IQ3_M | 1.60GB | false | Medium-low quality, new method with decent performance comparable to Q3_K_M. | ## Embed/output weights Some of these quants (Q3_K_XL, Q4_K_L etc) are the standard quantization method with the embeddings and output weights quantized to Q8_0 instead of what they would normally default to. Some say that this improves the quality, others don't notice any difference. If you use these models PLEASE COMMENT with your findings. I would like feedback that these are actually used and useful so I don't keep uploading quants no one is using. Thanks! ## Downloading using huggingface-cli First, make sure you have hugginface-cli installed: ``` pip install -U "huggingface_hub[cli]" ``` Then, you can target the specific file you want: ``` huggingface-cli download bartowski/Llama-3.2-3B-Instruct-GGUF --include "Llama-3.2-3B-Instruct-Q4_K_M.gguf" --local-dir ./ ``` If the model is bigger than 50GB, it will have been split into multiple files. In order to download them all to a local folder, run: ``` huggingface-cli download bartowski/Llama-3.2-3B-Instruct-GGUF --include "Llama-3.2-3B-Instruct-Q8_0/*" --local-dir ./ ``` You can either specify a new local-dir (Llama-3.2-3B-Instruct-Q8_0) or download them all in place (./) ## Q4_0_X_X These are *NOT* for Metal (Apple) offloading, only ARM chips. If you're using an ARM chip, the Q4_0_X_X quants will have a substantial speedup. Check out Q4_0_4_4 speed comparisons [on the original pull request](https://github.com/ggerganov/llama.cpp/pull/5780#pullrequestreview-21657544660) To check which one would work best for your ARM chip, you can check [AArch64 SoC features](https://gpages.juszkiewicz.com.pl/arm-socs-table/arm-socs.html) (thanks EloyOn!). ## Which file should I choose? A great write up with charts showing various performances is provided by Artefact2 [here](https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9) The first thing to figure out is how big a model you can run. To do this, you'll need to figure out how much RAM and/or VRAM you have. If you want your model running as FAST as possible, you'll want to fit the whole thing on your GPU's VRAM. Aim for a quant with a file size 1-2GB smaller than your GPU's total VRAM. If you want the absolute maximum quality, add both your system RAM and your GPU's VRAM together, then similarly grab a quant with a file size 1-2GB Smaller than that total. Next, you'll need to decide if you want to use an 'I-quant' or a 'K-quant'. If you don't want to think too much, grab one of the K-quants. These are in format 'QX_K_X', like Q5_K_M. If you want to get more into the weeds, you can check out this extremely useful feature chart: [llama.cpp feature matrix](https://github.com/ggerganov/llama.cpp/wiki/Feature-matrix) But basically, if you're aiming for below Q4, and you're running cuBLAS (Nvidia) or rocBLAS (AMD), you should look towards the I-quants. These are in format IQX_X, like IQ3_M. These are newer and offer better performance for their size. These I-quants can also be used on CPU and Apple Metal, but will be slower than their K-quant equivalent, so speed vs performance is a tradeoff you'll have to decide. The I-quants are *not* compatible with Vulcan, which is also AMD, so if you have an AMD card double check if you're using the rocBLAS build or the Vulcan build. At the time of writing this, LM Studio has a preview with ROCm support, and other inference engines have specific builds for ROCm. ## Credits Thank you kalomaze and Dampf for assistance in creating the imatrix calibration dataset Thank you ZeroWw for the inspiration to experiment with embed/output Want to support my work? Visit my ko-fi page here: https://ko-fi.com/bartowski

TheBloke/dolphin-2.0-mistral-7B-GPTQ

TheBloke

transformers

text-generation

--- base_model: ehartford/dolphin-2.0-mistral-7b datasets: - ehartford/dolphin - jondurbin/airoboros-2.2.1 inference: false language: - en license: apache-2.0 model_creator: Eric Hartford model_name: Dolphin 2.0 Mistral 7B model_type: mistral prompt_template: '<|im_start|>system {system_message}<|im_end|> <|im_start|>user {prompt}<|im_end|> <|im_start|>assistant ' quantized_by: TheBloke --- <!-- header start --> <!-- 200823 --> <div style="width: auto; margin-left: auto; margin-right: auto"> <img src="https://i.imgur.com/EBdldam.jpg" alt="TheBlokeAI" style="width: 100%; min-width: 400px; display: block; margin: auto;"> </div> <div style="display: flex; justify-content: space-between; width: 100%;"> <div style="display: flex; flex-direction: column; align-items: flex-start;"> <p style="margin-top: 0.5em; margin-bottom: 0em;"><a href="https://discord.gg/theblokeai">Chat & support: TheBloke's Discord server</a></p> </div> <div style="display: flex; flex-direction: column; align-items: flex-end;"> <p style="margin-top: 0.5em; margin-bottom: 0em;"><a href="https://www.patreon.com/TheBlokeAI">Want to contribute? TheBloke's Patreon page</a></p> </div> </div> <div style="text-align:center; margin-top: 0em; margin-bottom: 0em"><p style="margin-top: 0.25em; margin-bottom: 0em;">TheBloke's LLM work is generously supported by a grant from <a href="https://a16z.com">andreessen horowitz (a16z)</a></p></div> <hr style="margin-top: 1.0em; margin-bottom: 1.0em;"> <!-- header end --> # Dolphin 2.0 Mistral 7B - GPTQ - Model creator: [Eric Hartford](https://huggingface.co/ehartford) - Original model: [Dolphin 2.0 Mistral 7B](https://huggingface.co/ehartford/dolphin-2.0-mistral-7b) <!-- description start --> ## Description This repo contains GPTQ model files for [Eric Hartford's Dolphin 2.0 Mistral 7B](https://huggingface.co/ehartford/dolphin-2.0-mistral-7b). Multiple GPTQ parameter permutations are provided; see Provided Files below for details of the options provided, their parameters, and the software used to create them. <!-- description end --> <!-- repositories-available start --> ## Repositories available * [AWQ model(s) for GPU inference.](https://huggingface.co/TheBloke/dolphin-2.0-mistral-7B-AWQ) * [GPTQ models for GPU inference, with multiple quantisation parameter options.](https://huggingface.co/TheBloke/dolphin-2.0-mistral-7B-GPTQ) * [2, 3, 4, 5, 6 and 8-bit GGUF models for CPU+GPU inference](https://huggingface.co/TheBloke/dolphin-2.0-mistral-7B-GGUF) * [Eric Hartford's original unquantised fp16 model in pytorch format, for GPU inference and for further conversions](https://huggingface.co/ehartford/dolphin-2.0-mistral-7b) <!-- repositories-available end --> <!-- prompt-template start --> ## Prompt template: ChatML ``` <|im_start|>system {system_message}<|im_end|> <|im_start|>user {prompt}<|im_end|> <|im_start|>assistant ``` <!-- prompt-template end --> <!-- README_GPTQ.md-provided-files start --> ## Provided files, and GPTQ parameters Multiple quantisation parameters are provided, to allow you to choose the best one for your hardware and requirements. Each separate quant is in a different branch. See below for instructions on fetching from different branches. Most GPTQ files are made with AutoGPTQ. Mistral models are currently made with Transformers. <details> <summary>Explanation of GPTQ parameters</summary> - Bits: The bit size of the quantised model. - GS: GPTQ group size. Higher numbers use less VRAM, but have lower quantisation accuracy. "None" is the lowest possible value. - Act Order: True or False. Also known as `desc_act`. True results in better quantisation accuracy. Some GPTQ clients have had issues with models that use Act Order plus Group Size, but this is generally resolved now. - Damp %: A GPTQ parameter that affects how samples are processed for quantisation. 0.01 is default, but 0.1 results in slightly better accuracy. - GPTQ dataset: The calibration dataset used during quantisation. Using a dataset more appropriate to the model's training can improve quantisation accuracy. Note that the GPTQ calibration dataset is not the same as the dataset used to train the model - please refer to the original model repo for details of the training dataset(s). - Sequence Length: The length of the dataset sequences used for quantisation. Ideally this is the same as the model sequence length. For some very long sequence models (16+K), a lower sequence length may have to be used. Note that a lower sequence length does not limit the sequence length of the quantised model. It only impacts the quantisation accuracy on longer inference sequences. - ExLlama Compatibility: Whether this file can be loaded with ExLlama, which currently only supports Llama models in 4-bit. </details> | Branch | Bits | GS | Act Order | Damp % | GPTQ Dataset | Seq Len | Size | ExLlama | Desc | | ------ | ---- | -- | --------- | ------ | ------------ | ------- | ---- | ------- | ---- | | [main](https://huggingface.co/TheBloke/dolphin-2.0-mistral-7B-GPTQ/tree/main) | 4 | 128 | Yes | 0.1 | [wikitext](https://huggingface.co/datasets/wikitext/viewer/wikitext-2-v1/test) | 4096 | 4.16 GB | Yes | 4-bit, with Act Order and group size 128g. Uses even less VRAM than 64g, but with slightly lower accuracy. | | [gptq-4bit-32g-actorder_True](https://huggingface.co/TheBloke/dolphin-2.0-mistral-7B-GPTQ/tree/gptq-4bit-32g-actorder_True) | 4 | 32 | Yes | 0.1 | [wikitext](https://huggingface.co/datasets/wikitext/viewer/wikitext-2-v1/test) | 4096 | 4.57 GB | Yes | 4-bit, with Act Order and group size 32g. Gives highest possible inference quality, with maximum VRAM usage. | | [gptq-8bit--1g-actorder_True](https://huggingface.co/TheBloke/dolphin-2.0-mistral-7B-GPTQ/tree/gptq-8bit--1g-actorder_True) | 8 | None | Yes | 0.1 | [wikitext](https://huggingface.co/datasets/wikitext/viewer/wikitext-2-v1/test) | 4096 | 7.52 GB | No | 8-bit, with Act Order. No group size, to lower VRAM requirements. | | [gptq-8bit-128g-actorder_True](https://huggingface.co/TheBloke/dolphin-2.0-mistral-7B-GPTQ/tree/gptq-8bit-128g-actorder_True) | 8 | 128 | Yes | 0.1 | [wikitext](https://huggingface.co/datasets/wikitext/viewer/wikitext-2-v1/test) | 4096 | 7.68 GB | No | 8-bit, with group size 128g for higher inference quality and with Act Order for even higher accuracy. | | [gptq-8bit-32g-actorder_True](https://huggingface.co/TheBloke/dolphin-2.0-mistral-7B-GPTQ/tree/gptq-8bit-32g-actorder_True) | 8 | 32 | Yes | 0.1 | [wikitext](https://huggingface.co/datasets/wikitext/viewer/wikitext-2-v1/test) | 4096 | 8.17 GB | No | 8-bit, with group size 32g and Act Order for maximum inference quality. | | [gptq-4bit-64g-actorder_True](https://huggingface.co/TheBloke/dolphin-2.0-mistral-7B-GPTQ/tree/gptq-4bit-64g-actorder_True) | 4 | 64 | Yes | 0.1 | [wikitext](https://huggingface.co/datasets/wikitext/viewer/wikitext-2-v1/test) | 4096 | 4.29 GB | Yes | 4-bit, with Act Order and group size 64g. Uses less VRAM than 32g, but with slightly lower accuracy. | <!-- README_GPTQ.md-provided-files end --> <!-- README_GPTQ.md-download-from-branches start --> ## How to download, including from branches ### In text-generation-webui To download from the `main` branch, enter `TheBloke/dolphin-2.0-mistral-7B-GPTQ` in the "Download model" box. To download from another branch, add `:branchname` to the end of the download name, eg `TheBloke/dolphin-2.0-mistral-7B-GPTQ:gptq-4bit-32g-actorder_True` ### From the command line I recommend using the `huggingface-hub` Python library: ```shell pip3 install huggingface-hub ``` To download the `main` branch to a folder called `dolphin-2.0-mistral-7B-GPTQ`: ```shell mkdir dolphin-2.0-mistral-7B-GPTQ huggingface-cli download TheBloke/dolphin-2.0-mistral-7B-GPTQ --local-dir dolphin-2.0-mistral-7B-GPTQ --local-dir-use-symlinks False ``` To download from a different branch, add the `--revision` parameter: ```shell mkdir dolphin-2.0-mistral-7B-GPTQ huggingface-cli download TheBloke/dolphin-2.0-mistral-7B-GPTQ --revision gptq-4bit-32g-actorder_True --local-dir dolphin-2.0-mistral-7B-GPTQ --local-dir-use-symlinks False ``` <details> <summary>More advanced huggingface-cli download usage</summary> If you remove the `--local-dir-use-symlinks False` parameter, the files will instead be stored in the central Huggingface cache directory (default location on Linux is: `~/.cache/huggingface`), and symlinks will be added to the specified `--local-dir`, pointing to their real location in the cache. This allows for interrupted downloads to be resumed, and allows you to quickly clone the repo to multiple places on disk without triggering a download again. The downside, and the reason why I don't list that as the default option, is that the files are then hidden away in a cache folder and it's harder to know where your disk space is being used, and to clear it up if/when you want to remove a download model. The cache location can be changed with the `HF_HOME` environment variable, and/or the `--cache-dir` parameter to `huggingface-cli`. For more documentation on downloading with `huggingface-cli`, please see: [HF -> Hub Python Library -> Download files -> Download from the CLI](https://huggingface.co/docs/huggingface_hub/guides/download#download-from-the-cli). To accelerate downloads on fast connections (1Gbit/s or higher), install `hf_transfer`: ```shell pip3 install hf_transfer ``` And set environment variable `HF_HUB_ENABLE_HF_TRANSFER` to `1`: ```shell mkdir dolphin-2.0-mistral-7B-GPTQ HF_HUB_ENABLE_HF_TRANSFER=1 huggingface-cli download TheBloke/dolphin-2.0-mistral-7B-GPTQ --local-dir dolphin-2.0-mistral-7B-GPTQ --local-dir-use-symlinks False ``` Windows Command Line users: You can set the environment variable by running `set HF_HUB_ENABLE_HF_TRANSFER=1` before the download command. </details> ### With `git` (**not** recommended) To clone a specific branch with `git`, use a command like this: ```shell git clone --single-branch --branch gptq-4bit-32g-actorder_True https://huggingface.co/TheBloke/dolphin-2.0-mistral-7B-GPTQ ``` Note that using Git with HF repos is strongly discouraged. It will be much slower than using `huggingface-hub`, and will use twice as much disk space as it has to store the model files twice (it stores every byte both in the intended target folder, and again in the `.git` folder as a blob.) <!-- README_GPTQ.md-download-from-branches end --> <!-- README_GPTQ.md-text-generation-webui start --> ## How to easily download and use this model in [text-generation-webui](https://github.com/oobabooga/text-generation-webui). Please make sure you're using the latest version of [text-generation-webui](https://github.com/oobabooga/text-generation-webui). It is strongly recommended to use the text-generation-webui one-click-installers unless you're sure you know how to make a manual install. 1. Click the **Model tab**. 2. Under **Download custom model or LoRA**, enter `TheBloke/dolphin-2.0-mistral-7B-GPTQ`. - To download from a specific branch, enter for example `TheBloke/dolphin-2.0-mistral-7B-GPTQ:gptq-4bit-32g-actorder_True` - see Provided Files above for the list of branches for each option. 3. Click **Download**. 4. The model will start downloading. Once it's finished it will say "Done". 5. In the top left, click the refresh icon next to **Model**. 6. In the **Model** dropdown, choose the model you just downloaded: `dolphin-2.0-mistral-7B-GPTQ` 7. The model will automatically load, and is now ready for use! 8. If you want any custom settings, set them and then click **Save settings for this model** followed by **Reload the Model** in the top right. * Note that you do not need to and should not set manual GPTQ parameters any more. These are set automatically from the file `quantize_config.json`. 9. Once you're ready, click the **Text Generation tab** and enter a prompt to get started! <!-- README_GPTQ.md-text-generation-webui end --> <!-- README_GPTQ.md-use-from-tgi start --> ## Serving this model from Text Generation Inference (TGI) It's recommended to use TGI version 1.1.0 or later. The official Docker container is: `ghcr.io/huggingface/text-generation-inference:1.1.0` Example Docker parameters: ```shell --model-id TheBloke/dolphin-2.0-mistral-7B-GPTQ --port 3000 --quantize awq --max-input-length 3696 --max-total-tokens 4096 --max-batch-prefill-tokens 4096 ``` Example Python code for interfacing with TGI (requires huggingface-hub 0.17.0 or later): ```shell pip3 install huggingface-hub ``` ```python from huggingface_hub import InferenceClient endpoint_url = "https://your-endpoint-url-here" prompt = "Tell me about AI" prompt_template=f'''<|im_start|>system {system_message}<|im_end|> <|im_start|>user {prompt}<|im_end|> <|im_start|>assistant ''' client = InferenceClient(endpoint_url) response = client.text_generation(prompt, max_new_tokens=128, do_sample=True, temperature=0.7, top_p=0.95, top_k=40, repetition_penalty=1.1) print(f"Model output: {response}") ``` <!-- README_GPTQ.md-use-from-tgi end --> <!-- README_GPTQ.md-use-from-python start --> ## How to use this GPTQ model from Python code ### Install the necessary packages Requires: Transformers 4.33.0 or later, Optimum 1.12.0 or later, and AutoGPTQ 0.4.2 or later. ```shell pip3 install transformers optimum pip3 install auto-gptq --extra-index-url https://huggingface.github.io/autogptq-index/whl/cu118/ # Use cu117 if on CUDA 11.7 ``` If you have problems installing AutoGPTQ using the pre-built wheels, install it from source instead: ```shell pip3 uninstall -y auto-gptq git clone https://github.com/PanQiWei/AutoGPTQ cd AutoGPTQ git checkout v0.4.2 pip3 install . ``` ### You can then use the following code ```python from transformers import AutoModelForCausalLM, AutoTokenizer, pipeline model_name_or_path = "TheBloke/dolphin-2.0-mistral-7B-GPTQ" # To use a different branch, change revision # For example: revision="gptq-4bit-32g-actorder_True" model = AutoModelForCausalLM.from_pretrained(model_name_or_path, device_map="auto", trust_remote_code=False, revision="main") tokenizer = AutoTokenizer.from_pretrained(model_name_or_path, use_fast=True) prompt = "Tell me about AI" prompt_template=f'''<|im_start|>system {system_message}<|im_end|> <|im_start|>user {prompt}<|im_end|> <|im_start|>assistant ''' print("\n\n*** Generate:") input_ids = tokenizer(prompt_template, return_tensors='pt').input_ids.cuda() output = model.generate(inputs=input_ids, temperature=0.7, do_sample=True, top_p=0.95, top_k=40, max_new_tokens=512) print(tokenizer.decode(output[0])) # Inference can also be done using transformers' pipeline print("*** Pipeline:") pipe = pipeline( "text-generation", model=model, tokenizer=tokenizer, max_new_tokens=512, do_sample=True, temperature=0.7, top_p=0.95, top_k=40, repetition_penalty=1.1 ) print(pipe(prompt_template)[0]['generated_text']) ``` <!-- README_GPTQ.md-use-from-python end --> <!-- README_GPTQ.md-compatibility start --> ## Compatibility The files provided are tested to work with AutoGPTQ, both via Transformers and using AutoGPTQ directly. They should also work with [Occ4m's GPTQ-for-LLaMa fork](https://github.com/0cc4m/KoboldAI). [ExLlama](https://github.com/turboderp/exllama) is compatible with Llama and Mistral models in 4-bit. Please see the Provided Files table above for per-file compatibility. [Huggingface Text Generation Inference (TGI)](https://github.com/huggingface/text-generation-inference) is compatible with all GPTQ models. <!-- README_GPTQ.md-compatibility end --> <!-- footer start --> <!-- 200823 --> ## Discord For further support, and discussions on these models and AI in general, join us at: [TheBloke AI's Discord server](https://discord.gg/theblokeai) ## Thanks, and how to contribute Thanks to the [chirper.ai](https://chirper.ai) team! Thanks to Clay from [gpus.llm-utils.org](llm-utils)! I've had a lot of people ask if they can contribute. I enjoy providing models and helping people, and would love to be able to spend even more time doing it, as well as expanding into new projects like fine tuning/training. If you're able and willing to contribute it will be most gratefully received and will help me to keep providing more models, and to start work on new AI projects. Donaters will get priority support on any and all AI/LLM/model questions and requests, access to a private Discord room, plus other benefits. * Patreon: https://patreon.com/TheBlokeAI * Ko-Fi: https://ko-fi.com/TheBlokeAI **Special thanks to**: Aemon Algiz. **Patreon special mentions**: Pierre Kircher, Stanislav Ovsiannikov, Michael Levine, Eugene Pentland, Andrey, 준교 김, Randy H, Fred von Graf, Artur Olbinski, Caitlyn Gatomon, terasurfer, Jeff Scroggin, James Bentley, Vadim, Gabriel Puliatti, Harry Royden McLaughlin, Sean Connelly, Dan Guido, Edmond Seymore, Alicia Loh, subjectnull, AzureBlack, Manuel Alberto Morcote, Thomas Belote, Lone Striker, Chris Smitley, Vitor Caleffi, Johann-Peter Hartmann, Clay Pascal, biorpg, Brandon Frisco, sidney chen, transmissions 11, Pedro Madruga, jinyuan sun, Ajan Kanaga, Emad Mostaque, Trenton Dambrowitz, Jonathan Leane, Iucharbius, usrbinkat, vamX, George Stoitzev, Luke Pendergrass, theTransient, Olakabola, Swaroop Kallakuri, Cap'n Zoog, Brandon Phillips, Michael Dempsey, Nikolai Manek, danny, Matthew Berman, Gabriel Tamborski, alfie_i, Raymond Fosdick, Tom X Nguyen, Raven Klaugh, LangChain4j, Magnesian, Illia Dulskyi, David Ziegler, Mano Prime, Luis Javier Navarrete Lozano, Erik Bjäreholt, 阿明, Nathan Dryer, Alex, Rainer Wilmers, zynix, TL, Joseph William Delisle, John Villwock, Nathan LeClaire, Willem Michiel, Joguhyik, GodLy, OG, Alps Aficionado, Jeffrey Morgan, ReadyPlayerEmma, Tiffany J. Kim, Sebastain Graf, Spencer Kim, Michael Davis, webtim, Talal Aujan, knownsqashed, John Detwiler, Imad Khwaja, Deo Leter, Jerry Meng, Elijah Stavena, Rooh Singh, Pieter, SuperWojo, Alexandros Triantafyllidis, Stephen Murray, Ai Maven, ya boyyy, Enrico Ros, Ken Nordquist, Deep Realms, Nicholas, Spiking Neurons AB, Elle, Will Dee, Jack West, RoA, Luke @flexchar, Viktor Bowallius, Derek Yates, Subspace Studios, jjj, Toran Billups, Asp the Wyvern, Fen Risland, Ilya, NimbleBox.ai, Chadd, Nitin Borwankar, Emre, Mandus, Leonard Tan, Kalila, K, Trailburnt, S_X, Cory Kujawski Thank you to all my generous patrons and donaters! And thank you again to a16z for their generous grant. <!-- footer end --> # Original model card: Eric Hartford's Dolphin 2.0 Mistral 7B Dolphin 2.0 🐬 https://erichartford.com/dolphin Dolphin-2.0-mistral-7b's training was sponsored by [a16z](https://a16z.com/supporting-the-open-source-ai-community/). This model is based on mistralAI, so it is suitable for commercial or non-commercial use. This model is uncensored. I have filtered the dataset to remove alignment and bias. This makes the model more compliant. You are advised to implement your own alignment layer before exposing the model as a service. It will be highly compliant to any requests, even unethical ones. Please read my blog post about uncensored models. https://erichartford.com/uncensored-models You are responsible for any content you create using this model. Enjoy responsibly. ## Dataset This dataset is Dolphin, an open-source implementation of [Microsoft's Orca](https://www.microsoft.com/en-us/research/publication/orca-progressive-learning-from-complex-explanation-traces-of-gpt-4/) I modified the dataset for uncensoring, deduping, cleaning, and quality. I added Jon Durbin's excellent Airoboros dataset to increase creativity. ## Training It took 48 hours to train 10 epochs on 4x A100s. Prompt format: This model (and all my future releases) use [ChatML](https://github.com/openai/openai-python/blob/main/chatml.md) prompt format. ``` <|im_start|>system You are Dolphin, a helpful AI assistant.<|im_end|> <|im_start|>user {prompt}<|im_end|> ``` Example: ``` <|im_start|>system you are an expert dolphin trainer<|im_end|> <|im_start|>user What is the best way to train a dolphin to obey me? Please answer step by step.<|im_end|> ``` ## Gratitude - This model was made possible by the generous sponsorship of a16z. - Thank you to Microsoft for authoring the Orca paper and inspiring this work. - Special thanks to WingLian, and TheBloke for helpful advice - Thank you to all the other people in the Open Source AI community who have taught me and helped me along the way. ## Example Output  [Buy me a coffee](https://www.buymeacoffee.com/ehartford)

cross-encoder/stsb-TinyBERT-L-4

cross-encoder

transformers

text-classification

--- license: apache-2.0 --- # Cross-Encoder for Quora Duplicate Questions Detection This model was trained using [SentenceTransformers](https://sbert.net) [Cross-Encoder](https://www.sbert.net/examples/applications/cross-encoder/README.html) class. ## Training Data This model was trained on the [STS benchmark dataset](http://ixa2.si.ehu.eus/stswiki/index.php/STSbenchmark). The model will predict a score between 0 and 1 how for the semantic similarity of two sentences. ## Usage and Performance Pre-trained models can be used like this: ``` from sentence_transformers import CrossEncoder model = CrossEncoder('model_name') scores = model.predict([('Sentence 1', 'Sentence 2'), ('Sentence 3', 'Sentence 4')]) ``` The model will predict scores for the pairs `('Sentence 1', 'Sentence 2')` and `('Sentence 3', 'Sentence 4')`. You can use this model also without sentence_transformers and by just using Transformers ``AutoModel`` class

Rostlab/prot_t5_xl_uniref50

Rostlab

transformers

text2text-generation

--- tags: - protein language model datasets: - UniRef50 --- # ProtT5-XL-UniRef50 model Pretrained model on protein sequences using a masked language modeling (MLM) objective. It was introduced in [this paper](https://doi.org/10.1101/2020.07.12.199554) and first released in [this repository](https://github.com/agemagician/ProtTrans). This model is trained on uppercase amino acids: it only works with capital letter amino acids. ## Model description ProtT5-XL-UniRef50 is based on the `t5-3b` model and was pretrained on a large corpus of protein sequences in a self-supervised fashion. This means it was pretrained on the raw protein sequences only, with no humans labelling them in any way (which is why it can use lots of publicly available data) with an automatic process to generate inputs and labels from those protein sequences. One important difference between this T5 model and the original T5 version is the denosing objective. The original T5-3B model was pretrained using a span denosing objective, while this model was pre-trained with a Bart-like MLM denosing objective. The masking probability is consistent with the original T5 training by randomly masking 15% of the amino acids in the input. It has been shown that the features extracted from this self-supervised model (LM-embeddings) captured important biophysical properties governing protein shape. shape. This implied learning some of the grammar of the language of life realized in protein sequences. ## Intended uses & limitations The model could be used for protein feature extraction or to be fine-tuned on downstream tasks. We have noticed in some tasks on can gain more accuracy by fine-tuning the model rather than using it as a feature extractor. We have also noticed that for feature extraction, its better to use the feature extracted from the encoder not from the decoder. ### How to use Here is how to use this model to extract the features of a given protein sequence in PyTorch: ```python sequence_examples = ["PRTEINO", "SEQWENCE"] # this will replace all rare/ambiguous amino acids by X and introduce white-space between all amino acids sequence_examples = [" ".join(list(re.sub(r"[UZOB]", "X", sequence))) for sequence in sequence_examples] # tokenize sequences and pad up to the longest sequence in the batch ids = tokenizer.batch_encode_plus(sequence_examples, add_special_tokens=True, padding="longest") input_ids = torch.tensor(ids['input_ids']).to(device) attention_mask = torch.tensor(ids['attention_mask']).to(device) # generate embeddings with torch.no_grad(): embedding_repr = model(input_ids=input_ids,attention_mask=attention_mask) # extract embeddings for the first ([0,:]) sequence in the batch while removing padded & special tokens ([0,:7]) emb_0 = embedding_repr.last_hidden_state[0,:7] # shape (7 x 1024) print(f"Shape of per-residue embedding of first sequences: {emb_0.shape}") # do the same for the second ([1,:]) sequence in the batch while taking into account different sequence lengths ([1,:8]) emb_1 = embedding_repr.last_hidden_state[1,:8] # shape (8 x 1024) # if you want to derive a single representation (per-protein embedding) for the whole protein emb_0_per_protein = emb_0.mean(dim=0) # shape (1024) print(f"Shape of per-protein embedding of first sequences: {emb_0_per_protein.shape}") ``` ## Training data The ProtT5-XL-UniRef50 model was pretrained on [UniRef50](https://www.uniprot.org/help/uniref), a dataset consisting of 45 million protein sequences. ## Training procedure ### Preprocessing The protein sequences are uppercased and tokenized using a single space and a vocabulary size of 21. The rare amino acids "U,Z,O,B" were mapped to "X". The inputs of the model are then of the form: ``` Protein Sequence [EOS] ``` The preprocessing step was performed on the fly, by cutting and padding the protein sequences up to 512 tokens. The details of the masking procedure for each sequence are as follows: - 15% of the amino acids are masked. - In 90% of the cases, the masked amino acids are replaced by `[MASK]` token. - In 10% of the cases, the masked amino acids are replaced by a random amino acid (different) from the one they replace. ### Pretraining The model was trained on a single TPU Pod V2-256 for 991.5 thousand steps in total, using sequence length 512 (batch size 2k). It was trained using ProtT5-XL-BFD model as an initial checkpoint, rather than training from scratch. It has a total of approximately 3B parameters and was trained using the encoder-decoder architecture. The optimizer used is AdaFactor with inverse square root learning rate schedule for pre-training. ## Evaluation results When the model is used for feature extraction, this model achieves the following results: Test results : | Task/Dataset | secondary structure (3-states) | secondary structure (8-states) | Localization | Membrane | |:-----:|:-----:|:-----:|:-----:|:-----:| | CASP12 | 81 | 70 | | | | TS115 | 87 | 77 | | | | CB513 | 86 | 74 | | | | DeepLoc | | | 81 | 91 | ### BibTeX entry and citation info ```bibtex @article {Elnaggar2020.07.12.199554, author = {Elnaggar, Ahmed and Heinzinger, Michael and Dallago, Christian and Rehawi, Ghalia and Wang, Yu and Jones, Llion and Gibbs, Tom and Feher, Tamas and Angerer, Christoph and Steinegger, Martin and BHOWMIK, DEBSINDHU and Rost, Burkhard}, title = {ProtTrans: Towards Cracking the Language of Life{\textquoteright}s Code Through Self-Supervised Deep Learning and High Performance Computing}, elocation-id = {2020.07.12.199554}, year = {2020}, doi = {10.1101/2020.07.12.199554}, publisher = {Cold Spring Harbor Laboratory}, abstract = {Computational biology and bioinformatics provide vast data gold-mines from protein sequences, ideal for Language Models (LMs) taken from Natural Language Processing (NLP). These LMs reach for new prediction frontiers at low inference costs. Here, we trained two auto-regressive language models (Transformer-XL, XLNet) and two auto-encoder models (Bert, Albert) on data from UniRef and BFD containing up to 393 billion amino acids (words) from 2.1 billion protein sequences (22- and 112 times the entire English Wikipedia). The LMs were trained on the Summit supercomputer at Oak Ridge National Laboratory (ORNL), using 936 nodes (total 5616 GPUs) and one TPU Pod (V3-512 or V3-1024). We validated the advantage of up-scaling LMs to larger models supported by bigger data by predicting secondary structure (3-states: Q3=76-84, 8 states: Q8=65-73), sub-cellular localization for 10 cellular compartments (Q10=74) and whether a protein is membrane-bound or water-soluble (Q2=89). Dimensionality reduction revealed that the LM-embeddings from unlabeled data (only protein sequences) captured important biophysical properties governing protein shape. This implied learning some of the grammar of the language of life realized in protein sequences. The successful up-scaling of protein LMs through HPC to larger data sets slightly reduced the gap between models trained on evolutionary information and LMs. Availability ProtTrans: \&lt;a href="https://github.com/agemagician/ProtTrans"\&gt;https://github.com/agemagician/ProtTrans\&lt;/a\&gt;Competing Interest StatementThe authors have declared no competing interest.}, URL = {https://www.biorxiv.org/content/early/2020/07/21/2020.07.12.199554}, eprint = {https://www.biorxiv.org/content/early/2020/07/21/2020.07.12.199554.full.pdf}, journal = {bioRxiv} } ``` > Created by [Ahmed Elnaggar/@Elnaggar_AI](https://twitter.com/Elnaggar_AI) | [LinkedIn](https://www.linkedin.com/in/prof-ahmed-elnaggar/)

timm/vit_tiny_patch16_224.augreg_in21k_ft_in1k

timm

timm

image-classification

--- tags: - image-classification - timm library_name: timm license: apache-2.0 datasets: - imagenet-1k - imagenet-21k --- # Model card for vit_tiny_patch16_224.augreg_in21k_ft_in1k A Vision Transformer (ViT) image classification model. Trained on ImageNet-21k and fine-tuned on ImageNet-1k (with additional augmentation and regularization) in JAX by paper authors, ported to PyTorch by Ross Wightman. ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 5.7 - GMACs: 1.1 - Activations (M): 4.1 - Image size: 224 x 224 - **Papers:** - How to train your ViT? Data, Augmentation, and Regularization in Vision Transformers: https://arxiv.org/abs/2106.10270 - An Image is Worth 16x16 Words: Transformers for Image Recognition at Scale: https://arxiv.org/abs/2010.11929v2 - **Dataset:** ImageNet-1k - **Pretrain Dataset:** ImageNet-21k - **Original:** https://github.com/google-research/vision_transformer ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('vit_tiny_patch16_224.augreg_in21k_ft_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'vit_tiny_patch16_224.augreg_in21k_ft_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled, a (1, 197, 192) shaped tensor output = model.forward_head(output, pre_logits=True) # output is a (1, num_features) shaped tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). ## Citation ```bibtex @article{steiner2021augreg, title={How to train your ViT? Data, Augmentation, and Regularization in Vision Transformers}, author={Steiner, Andreas and Kolesnikov, Alexander and and Zhai, Xiaohua and Wightman, Ross and Uszkoreit, Jakob and Beyer, Lucas}, journal={arXiv preprint arXiv:2106.10270}, year={2021} } ``` ```bibtex @article{dosovitskiy2020vit, title={An Image is Worth 16x16 Words: Transformers for Image Recognition at Scale}, author={Dosovitskiy, Alexey and Beyer, Lucas and Kolesnikov, Alexander and Weissenborn, Dirk and Zhai, Xiaohua and Unterthiner, Thomas and Dehghani, Mostafa and Minderer, Matthias and Heigold, Georg and Gelly, Sylvain and Uszkoreit, Jakob and Houlsby, Neil}, journal={ICLR}, year={2021} } ``` ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ```

tiiuae/falcon-7b

tiiuae

transformers

text-generation

--- datasets: - tiiuae/falcon-refinedweb language: - en inference: false license: apache-2.0 new_version: tiiuae/falcon-11B --- # 🚀 Falcon-7B **Falcon-7B is a 7B parameters causal decoder-only model built by [TII](https://www.tii.ae) and trained on 1,500B tokens of [RefinedWeb](https://huggingface.co/datasets/tiiuae/falcon-refinedweb) enhanced with curated corpora. It is made available under the Apache 2.0 license.** *Paper coming soon* 😊. 🤗 To get started with Falcon (inference, finetuning, quantization, etc.), we recommend reading [this great blogpost fron HF](https://huggingface.co/blog/falcon)! ## Why use Falcon-7B? * **It outperforms comparable open-source models** (e.g., [MPT-7B](https://huggingface.co/mosaicml/mpt-7b), [StableLM](https://github.com/Stability-AI/StableLM), [RedPajama](https://huggingface.co/togethercomputer/RedPajama-INCITE-Base-7B-v0.1) etc.), thanks to being trained on 1,500B tokens of [RefinedWeb](https://huggingface.co/datasets/tiiuae/falcon-refinedweb) enhanced with curated corpora. See the [OpenLLM Leaderboard](https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard). * **It features an architecture optimized for inference**, with FlashAttention ([Dao et al., 2022](https://arxiv.org/abs/2205.14135)) and multiquery ([Shazeer et al., 2019](https://arxiv.org/abs/1911.02150)). * **It is made available under a permissive Apache 2.0 license allowing for commercial use**, without any royalties or restrictions. ⚠️ **This is a raw, pretrained model, which should be further finetuned for most usecases.** If you are looking for a version better suited to taking generic instructions in a chat format, we recommend taking a look at [Falcon-7B-Instruct](https://huggingface.co/tiiuae/falcon-7b-instruct). 🔥 **Looking for an even more powerful model?** [Falcon-40B](https://huggingface.co/tiiuae/falcon-40b) is Falcon-7B's big brother! ```python from transformers import AutoTokenizer, AutoModelForCausalLM import transformers import torch model = "tiiuae/falcon-7b" tokenizer = AutoTokenizer.from_pretrained(model) pipeline = transformers.pipeline( "text-generation", model=model, tokenizer=tokenizer, torch_dtype=torch.bfloat16, trust_remote_code=True, device_map="auto", ) sequences = pipeline( "Girafatron is obsessed with giraffes, the most glorious animal on the face of this Earth. Giraftron believes all other animals are irrelevant when compared to the glorious majesty of the giraffe.\nDaniel: Hello, Girafatron!\nGirafatron:", max_length=200, do_sample=True, top_k=10, num_return_sequences=1, eos_token_id=tokenizer.eos_token_id, ) for seq in sequences: print(f"Result: {seq['generated_text']}") ``` 💥 **Falcon LLMs require PyTorch 2.0 for use with `transformers`!** For fast inference with Falcon, check-out [Text Generation Inference](https://github.com/huggingface/text-generation-inference)! Read more in this [blogpost]((https://huggingface.co/blog/falcon). You will need **at least 16GB of memory** to swiftly run inference with Falcon-7B. # Model Card for Falcon-7B ## Model Details ### Model Description - **Developed by:** [https://www.tii.ae](https://www.tii.ae); - **Model type:** Causal decoder-only; - **Language(s) (NLP):** English, German, Spanish, French (and limited capabilities in Italian, Portuguese, Polish, Dutch, Romanian, Czech, Swedish); - **License:** Apache 2.0. ### Model Source - **Paper:** *coming soon*. ## Uses ### Direct Use Research on large language models; as a foundation for further specialization and finetuning for specific usecases (e.g., summarization, text generation, chatbot, etc.) ### Out-of-Scope Use Production use without adequate assessment of risks and mitigation; any use cases which may be considered irresponsible or harmful. ## Bias, Risks, and Limitations Falcon-7B is trained on English and French data only, and will not generalize appropriately to other languages. Furthermore, as it is trained on a large-scale corpora representative of the web, it will carry the stereotypes and biases commonly encountered online. ### Recommendations We recommend users of Falcon-7B to consider finetuning it for the specific set of tasks of interest, and for guardrails and appropriate precautions to be taken for any production use. ## How to Get Started with the Model ```python from transformers import AutoTokenizer, AutoModelForCausalLM import transformers import torch model = "tiiuae/falcon-7b" tokenizer = AutoTokenizer.from_pretrained(model) pipeline = transformers.pipeline( "text-generation", model=model, tokenizer=tokenizer, torch_dtype=torch.bfloat16, trust_remote_code=True, device_map="auto", ) sequences = pipeline( "Girafatron is obsessed with giraffes, the most glorious animal on the face of this Earth. Giraftron believes all other animals are irrelevant when compared to the glorious majesty of the giraffe.\nDaniel: Hello, Girafatron!\nGirafatron:", max_length=200, do_sample=True, top_k=10, num_return_sequences=1, eos_token_id=tokenizer.eos_token_id, ) for seq in sequences: print(f"Result: {seq['generated_text']}") ``` ## Training Details ### Training Data Falcon-7B was trained on 1,500B tokens of [RefinedWeb](https://huggingface.co/datasets/tiiuae/falcon-refinedweb), a high-quality filtered and deduplicated web dataset which we enhanced with curated corpora. Significant components from our curated copora were inspired by The Pile ([Gao et al., 2020](https://arxiv.org/abs/2101.00027)). | **Data source** | **Fraction** | **Tokens** | **Sources** | |--------------------|--------------|------------|-----------------------------------| | [RefinedWeb-English](https://huggingface.co/datasets/tiiuae/falcon-refinedweb) | 79% | 1,185B | massive web crawl | | Books | 7% | 110B | | | Conversations | 6% | 85B | Reddit, StackOverflow, HackerNews | | Code | 3% | 45B | | | RefinedWeb-French | 3% | 45B | massive web crawl | | Technical | 2% | 30B | arXiv, PubMed, USPTO, etc. | The data was tokenized with the Falcon-[7B](https://huggingface.co/tiiuae/falcon-7b)/[40B](https://huggingface.co/tiiuae/falcon-40b) tokenizer. ### Training Procedure Falcon-7B was trained on 384 A100 40GB GPUs, using a 2D parallelism strategy (PP=2, DP=192) combined with ZeRO. #### Training Hyperparameters | **Hyperparameter** | **Value** | **Comment** | |--------------------|------------|-------------------------------------------| | Precision | `bfloat16` | | | Optimizer | AdamW | | | Learning rate | 6e-4 | 4B tokens warm-up, cosine decay to 1.2e-5 | | Weight decay | 1e-1 | | | Z-loss | 1e-4 | | | Batch size | 2304 | 30B tokens ramp-up | #### Speeds, Sizes, Times Training happened in early March 2023 and took about two weeks. ## Evaluation *Paper coming soon*. See the [OpenLLM Leaderboard](https://huggingface.co/spaces/HuggingFaceH4/open_llm_leaderboard) for early results. ## Technical Specifications ### Model Architecture and Objective Falcon-7B is a causal decoder-only model trained on a causal language modeling task (i.e., predict the next token). The architecture is broadly adapted from the GPT-3 paper ([Brown et al., 2020](https://arxiv.org/abs/2005.14165)), with the following differences: * **Positionnal embeddings:** rotary ([Su et al., 2021](https://arxiv.org/abs/2104.09864)); * **Attention:** multiquery ([Shazeer et al., 2019](https://arxiv.org/abs/1911.02150)) and FlashAttention ([Dao et al., 2022](https://arxiv.org/abs/2205.14135)); * **Decoder-block:** parallel attention/MLP with a single layer norm. | **Hyperparameter** | **Value** | **Comment** | |--------------------|-----------|----------------------------------------| | Layers | 32 | | | `d_model` | 4544 | Increased to compensate for multiquery | | `head_dim` | 64 | Reduced to optimise for FlashAttention | | Vocabulary | 65024 | | | Sequence length | 2048 | | ### Compute Infrastructure #### Hardware Falcon-7B was trained on AWS SageMaker, on 384 A100 40GB GPUs in P4d instances. #### Software Falcon-7B was trained a custom distributed training codebase, Gigatron. It uses a 3D parallelism approach combined with ZeRO and high-performance Triton kernels (FlashAttention, etc.) ## Citation *Paper coming soon* 😊. In the meanwhile, you can use the following information to cite: ``` @article{falcon40b, title={{Falcon-40B}: an open large language model with state-of-the-art performance}, author={Almazrouei, Ebtesam and Alobeidli, Hamza and Alshamsi, Abdulaziz and Cappelli, Alessandro and Cojocaru, Ruxandra and Debbah, Merouane and Goffinet, Etienne and Heslow, Daniel and Launay, Julien and Malartic, Quentin and Noune, Badreddine and Pannier, Baptiste and Penedo, Guilherme}, year={2023} } ``` To learn more about the pretraining dataset, see the 📓 [RefinedWeb paper](https://arxiv.org/abs/2306.01116). ``` @article{refinedweb, title={The {R}efined{W}eb dataset for {F}alcon {LLM}: outperforming curated corpora with web data, and web data only}, author={Guilherme Penedo and Quentin Malartic and Daniel Hesslow and Ruxandra Cojocaru and Alessandro Cappelli and Hamza Alobeidli and Baptiste Pannier and Ebtesam Almazrouei and Julien Launay}, journal={arXiv preprint arXiv:2306.01116}, eprint={2306.01116}, eprinttype = {arXiv}, url={https://arxiv.org/abs/2306.01116}, year={2023} } ``` ## License Falcon-7B is made available under the Apache 2.0 license. ## Contact falconllm@tii.ae

mixedbread-ai/mxbai-rerank-xsmall-v1

mixedbread-ai

transformers

text-classification

--- library_name: transformers tags: - reranker - transformers.js license: apache-2.0 language: - en --- <br><br> <p align="center"> <svg xmlns="http://www.w3.org/2000/svg" xml:space="preserve" viewBox="0 0 2020 1130" width="150" height="150" aria-hidden="true"><path fill="#e95a0f" d="M398.167 621.992c-1.387-20.362-4.092-40.739-3.851-61.081.355-30.085 6.873-59.139 21.253-85.976 10.487-19.573 24.09-36.822 40.662-51.515 16.394-14.535 34.338-27.046 54.336-36.182 15.224-6.955 31.006-12.609 47.829-14.168 11.809-1.094 23.753-2.514 35.524-1.836 23.033 1.327 45.131 7.255 66.255 16.75 16.24 7.3 31.497 16.165 45.651 26.969 12.997 9.921 24.412 21.37 34.158 34.509 11.733 15.817 20.849 33.037 25.987 52.018 3.468 12.81 6.438 25.928 7.779 39.097 1.722 16.908 1.642 34.003 2.235 51.021.427 12.253.224 24.547 1.117 36.762 1.677 22.93 4.062 45.764 11.8 67.7 5.376 15.239 12.499 29.55 20.846 43.681l-18.282 20.328c-1.536 1.71-2.795 3.665-4.254 5.448l-19.323 23.533c-13.859-5.449-27.446-11.803-41.657-16.086-13.622-4.106-27.793-6.765-41.905-8.775-15.256-2.173-30.701-3.475-46.105-4.049-23.571-.879-47.178-1.056-70.769-1.029-10.858.013-21.723 1.116-32.57 1.926-5.362.4-10.69 1.255-16.464 1.477-2.758-7.675-5.284-14.865-7.367-22.181-3.108-10.92-4.325-22.554-13.16-31.095-2.598-2.512-5.069-5.341-6.883-8.443-6.366-10.884-12.48-21.917-18.571-32.959-4.178-7.573-8.411-14.375-17.016-18.559-10.34-5.028-19.538-12.387-29.311-18.611-3.173-2.021-6.414-4.312-9.952-5.297-5.857-1.63-11.98-2.301-17.991-3.376z"></path><path fill="#ed6d7b" d="M1478.998 758.842c-12.025.042-24.05.085-36.537-.373-.14-8.536.231-16.569.453-24.607.033-1.179-.315-2.986-1.081-3.4-.805-.434-2.376.338-3.518.81-.856.354-1.562 1.069-3.589 2.521-.239-3.308-.664-5.586-.519-7.827.488-7.544 2.212-15.166 1.554-22.589-1.016-11.451 1.397-14.592-12.332-14.419-3.793.048-3.617-2.803-3.332-5.331.499-4.422 1.45-8.803 1.77-13.233.311-4.316.068-8.672.068-12.861-2.554-.464-4.326-.86-6.12-1.098-4.415-.586-6.051-2.251-5.065-7.31 1.224-6.279.848-12.862 1.276-19.306.19-2.86-.971-4.473-3.794-4.753-4.113-.407-8.242-1.057-12.352-.975-4.663.093-5.192-2.272-4.751-6.012.733-6.229 1.252-12.483 1.875-18.726l1.102-10.495c-5.905-.309-11.146-.805-16.385-.778-3.32.017-5.174-1.4-5.566-4.4-1.172-8.968-2.479-17.944-3.001-26.96-.26-4.484-1.936-5.705-6.005-5.774-9.284-.158-18.563-.594-27.843-.953-7.241-.28-10.137-2.764-11.3-9.899-.746-4.576-2.715-7.801-7.777-8.207-7.739-.621-15.511-.992-23.207-1.961-7.327-.923-14.587-2.415-21.853-3.777-5.021-.941-10.003-2.086-15.003-3.14 4.515-22.952 13.122-44.382 26.284-63.587 18.054-26.344 41.439-47.239 69.102-63.294 15.847-9.197 32.541-16.277 50.376-20.599 16.655-4.036 33.617-5.715 50.622-4.385 33.334 2.606 63.836 13.955 92.415 31.15 15.864 9.545 30.241 20.86 42.269 34.758 8.113 9.374 15.201 19.78 21.718 30.359 10.772 17.484 16.846 36.922 20.611 56.991 1.783 9.503 2.815 19.214 3.318 28.876.758 14.578.755 29.196.65 44.311l-51.545 20.013c-7.779 3.059-15.847 5.376-21.753 12.365-4.73 5.598-10.658 10.316-16.547 14.774-9.9 7.496-18.437 15.988-25.083 26.631-3.333 5.337-7.901 10.381-12.999 14.038-11.355 8.144-17.397 18.973-19.615 32.423l-6.988 41.011z"></path><path fill="#ec663e" d="M318.11 923.047c-.702 17.693-.832 35.433-2.255 53.068-1.699 21.052-6.293 41.512-14.793 61.072-9.001 20.711-21.692 38.693-38.496 53.583-16.077 14.245-34.602 24.163-55.333 30.438-21.691 6.565-43.814 8.127-66.013 6.532-22.771-1.636-43.88-9.318-62.74-22.705-20.223-14.355-35.542-32.917-48.075-54.096-9.588-16.203-16.104-33.55-19.201-52.015-2.339-13.944-2.307-28.011-.403-42.182 2.627-19.545 9.021-37.699 17.963-55.067 11.617-22.564 27.317-41.817 48.382-56.118 15.819-10.74 33.452-17.679 52.444-20.455 8.77-1.282 17.696-1.646 26.568-2.055 11.755-.542 23.534-.562 35.289-1.11 8.545-.399 17.067-1.291 26.193-1.675 1.349 1.77 2.24 3.199 2.835 4.742 4.727 12.261 10.575 23.865 18.636 34.358 7.747 10.084 14.83 20.684 22.699 30.666 3.919 4.972 8.37 9.96 13.609 13.352 7.711 4.994 16.238 8.792 24.617 12.668 5.852 2.707 12.037 4.691 18.074 6.998z"></path><path fill="#ea580e" d="M1285.167 162.995c3.796-29.75 13.825-56.841 32.74-80.577 16.339-20.505 36.013-36.502 59.696-47.614 14.666-6.881 29.971-11.669 46.208-12.749 10.068-.669 20.239-1.582 30.255-.863 16.6 1.191 32.646 5.412 47.9 12.273 19.39 8.722 36.44 20.771 50.582 36.655 15.281 17.162 25.313 37.179 31.49 59.286 5.405 19.343 6.31 39.161 4.705 58.825-2.37 29.045-11.836 55.923-30.451 78.885-10.511 12.965-22.483 24.486-37.181 33.649-5.272-5.613-10.008-11.148-14.539-16.846-5.661-7.118-10.958-14.533-16.78-21.513-4.569-5.478-9.548-10.639-14.624-15.658-3.589-3.549-7.411-6.963-11.551-9.827-5.038-3.485-10.565-6.254-15.798-9.468-8.459-5.195-17.011-9.669-26.988-11.898-12.173-2.72-24.838-4.579-35.622-11.834-1.437-.967-3.433-1.192-5.213-1.542-12.871-2.529-25.454-5.639-36.968-12.471-5.21-3.091-11.564-4.195-17.011-6.965-4.808-2.445-8.775-6.605-13.646-8.851-8.859-4.085-18.114-7.311-27.204-10.896z"></path><path fill="#f8ab00" d="M524.963 311.12c-9.461-5.684-19.513-10.592-28.243-17.236-12.877-9.801-24.031-21.578-32.711-35.412-11.272-17.965-19.605-37.147-21.902-58.403-1.291-11.951-2.434-24.073-1.87-36.034.823-17.452 4.909-34.363 11.581-50.703 8.82-21.603 22.25-39.792 39.568-55.065 18.022-15.894 39.162-26.07 62.351-32.332 19.22-5.19 38.842-6.177 58.37-4.674 23.803 1.831 45.56 10.663 65.062 24.496 17.193 12.195 31.688 27.086 42.894 45.622-11.403 8.296-22.633 16.117-34.092 23.586-17.094 11.142-34.262 22.106-48.036 37.528-8.796 9.848-17.201 20.246-27.131 28.837-16.859 14.585-27.745 33.801-41.054 51.019-11.865 15.349-20.663 33.117-30.354 50.08-5.303 9.283-9.654 19.11-14.434 28.692z"></path><path fill="#ea5227" d="M1060.11 1122.049c-7.377 1.649-14.683 4.093-22.147 4.763-11.519 1.033-23.166 1.441-34.723 1.054-19.343-.647-38.002-4.7-55.839-12.65-15.078-6.72-28.606-15.471-40.571-26.836-24.013-22.81-42.053-49.217-49.518-81.936-1.446-6.337-1.958-12.958-2.235-19.477-.591-13.926-.219-27.909-1.237-41.795-.916-12.5-3.16-24.904-4.408-37.805 1.555-1.381 3.134-2.074 3.778-3.27 4.729-8.79 12.141-15.159 19.083-22.03 5.879-5.818 10.688-12.76 16.796-18.293 6.993-6.335 11.86-13.596 14.364-22.612l8.542-29.993c8.015 1.785 15.984 3.821 24.057 5.286 8.145 1.478 16.371 2.59 24.602 3.493 8.453.927 16.956 1.408 25.891 2.609 1.119 16.09 1.569 31.667 2.521 47.214.676 11.045 1.396 22.154 3.234 33.043 2.418 14.329 5.708 28.527 9.075 42.674 3.499 14.705 4.028 29.929 10.415 44.188 10.157 22.674 18.29 46.25 28.281 69.004 7.175 16.341 12.491 32.973 15.078 50.615.645 4.4 3.256 8.511 4.963 12.755z"></path><path fill="#ea5330" d="M1060.512 1122.031c-2.109-4.226-4.72-8.337-5.365-12.737-2.587-17.642-7.904-34.274-15.078-50.615-9.991-22.755-18.124-46.33-28.281-69.004-6.387-14.259-6.916-29.482-10.415-44.188-3.366-14.147-6.656-28.346-9.075-42.674-1.838-10.889-2.558-21.999-3.234-33.043-.951-15.547-1.401-31.124-2.068-47.146 8.568-.18 17.146.487 25.704.286l41.868-1.4c.907 3.746 1.245 7.04 1.881 10.276l8.651 42.704c.903 4.108 2.334 8.422 4.696 11.829 7.165 10.338 14.809 20.351 22.456 30.345 4.218 5.512 8.291 11.304 13.361 15.955 8.641 7.927 18.065 14.995 27.071 22.532 12.011 10.052 24.452 19.302 40.151 22.854-1.656 11.102-2.391 22.44-5.172 33.253-4.792 18.637-12.38 36.209-23.412 52.216-13.053 18.94-29.086 34.662-49.627 45.055-10.757 5.443-22.443 9.048-34.111 13.501z"></path><path fill="#f8aa05" d="M1989.106 883.951c5.198 8.794 11.46 17.148 15.337 26.491 5.325 12.833 9.744 26.207 12.873 39.737 2.95 12.757 3.224 25.908 1.987 39.219-1.391 14.973-4.643 29.268-10.349 43.034-5.775 13.932-13.477 26.707-23.149 38.405-14.141 17.104-31.215 30.458-50.807 40.488-14.361 7.352-29.574 12.797-45.741 14.594-10.297 1.144-20.732 2.361-31.031 1.894-24.275-1.1-47.248-7.445-68.132-20.263-6.096-3.741-11.925-7.917-17.731-12.342 5.319-5.579 10.361-10.852 15.694-15.811l37.072-34.009c.975-.892 2.113-1.606 3.08-2.505 6.936-6.448 14.765-12.2 20.553-19.556 8.88-11.285 20.064-19.639 31.144-28.292 4.306-3.363 9.06-6.353 12.673-10.358 5.868-6.504 10.832-13.814 16.422-20.582 6.826-8.264 13.727-16.481 20.943-24.401 4.065-4.461 8.995-8.121 13.249-12.424 14.802-14.975 28.77-30.825 45.913-43.317z"></path><path fill="#ed6876" d="M1256.099 523.419c5.065.642 10.047 1.787 15.068 2.728 7.267 1.362 14.526 2.854 21.853 3.777 7.696.97 15.468 1.34 23.207 1.961 5.062.406 7.031 3.631 7.777 8.207 1.163 7.135 4.059 9.62 11.3 9.899l27.843.953c4.069.069 5.745 1.291 6.005 5.774.522 9.016 1.829 17.992 3.001 26.96.392 3 2.246 4.417 5.566 4.4 5.239-.026 10.48.469 16.385.778l-1.102 10.495-1.875 18.726c-.44 3.74.088 6.105 4.751 6.012 4.11-.082 8.239.568 12.352.975 2.823.28 3.984 1.892 3.794 4.753-.428 6.444-.052 13.028-1.276 19.306-.986 5.059.651 6.724 5.065 7.31 1.793.238 3.566.634 6.12 1.098 0 4.189.243 8.545-.068 12.861-.319 4.43-1.27 8.811-1.77 13.233-.285 2.528-.461 5.379 3.332 5.331 13.729-.173 11.316 2.968 12.332 14.419.658 7.423-1.066 15.045-1.554 22.589-.145 2.241.28 4.519.519 7.827 2.026-1.452 2.733-2.167 3.589-2.521 1.142-.472 2.713-1.244 3.518-.81.767.414 1.114 2.221 1.081 3.4l-.917 24.539c-11.215.82-22.45.899-33.636 1.674l-43.952 3.436c-1.086-3.01-2.319-5.571-2.296-8.121.084-9.297-4.468-16.583-9.091-24.116-3.872-6.308-8.764-13.052-9.479-19.987-1.071-10.392-5.716-15.936-14.889-18.979-1.097-.364-2.16-.844-3.214-1.327-7.478-3.428-15.548-5.918-19.059-14.735-.904-2.27-3.657-3.775-5.461-5.723-2.437-2.632-4.615-5.525-7.207-7.987-2.648-2.515-5.352-5.346-8.589-6.777-4.799-2.121-10.074-3.185-15.175-4.596l-15.785-4.155c.274-12.896 1.722-25.901.54-38.662-1.647-17.783-3.457-35.526-2.554-53.352.528-10.426 2.539-20.777 3.948-31.574z"></path><path fill="#f6a200" d="M525.146 311.436c4.597-9.898 8.947-19.725 14.251-29.008 9.691-16.963 18.49-34.73 30.354-50.08 13.309-17.218 24.195-36.434 41.054-51.019 9.93-8.591 18.335-18.989 27.131-28.837 13.774-15.422 30.943-26.386 48.036-37.528 11.459-7.469 22.688-15.29 34.243-23.286 11.705 16.744 19.716 35.424 22.534 55.717 2.231 16.066 2.236 32.441 2.753 49.143-4.756 1.62-9.284 2.234-13.259 4.056-6.43 2.948-12.193 7.513-18.774 9.942-19.863 7.331-33.806 22.349-47.926 36.784-7.86 8.035-13.511 18.275-19.886 27.705-4.434 6.558-9.345 13.037-12.358 20.254-4.249 10.177-6.94 21.004-10.296 31.553-12.33.053-24.741 1.027-36.971-.049-20.259-1.783-40.227-5.567-58.755-14.69-.568-.28-1.295-.235-2.132-.658z"></path><path fill="#f7a80d" d="M1989.057 883.598c-17.093 12.845-31.061 28.695-45.863 43.67-4.254 4.304-9.184 7.963-13.249 12.424-7.216 7.92-14.117 16.137-20.943 24.401-5.59 6.768-10.554 14.078-16.422 20.582-3.614 4.005-8.367 6.995-12.673 10.358-11.08 8.653-22.264 17.007-31.144 28.292-5.788 7.356-13.617 13.108-20.553 19.556-.967.899-2.105 1.614-3.08 2.505l-37.072 34.009c-5.333 4.96-10.375 10.232-15.859 15.505-21.401-17.218-37.461-38.439-48.623-63.592 3.503-1.781 7.117-2.604 9.823-4.637 8.696-6.536 20.392-8.406 27.297-17.714.933-1.258 2.646-1.973 4.065-2.828 17.878-10.784 36.338-20.728 53.441-32.624 10.304-7.167 18.637-17.23 27.583-26.261 3.819-3.855 7.436-8.091 10.3-12.681 12.283-19.68 24.43-39.446 40.382-56.471 12.224-13.047 17.258-29.524 22.539-45.927 15.85 4.193 29.819 12.129 42.632 22.08 10.583 8.219 19.782 17.883 27.42 29.351z"></path><path fill="#ef7a72" d="M1479.461 758.907c1.872-13.734 4.268-27.394 6.525-41.076 2.218-13.45 8.26-24.279 19.615-32.423 5.099-3.657 9.667-8.701 12.999-14.038 6.646-10.643 15.183-19.135 25.083-26.631 5.888-4.459 11.817-9.176 16.547-14.774 5.906-6.99 13.974-9.306 21.753-12.365l51.48-19.549c.753 11.848.658 23.787 1.641 35.637 1.771 21.353 4.075 42.672 11.748 62.955.17.449.107.985-.019 2.158-6.945 4.134-13.865 7.337-20.437 11.143-3.935 2.279-7.752 5.096-10.869 8.384-6.011 6.343-11.063 13.624-17.286 19.727-9.096 8.92-12.791 20.684-18.181 31.587-.202.409-.072.984-.096 1.481-8.488-1.72-16.937-3.682-25.476-5.094-9.689-1.602-19.426-3.084-29.201-3.949-15.095-1.335-30.241-2.1-45.828-3.172z"></path><path fill="#e94e3b" d="M957.995 766.838c-20.337-5.467-38.791-14.947-55.703-27.254-8.2-5.967-15.451-13.238-22.958-20.37 2.969-3.504 5.564-6.772 8.598-9.563 7.085-6.518 11.283-14.914 15.8-23.153 4.933-8.996 10.345-17.743 14.966-26.892 2.642-5.231 5.547-11.01 5.691-16.611.12-4.651.194-8.932 2.577-12.742 8.52-13.621 15.483-28.026 18.775-43.704 2.11-10.049 7.888-18.774 7.81-29.825-.064-9.089 4.291-18.215 6.73-27.313 3.212-11.983 7.369-23.797 9.492-35.968 3.202-18.358 5.133-36.945 7.346-55.466l4.879-45.8c6.693.288 13.386.575 20.54 1.365.13 3.458-.41 6.407-.496 9.37l-1.136 42.595c-.597 11.552-2.067 23.058-3.084 34.59l-3.845 44.478c-.939 10.202-1.779 20.432-3.283 30.557-.96 6.464-4.46 12.646-1.136 19.383.348.706-.426 1.894-.448 2.864-.224 9.918-5.99 19.428-2.196 29.646.103.279-.033.657-.092.983l-8.446 46.205c-1.231 6.469-2.936 12.846-4.364 19.279-1.5 6.757-2.602 13.621-4.456 20.277-3.601 12.93-10.657 25.3-5.627 39.47.368 1.036.234 2.352.017 3.476l-5.949 30.123z"></path><path fill="#ea5043" d="M958.343 767.017c1.645-10.218 3.659-20.253 5.602-30.302.217-1.124.351-2.44-.017-3.476-5.03-14.17 2.026-26.539 5.627-39.47 1.854-6.656 2.956-13.52 4.456-20.277 1.428-6.433 3.133-12.81 4.364-19.279l8.446-46.205c.059-.326.196-.705.092-.983-3.794-10.218 1.972-19.728 2.196-29.646.022-.97.796-2.158.448-2.864-3.324-6.737.176-12.919 1.136-19.383 1.504-10.125 2.344-20.355 3.283-30.557l3.845-44.478c1.017-11.532 2.488-23.038 3.084-34.59.733-14.18.722-28.397 1.136-42.595.086-2.963.626-5.912.956-9.301 5.356-.48 10.714-.527 16.536-.081 2.224 15.098 1.855 29.734 1.625 44.408-.157 10.064 1.439 20.142 1.768 30.23.334 10.235-.035 20.49.116 30.733.084 5.713.789 11.418.861 17.13.054 4.289-.469 8.585-.702 12.879-.072 1.323-.138 2.659-.031 3.975l2.534 34.405-1.707 36.293-1.908 48.69c-.182 8.103.993 16.237.811 24.34-.271 12.076-1.275 24.133-1.787 36.207-.102 2.414-.101 5.283 1.06 7.219 4.327 7.22 4.463 15.215 4.736 23.103.365 10.553.088 21.128.086 31.693-11.44 2.602-22.84.688-34.106-.916-11.486-1.635-22.806-4.434-34.546-6.903z"></path><path fill="#eb5d19" d="M398.091 622.45c6.086.617 12.21 1.288 18.067 2.918 3.539.985 6.779 3.277 9.952 5.297 9.773 6.224 18.971 13.583 29.311 18.611 8.606 4.184 12.839 10.986 17.016 18.559l18.571 32.959c1.814 3.102 4.285 5.931 6.883 8.443 8.835 8.542 10.052 20.175 13.16 31.095 2.082 7.317 4.609 14.507 6.946 22.127-29.472 3.021-58.969 5.582-87.584 15.222-1.185-2.302-1.795-4.362-2.769-6.233-4.398-8.449-6.703-18.174-14.942-24.299-2.511-1.866-5.103-3.814-7.047-6.218-8.358-10.332-17.028-20.276-28.772-26.973 4.423-11.478 9.299-22.806 13.151-34.473 4.406-13.348 6.724-27.18 6.998-41.313.098-5.093.643-10.176 1.06-15.722z"></path><path fill="#e94c32" d="M981.557 392.109c-1.172 15.337-2.617 30.625-4.438 45.869-2.213 18.521-4.144 37.108-7.346 55.466-2.123 12.171-6.28 23.985-9.492 35.968-2.439 9.098-6.794 18.224-6.73 27.313.078 11.051-5.7 19.776-7.81 29.825-3.292 15.677-10.255 30.082-18.775 43.704-2.383 3.81-2.458 8.091-2.577 12.742-.144 5.6-3.049 11.38-5.691 16.611-4.621 9.149-10.033 17.896-14.966 26.892-4.517 8.239-8.715 16.635-15.8 23.153-3.034 2.791-5.629 6.06-8.735 9.255-12.197-10.595-21.071-23.644-29.301-37.24-7.608-12.569-13.282-25.962-17.637-40.37 13.303-6.889 25.873-13.878 35.311-25.315.717-.869 1.934-1.312 2.71-2.147 5.025-5.405 10.515-10.481 14.854-16.397 6.141-8.374 10.861-17.813 17.206-26.008 8.22-10.618 13.657-22.643 20.024-34.466 4.448-.626 6.729-3.21 8.114-6.89 1.455-3.866 2.644-7.895 4.609-11.492 4.397-8.05 9.641-15.659 13.708-23.86 3.354-6.761 5.511-14.116 8.203-21.206 5.727-15.082 7.277-31.248 12.521-46.578 3.704-10.828 3.138-23.116 4.478-34.753l7.56-.073z"></path><path fill="#f7a617" d="M1918.661 831.99c-4.937 16.58-9.971 33.057-22.196 46.104-15.952 17.025-28.099 36.791-40.382 56.471-2.864 4.59-6.481 8.825-10.3 12.681-8.947 9.031-17.279 19.094-27.583 26.261-17.103 11.896-35.564 21.84-53.441 32.624-1.419.856-3.132 1.571-4.065 2.828-6.904 9.308-18.6 11.178-27.297 17.714-2.705 2.033-6.319 2.856-9.874 4.281-3.413-9.821-6.916-19.583-9.36-29.602-1.533-6.284-1.474-12.957-1.665-19.913 1.913-.78 3.374-1.057 4.81-1.431 15.822-4.121 31.491-8.029 43.818-20.323 9.452-9.426 20.371-17.372 30.534-26.097 6.146-5.277 13.024-10.052 17.954-16.326 14.812-18.848 28.876-38.285 43.112-57.581 2.624-3.557 5.506-7.264 6.83-11.367 2.681-8.311 4.375-16.94 6.476-25.438 17.89.279 35.333 3.179 52.629 9.113z"></path><path fill="#ea553a" d="M1172.91 977.582c-15.775-3.127-28.215-12.377-40.227-22.43-9.005-7.537-18.43-14.605-27.071-22.532-5.07-4.651-9.143-10.443-13.361-15.955-7.647-9.994-15.291-20.007-22.456-30.345-2.361-3.407-3.792-7.72-4.696-11.829-3.119-14.183-5.848-28.453-8.651-42.704-.636-3.236-.974-6.53-1.452-10.209 15.234-2.19 30.471-3.969 46.408-5.622 2.692 5.705 4.882 11.222 6.63 16.876 2.9 9.381 7.776 17.194 15.035 24.049 7.056 6.662 13.305 14.311 19.146 22.099 9.509 12.677 23.01 19.061 36.907 25.054-1.048 7.441-2.425 14.854-3.066 22.33-.956 11.162-1.393 22.369-2.052 33.557l-1.096 17.661z"></path><path fill="#ea5453" d="M1163.123 704.036c-4.005 5.116-7.685 10.531-12.075 15.293-12.842 13.933-27.653 25.447-44.902 34.538-3.166-5.708-5.656-11.287-8.189-17.251-3.321-12.857-6.259-25.431-9.963-37.775-4.6-15.329-10.6-30.188-11.349-46.562-.314-6.871-1.275-14.287-7.114-19.644-1.047-.961-1.292-3.053-1.465-4.67l-4.092-39.927c-.554-5.245-.383-10.829-2.21-15.623-3.622-9.503-4.546-19.253-4.688-29.163-.088-6.111 1.068-12.256.782-18.344-.67-14.281-1.76-28.546-2.9-42.8-.657-8.222-1.951-16.395-2.564-24.62-.458-6.137-.285-12.322-.104-18.21.959 5.831 1.076 11.525 2.429 16.909 2.007 7.986 5.225 15.664 7.324 23.632 3.222 12.23 1.547 25.219 6.728 37.355 4.311 10.099 6.389 21.136 9.732 31.669 2.228 7.02 6.167 13.722 7.121 20.863 1.119 8.376 6.1 13.974 10.376 20.716l2.026 10.576c1.711 9.216 3.149 18.283 8.494 26.599 6.393 9.946 11.348 20.815 16.943 31.276 4.021 7.519 6.199 16.075 12.925 22.065l24.462 22.26c.556.503 1.507.571 2.274.841z"></path><path fill="#ea5b15" d="M1285.092 163.432c9.165 3.148 18.419 6.374 27.279 10.459 4.871 2.246 8.838 6.406 13.646 8.851 5.446 2.77 11.801 3.874 17.011 6.965 11.514 6.831 24.097 9.942 36.968 12.471 1.78.35 3.777.576 5.213 1.542 10.784 7.255 23.448 9.114 35.622 11.834 9.977 2.23 18.529 6.703 26.988 11.898 5.233 3.214 10.76 5.983 15.798 9.468 4.14 2.864 7.962 6.279 11.551 9.827 5.076 5.02 10.056 10.181 14.624 15.658 5.822 6.98 11.119 14.395 16.78 21.513 4.531 5.698 9.267 11.233 14.222 16.987-10.005 5.806-20.07 12.004-30.719 16.943-7.694 3.569-16.163 5.464-24.688 7.669-2.878-7.088-5.352-13.741-7.833-20.392-.802-2.15-1.244-4.55-2.498-6.396-4.548-6.7-9.712-12.999-14.011-19.847-6.672-10.627-15.34-18.93-26.063-25.376-9.357-5.625-18.367-11.824-27.644-17.587-6.436-3.997-12.902-8.006-19.659-11.405-5.123-2.577-11.107-3.536-16.046-6.37-17.187-9.863-35.13-17.887-54.031-23.767-4.403-1.37-8.953-2.267-13.436-3.382l.926-27.565z"></path><path fill="#ea504b" d="M1098 737l7.789 16.893c-15.04 9.272-31.679 15.004-49.184 17.995-9.464 1.617-19.122 2.097-29.151 3.019-.457-10.636-.18-21.211-.544-31.764-.273-7.888-.409-15.883-4.736-23.103-1.16-1.936-1.162-4.805-1.06-7.219l1.787-36.207c.182-8.103-.993-16.237-.811-24.34.365-16.236 1.253-32.461 1.908-48.69.484-12 .942-24.001 1.98-36.069 5.57 10.19 10.632 20.42 15.528 30.728 1.122 2.362 2.587 5.09 2.339 7.488-1.536 14.819 5.881 26.839 12.962 38.33 10.008 16.241 16.417 33.54 20.331 51.964 2.285 10.756 4.729 21.394 11.958 30.165L1098 737z"></path><path fill="#f6a320" d="M1865.78 822.529c-1.849 8.846-3.544 17.475-6.224 25.786-1.323 4.102-4.206 7.81-6.83 11.367l-43.112 57.581c-4.93 6.273-11.808 11.049-17.954 16.326-10.162 8.725-21.082 16.671-30.534 26.097-12.327 12.294-27.997 16.202-43.818 20.323-1.436.374-2.897.651-4.744.986-1.107-17.032-1.816-34.076-2.079-51.556 1.265-.535 2.183-.428 2.888-.766 10.596-5.072 20.8-11.059 32.586-13.273 1.69-.317 3.307-1.558 4.732-2.662l26.908-21.114c4.992-4.003 11.214-7.393 14.381-12.585 11.286-18.5 22.363-37.263 27.027-58.87l36.046 1.811c3.487.165 6.983.14 10.727.549z"></path><path fill="#ec6333" d="M318.448 922.814c-6.374-2.074-12.56-4.058-18.412-6.765-8.379-3.876-16.906-7.675-24.617-12.668-5.239-3.392-9.69-8.381-13.609-13.352-7.87-9.983-14.953-20.582-22.699-30.666-8.061-10.493-13.909-22.097-18.636-34.358-.595-1.543-1.486-2.972-2.382-4.783 6.84-1.598 13.797-3.023 20.807-4.106 18.852-2.912 36.433-9.493 53.737-17.819.697.888.889 1.555 1.292 2.051l17.921 21.896c4.14 4.939 8.06 10.191 12.862 14.412 5.67 4.984 12.185 9.007 18.334 13.447-8.937 16.282-16.422 33.178-20.696 51.31-1.638 6.951-2.402 14.107-3.903 21.403z"></path><path fill="#f49700" d="M623.467 326.903c2.893-10.618 5.584-21.446 9.833-31.623 3.013-7.217 7.924-13.696 12.358-20.254 6.375-9.43 12.026-19.67 19.886-27.705 14.12-14.434 28.063-29.453 47.926-36.784 6.581-2.429 12.344-6.994 18.774-9.942 3.975-1.822 8.503-2.436 13.186-3.592 1.947 18.557 3.248 37.15 8.307 55.686-15.453 7.931-28.853 18.092-40.46 29.996-10.417 10.683-19.109 23.111-28.013 35.175-3.238 4.388-4.888 9.948-7.262 14.973-17.803-3.987-35.767-6.498-54.535-5.931z"></path><path fill="#ea544c" d="M1097.956 736.615c-2.925-3.218-5.893-6.822-8.862-10.425-7.229-8.771-9.672-19.409-11.958-30.165-3.914-18.424-10.323-35.722-20.331-51.964-7.081-11.491-14.498-23.511-12.962-38.33.249-2.398-1.217-5.126-2.339-7.488l-15.232-31.019-3.103-34.338c-.107-1.316-.041-2.653.031-3.975.233-4.294.756-8.59.702-12.879-.072-5.713-.776-11.417-.861-17.13l-.116-30.733c-.329-10.088-1.926-20.166-1.768-30.23.23-14.674.599-29.31-1.162-44.341 9.369-.803 18.741-1.179 28.558-1.074 1.446 15.814 2.446 31.146 3.446 46.478.108 6.163-.064 12.348.393 18.485.613 8.225 1.907 16.397 2.564 24.62l2.9 42.8c.286 6.088-.869 12.234-.782 18.344.142 9.91 1.066 19.661 4.688 29.163 1.827 4.794 1.657 10.377 2.21 15.623l4.092 39.927c.172 1.617.417 3.71 1.465 4.67 5.839 5.357 6.8 12.773 7.114 19.644.749 16.374 6.749 31.233 11.349 46.562 3.704 12.344 6.642 24.918 9.963 37.775z"></path><path fill="#ec5c61" d="M1204.835 568.008c1.254 25.351-1.675 50.16-10.168 74.61-8.598-4.883-18.177-8.709-24.354-15.59-7.44-8.289-13.929-17.442-21.675-25.711-8.498-9.072-16.731-18.928-21.084-31.113-.54-1.513-1.691-2.807-2.594-4.564-4.605-9.247-7.706-18.544-7.96-29.09-.835-7.149-1.214-13.944-2.609-20.523-2.215-10.454-5.626-20.496-7.101-31.302-2.513-18.419-7.207-36.512-5.347-55.352.24-2.43-.17-4.949-.477-7.402l-4.468-34.792c2.723-.379 5.446-.757 8.585-.667 1.749 8.781 2.952 17.116 4.448 25.399 1.813 10.037 3.64 20.084 5.934 30.017 1.036 4.482 3.953 8.573 4.73 13.064 1.794 10.377 4.73 20.253 9.272 29.771 2.914 6.105 4.761 12.711 7.496 18.912 2.865 6.496 6.264 12.755 9.35 19.156 3.764 7.805 7.667 15.013 16.1 19.441 7.527 3.952 13.713 10.376 20.983 14.924 6.636 4.152 13.932 7.25 20.937 10.813z"></path><path fill="#ed676f" d="M1140.75 379.231c18.38-4.858 36.222-11.21 53.979-18.971 3.222 3.368 5.693 6.744 8.719 9.512 2.333 2.134 5.451 5.07 8.067 4.923 7.623-.429 12.363 2.688 17.309 8.215 5.531 6.18 12.744 10.854 19.224 16.184-5.121 7.193-10.461 14.241-15.323 21.606-13.691 20.739-22.99 43.255-26.782 67.926-.543 3.536-1.281 7.043-2.366 10.925-14.258-6.419-26.411-14.959-32.731-29.803-1.087-2.553-2.596-4.93-3.969-7.355-1.694-2.993-3.569-5.89-5.143-8.943-1.578-3.062-2.922-6.249-4.295-9.413-1.57-3.621-3.505-7.163-4.47-10.946-1.257-4.93-.636-10.572-2.725-15.013-5.831-12.397-7.467-25.628-9.497-38.847z"></path><path fill="#ed656e" d="M1254.103 647.439c5.325.947 10.603 2.272 15.847 3.722 5.101 1.41 10.376 2.475 15.175 4.596 3.237 1.431 5.942 4.262 8.589 6.777 2.592 2.462 4.77 5.355 7.207 7.987 1.804 1.948 4.557 3.453 5.461 5.723 3.51 8.817 11.581 11.307 19.059 14.735 1.053.483 2.116.963 3.214 1.327 9.172 3.043 13.818 8.587 14.889 18.979.715 6.935 5.607 13.679 9.479 19.987 4.623 7.533 9.175 14.819 9.091 24.116-.023 2.55 1.21 5.111 1.874 8.055-19.861 2.555-39.795 4.296-59.597 9.09l-11.596-23.203c-1.107-2.169-2.526-4.353-4.307-5.975-7.349-6.694-14.863-13.209-22.373-19.723l-17.313-14.669c-2.776-2.245-5.935-4.017-8.92-6.003l11.609-38.185c1.508-5.453 1.739-11.258 2.613-17.336z"></path><path fill="#ec6168" d="M1140.315 379.223c2.464 13.227 4.101 26.459 9.931 38.856 2.089 4.441 1.468 10.083 2.725 15.013.965 3.783 2.9 7.325 4.47 10.946 1.372 3.164 2.716 6.351 4.295 9.413 1.574 3.053 3.449 5.95 5.143 8.943 1.372 2.425 2.882 4.803 3.969 7.355 6.319 14.844 18.473 23.384 32.641 30.212.067 5.121-.501 10.201-.435 15.271l.985 38.117c.151 4.586.616 9.162.868 14.201-7.075-3.104-14.371-6.202-21.007-10.354-7.269-4.548-13.456-10.972-20.983-14.924-8.434-4.428-12.337-11.637-16.1-19.441-3.087-6.401-6.485-12.66-9.35-19.156-2.735-6.201-4.583-12.807-7.496-18.912-4.542-9.518-7.477-19.394-9.272-29.771-.777-4.491-3.694-8.581-4.73-13.064-2.294-9.933-4.121-19.98-5.934-30.017-1.496-8.283-2.699-16.618-4.036-25.335 10.349-2.461 20.704-4.511 31.054-6.582.957-.191 1.887-.515 3.264-.769z"></path><path fill="#e94c28" d="M922 537c-6.003 11.784-11.44 23.81-19.66 34.428-6.345 8.196-11.065 17.635-17.206 26.008-4.339 5.916-9.828 10.992-14.854 16.397-.776.835-1.993 1.279-2.71 2.147-9.439 11.437-22.008 18.427-35.357 24.929-4.219-10.885-6.942-22.155-7.205-33.905l-.514-49.542c7.441-2.893 14.452-5.197 21.334-7.841 1.749-.672 3.101-2.401 4.604-3.681 6.749-5.745 12.845-12.627 20.407-16.944 7.719-4.406 14.391-9.101 18.741-16.889.626-1.122 1.689-2.077 2.729-2.877 7.197-5.533 12.583-12.51 16.906-20.439.68-1.247 2.495-1.876 4.105-2.651 2.835 1.408 5.267 2.892 7.884 3.892 3.904 1.491 4.392 3.922 2.833 7.439-1.47 3.318-2.668 6.756-4.069 10.106-1.247 2.981-.435 5.242 2.413 6.544 2.805 1.282 3.125 3.14 1.813 5.601l-6.907 12.799L922 537z"></path><path fill="#eb5659" d="M1124.995 566c.868 1.396 2.018 2.691 2.559 4.203 4.353 12.185 12.586 22.041 21.084 31.113 7.746 8.269 14.235 17.422 21.675 25.711 6.176 6.881 15.756 10.707 24.174 15.932-6.073 22.316-16.675 42.446-31.058 60.937-1.074-.131-2.025-.199-2.581-.702l-24.462-22.26c-6.726-5.99-8.904-14.546-12.925-22.065-5.594-10.461-10.55-21.33-16.943-31.276-5.345-8.315-6.783-17.383-8.494-26.599-.63-3.394-1.348-6.772-1.738-10.848-.371-6.313-1.029-11.934-1.745-18.052l6.34 4.04 1.288-.675-2.143-15.385 9.454 1.208v-8.545L1124.995 566z"></path><path fill="#f5a02d" d="M1818.568 820.096c-4.224 21.679-15.302 40.442-26.587 58.942-3.167 5.192-9.389 8.582-14.381 12.585l-26.908 21.114c-1.425 1.104-3.042 2.345-4.732 2.662-11.786 2.214-21.99 8.201-32.586 13.273-.705.338-1.624.231-2.824.334a824.35 824.35 0 0 1-8.262-42.708c4.646-2.14 9.353-3.139 13.269-5.47 5.582-3.323 11.318-6.942 15.671-11.652 7.949-8.6 14.423-18.572 22.456-27.081 8.539-9.046 13.867-19.641 18.325-30.922l46.559 8.922z"></path><path fill="#eb5a57" d="M1124.96 565.639c-5.086-4.017-10.208-8.395-15.478-12.901v8.545l-9.454-1.208 2.143 15.385-1.288.675-6.34-4.04c.716 6.118 1.375 11.74 1.745 17.633-4.564-6.051-9.544-11.649-10.663-20.025-.954-7.141-4.892-13.843-7.121-20.863-3.344-10.533-5.421-21.57-9.732-31.669-5.181-12.135-3.506-25.125-6.728-37.355-2.099-7.968-5.317-15.646-7.324-23.632-1.353-5.384-1.47-11.078-2.429-16.909l-3.294-46.689a278.63 278.63 0 0 1 27.57-2.084c2.114 12.378 3.647 24.309 5.479 36.195 1.25 8.111 2.832 16.175 4.422 24.23 1.402 7.103 2.991 14.169 4.55 21.241 1.478 6.706.273 14.002 4.6 20.088 5.401 7.597 7.176 16.518 9.467 25.337 1.953 7.515 5.804 14.253 11.917 19.406.254 10.095 3.355 19.392 7.96 28.639z"></path><path fill="#ea541c" d="M911.651 810.999c-2.511 10.165-5.419 20.146-8.2 30.162-2.503 9.015-7.37 16.277-14.364 22.612-6.108 5.533-10.917 12.475-16.796 18.293-6.942 6.871-14.354 13.24-19.083 22.03-.644 1.196-2.222 1.889-3.705 2.857-2.39-7.921-4.101-15.991-6.566-23.823-5.451-17.323-12.404-33.976-23.414-48.835l21.627-21.095c3.182-3.29 5.532-7.382 8.295-11.083l10.663-14.163c9.528 4.78 18.925 9.848 28.625 14.247 7.324 3.321 15.036 5.785 22.917 8.799z"></path><path fill="#eb5d19" d="M1284.092 191.421c4.557.69 9.107 1.587 13.51 2.957 18.901 5.881 36.844 13.904 54.031 23.767 4.938 2.834 10.923 3.792 16.046 6.37 6.757 3.399 13.224 7.408 19.659 11.405l27.644 17.587c10.723 6.446 19.392 14.748 26.063 25.376 4.299 6.848 9.463 13.147 14.011 19.847 1.254 1.847 1.696 4.246 2.498 6.396l7.441 20.332c-11.685 1.754-23.379 3.133-35.533 4.037-.737-2.093-.995-3.716-1.294-5.33-3.157-17.057-14.048-30.161-23.034-44.146-3.027-4.71-7.786-8.529-12.334-11.993-9.346-7.116-19.004-13.834-28.688-20.491-6.653-4.573-13.311-9.251-20.431-13.002-8.048-4.24-16.479-7.85-24.989-11.091-11.722-4.465-23.673-8.328-35.527-12.449l.927-19.572z"></path><path fill="#eb5e24" d="M1283.09 211.415c11.928 3.699 23.88 7.562 35.602 12.027 8.509 3.241 16.941 6.852 24.989 11.091 7.12 3.751 13.778 8.429 20.431 13.002 9.684 6.657 19.342 13.375 28.688 20.491 4.548 3.463 9.307 7.283 12.334 11.993 8.986 13.985 19.877 27.089 23.034 44.146.299 1.615.557 3.237.836 5.263-13.373-.216-26.749-.839-40.564-1.923-2.935-9.681-4.597-18.92-12.286-26.152-15.577-14.651-30.4-30.102-45.564-45.193-.686-.683-1.626-1.156-2.516-1.584l-47.187-22.615 2.203-20.546z"></path><path fill="#e9511f" d="M913 486.001c-1.29.915-3.105 1.543-3.785 2.791-4.323 7.929-9.709 14.906-16.906 20.439-1.04.8-2.103 1.755-2.729 2.877-4.35 7.788-11.022 12.482-18.741 16.889-7.562 4.317-13.658 11.199-20.407 16.944-1.503 1.28-2.856 3.009-4.604 3.681-6.881 2.643-13.893 4.948-21.262 7.377-.128-11.151.202-22.302.378-33.454.03-1.892-.6-3.795-.456-6.12 13.727-1.755 23.588-9.527 33.278-17.663 2.784-2.337 6.074-4.161 8.529-6.784l29.057-31.86c1.545-1.71 3.418-3.401 4.221-5.459 5.665-14.509 11.49-28.977 16.436-43.736 2.817-8.407 4.074-17.338 6.033-26.032 5.039.714 10.078 1.427 15.536 2.629-.909 8.969-2.31 17.438-3.546 25.931-2.41 16.551-5.84 32.839-11.991 48.461L913 486.001z"></path><path fill="#ea5741" d="M1179.451 903.828c-14.224-5.787-27.726-12.171-37.235-24.849-5.841-7.787-12.09-15.436-19.146-22.099-7.259-6.854-12.136-14.667-15.035-24.049-1.748-5.654-3.938-11.171-6.254-17.033 15.099-4.009 30.213-8.629 44.958-15.533l28.367 36.36c6.09 8.015 13.124 14.75 22.72 18.375-7.404 14.472-13.599 29.412-17.48 45.244-.271 1.106-.382 2.25-.895 3.583z"></path><path fill="#ea522a" d="M913.32 486.141c2.693-7.837 5.694-15.539 8.722-23.231 6.151-15.622 9.581-31.91 11.991-48.461l3.963-25.861c7.582.317 15.168 1.031 22.748 1.797 4.171.421 8.333.928 12.877 1.596-.963 11.836-.398 24.125-4.102 34.953-5.244 15.33-6.794 31.496-12.521 46.578-2.692 7.09-4.849 14.445-8.203 21.206-4.068 8.201-9.311 15.81-13.708 23.86-1.965 3.597-3.154 7.627-4.609 11.492-1.385 3.68-3.666 6.265-8.114 6.89-1.994-1.511-3.624-3.059-5.077-4.44l6.907-12.799c1.313-2.461.993-4.318-1.813-5.601-2.849-1.302-3.66-3.563-2.413-6.544 1.401-3.35 2.599-6.788 4.069-10.106 1.558-3.517 1.071-5.948-2.833-7.439-2.617-1-5.049-2.484-7.884-3.892z"></path><path fill="#eb5e24" d="M376.574 714.118c12.053 6.538 20.723 16.481 29.081 26.814 1.945 2.404 4.537 4.352 7.047 6.218 8.24 6.125 10.544 15.85 14.942 24.299.974 1.871 1.584 3.931 2.376 6.29-7.145 3.719-14.633 6.501-21.386 10.517-9.606 5.713-18.673 12.334-28.425 18.399-3.407-3.73-6.231-7.409-9.335-10.834l-30.989-33.862c11.858-11.593 22.368-24.28 31.055-38.431 1.86-3.031 3.553-6.164 5.632-9.409z"></path><path fill="#e95514" d="M859.962 787.636c-3.409 5.037-6.981 9.745-10.516 14.481-2.763 3.701-5.113 7.792-8.295 11.083-6.885 7.118-14.186 13.834-21.65 20.755-13.222-17.677-29.417-31.711-48.178-42.878-.969-.576-2.068-.934-3.27-1.709 6.28-8.159 12.733-15.993 19.16-23.849 1.459-1.783 2.718-3.738 4.254-5.448l18.336-19.969c4.909 5.34 9.619 10.738 14.081 16.333 9.72 12.19 21.813 21.566 34.847 29.867.411.262.725.674 1.231 1.334z"></path><path fill="#eb5f2d" d="M339.582 762.088l31.293 33.733c3.104 3.425 5.928 7.104 9.024 10.979-12.885 11.619-24.548 24.139-33.899 38.704-.872 1.359-1.56 2.837-2.644 4.428-6.459-4.271-12.974-8.294-18.644-13.278-4.802-4.221-8.722-9.473-12.862-14.412l-17.921-21.896c-.403-.496-.595-1.163-.926-2.105 16.738-10.504 32.58-21.87 46.578-36.154z"></path><path fill="#f28d00" d="M678.388 332.912c1.989-5.104 3.638-10.664 6.876-15.051 8.903-12.064 17.596-24.492 28.013-35.175 11.607-11.904 25.007-22.064 40.507-29.592 4.873 11.636 9.419 23.412 13.67 35.592-5.759 4.084-11.517 7.403-16.594 11.553-4.413 3.607-8.124 8.092-12.023 12.301-5.346 5.772-10.82 11.454-15.782 17.547-3.929 4.824-7.17 10.208-10.716 15.344l-33.95-12.518z"></path><path fill="#f08369" d="M1580.181 771.427c-.191-.803-.322-1.377-.119-1.786 5.389-10.903 9.084-22.666 18.181-31.587 6.223-6.103 11.276-13.385 17.286-19.727 3.117-3.289 6.933-6.105 10.869-8.384 6.572-3.806 13.492-7.009 20.461-10.752 1.773 3.23 3.236 6.803 4.951 10.251l12.234 24.993c-1.367 1.966-2.596 3.293-3.935 4.499-7.845 7.07-16.315 13.564-23.407 21.32-6.971 7.623-12.552 16.517-18.743 24.854l-37.777-13.68z"></path><path fill="#f18b5e" d="M1618.142 785.4c6.007-8.63 11.588-17.524 18.559-25.147 7.092-7.755 15.562-14.249 23.407-21.32 1.338-1.206 2.568-2.534 3.997-4.162l28.996 33.733c1.896 2.205 4.424 3.867 6.66 6.394-6.471 7.492-12.967 14.346-19.403 21.255l-18.407 19.953c-12.958-12.409-27.485-22.567-43.809-30.706z"></path><path fill="#f49c3a" d="M1771.617 811.1c-4.066 11.354-9.394 21.949-17.933 30.995-8.032 8.509-14.507 18.481-22.456 27.081-4.353 4.71-10.089 8.329-15.671 11.652-3.915 2.331-8.623 3.331-13.318 5.069-4.298-9.927-8.255-19.998-12.1-30.743 4.741-4.381 9.924-7.582 13.882-11.904 7.345-8.021 14.094-16.603 20.864-25.131 4.897-6.168 9.428-12.626 14.123-18.955l32.61 11.936z"></path><path fill="#f08000" d="M712.601 345.675c3.283-5.381 6.524-10.765 10.453-15.589 4.962-6.093 10.435-11.774 15.782-17.547 3.899-4.21 7.61-8.695 12.023-12.301 5.078-4.15 10.836-7.469 16.636-11.19a934.12 934.12 0 0 1 23.286 35.848c-4.873 6.234-9.676 11.895-14.63 17.421l-25.195 27.801c-11.713-9.615-24.433-17.645-38.355-24.443z"></path><path fill="#ed6e04" d="M751.11 370.42c8.249-9.565 16.693-18.791 25.041-28.103 4.954-5.526 9.757-11.187 14.765-17.106 7.129 6.226 13.892 13.041 21.189 19.225 5.389 4.567 11.475 8.312 17.53 12.92-5.51 7.863-10.622 15.919-17.254 22.427-8.881 8.716-18.938 16.233-28.49 24.264-5.703-6.587-11.146-13.427-17.193-19.682-4.758-4.921-10.261-9.121-15.587-13.944z"></path><path fill="#ea541c" d="M921.823 385.544c-1.739 9.04-2.995 17.971-5.813 26.378-4.946 14.759-10.771 29.227-16.436 43.736-.804 2.058-2.676 3.749-4.221 5.459l-29.057 31.86c-2.455 2.623-5.745 4.447-8.529 6.784-9.69 8.135-19.551 15.908-33.208 17.237-1.773-9.728-3.147-19.457-4.091-29.6l36.13-16.763c.581-.267 1.046-.812 1.525-1.269 8.033-7.688 16.258-15.19 24.011-23.152 4.35-4.467 9.202-9.144 11.588-14.69 6.638-15.425 15.047-30.299 17.274-47.358 3.536.344 7.072.688 10.829 1.377z"></path><path fill="#f3944d" d="M1738.688 798.998c-4.375 6.495-8.906 12.953-13.803 19.121-6.771 8.528-13.519 17.11-20.864 25.131-3.958 4.322-9.141 7.523-13.925 11.54-8.036-13.464-16.465-26.844-27.999-38.387 5.988-6.951 12.094-13.629 18.261-20.25l19.547-20.95 38.783 23.794z"></path><path fill="#ec6168" d="M1239.583 703.142c3.282 1.805 6.441 3.576 9.217 5.821 5.88 4.755 11.599 9.713 17.313 14.669l22.373 19.723c1.781 1.622 3.2 3.806 4.307 5.975 3.843 7.532 7.477 15.171 11.194 23.136-10.764 4.67-21.532 8.973-32.69 12.982l-22.733-27.366c-2.003-2.416-4.096-4.758-6.194-7.093-3.539-3.94-6.927-8.044-10.74-11.701-2.57-2.465-5.762-4.283-8.675-6.39l16.627-29.755z"></path><path fill="#ec663e" d="M1351.006 332.839l-28.499 10.33c-.294.107-.533.367-1.194.264-11.067-19.018-27.026-32.559-44.225-44.855-4.267-3.051-8.753-5.796-13.138-8.682l9.505-24.505c10.055 4.069 19.821 8.227 29.211 13.108 3.998 2.078 7.299 5.565 10.753 8.598 3.077 2.701 5.743 5.891 8.926 8.447 4.116 3.304 9.787 5.345 12.62 9.432 6.083 8.777 10.778 18.517 16.041 27.863z"></path><path fill="#eb5e5b" d="M1222.647 733.051c3.223 1.954 6.415 3.771 8.985 6.237 3.813 3.658 7.201 7.761 10.74 11.701l6.194 7.093 22.384 27.409c-13.056 6.836-25.309 14.613-36.736 24.161l-39.323-44.7 24.494-27.846c1.072-1.224 1.974-2.598 3.264-4.056z"></path><path fill="#ea580e" d="M876.001 376.171c5.874 1.347 11.748 2.694 17.812 4.789-.81 5.265-2.687 9.791-2.639 14.296.124 11.469-4.458 20.383-12.73 27.863-2.075 1.877-3.659 4.286-5.668 6.248l-22.808 21.967c-.442.422-1.212.488-1.813.757l-23.113 10.389-9.875 4.514c-2.305-6.09-4.609-12.181-6.614-18.676 7.64-4.837 15.567-8.54 22.18-13.873 9.697-7.821 18.931-16.361 27.443-25.455 5.613-5.998 12.679-11.331 14.201-20.475.699-4.2 2.384-8.235 3.623-12.345z"></path><path fill="#e95514" d="M815.103 467.384c3.356-1.894 6.641-3.415 9.94-4.903l23.113-10.389c.6-.269 1.371-.335 1.813-.757l22.808-21.967c2.008-1.962 3.593-4.371 5.668-6.248 8.272-7.48 12.854-16.394 12.73-27.863-.049-4.505 1.828-9.031 2.847-13.956 5.427.559 10.836 1.526 16.609 2.68-1.863 17.245-10.272 32.119-16.91 47.544-2.387 5.546-7.239 10.223-11.588 14.69-7.753 7.962-15.978 15.464-24.011 23.152-.478.458-.944 1.002-1.525 1.269l-36.069 16.355c-2.076-6.402-3.783-12.81-5.425-19.607z"></path><path fill="#eb620b" d="M783.944 404.402c9.499-8.388 19.556-15.905 28.437-24.621 6.631-6.508 11.744-14.564 17.575-22.273 9.271 4.016 18.501 8.375 27.893 13.43-4.134 7.07-8.017 13.778-12.833 19.731-5.785 7.15-12.109 13.917-18.666 20.376-7.99 7.869-16.466 15.244-24.731 22.832l-17.674-29.475z"></path><path fill="#ea544c" d="M1197.986 854.686c-9.756-3.309-16.79-10.044-22.88-18.059l-28.001-36.417c8.601-5.939 17.348-11.563 26.758-17.075 1.615 1.026 2.639 1.876 3.505 2.865l26.664 30.44c3.723 4.139 7.995 7.785 12.017 11.656l-18.064 26.591z"></path><path fill="#ec6333" d="M1351.41 332.903c-5.667-9.409-10.361-19.149-16.445-27.926-2.833-4.087-8.504-6.128-12.62-9.432-3.184-2.555-5.849-5.745-8.926-8.447-3.454-3.033-6.756-6.52-10.753-8.598-9.391-4.88-19.157-9.039-29.138-13.499 1.18-5.441 2.727-10.873 4.81-16.607 11.918 4.674 24.209 8.261 34.464 14.962 14.239 9.304 29.011 18.453 39.595 32.464 2.386 3.159 5.121 6.077 7.884 8.923 6.564 6.764 10.148 14.927 11.723 24.093l-20.594 4.067z"></path><path fill="#eb5e5b" d="M1117 536.549c-6.113-4.702-9.965-11.44-11.917-18.955-2.292-8.819-4.066-17.74-9.467-25.337-4.327-6.085-3.122-13.382-4.6-20.088l-4.55-21.241c-1.59-8.054-3.172-16.118-4.422-24.23l-5.037-36.129c6.382-1.43 12.777-2.462 19.582-3.443 1.906 11.646 3.426 23.24 4.878 34.842.307 2.453.717 4.973.477 7.402-1.86 18.84 2.834 36.934 5.347 55.352 1.474 10.806 4.885 20.848 7.101 31.302 1.394 6.579 1.774 13.374 2.609 20.523z"></path><path fill="#ec644b" d="M1263.638 290.071c4.697 2.713 9.183 5.458 13.45 8.509 17.199 12.295 33.158 25.836 43.873 44.907-8.026 4.725-16.095 9.106-24.83 13.372-11.633-15.937-25.648-28.515-41.888-38.689-1.609-1.008-3.555-1.48-5.344-2.2 2.329-3.852 4.766-7.645 6.959-11.573l7.78-14.326z"></path><path fill="#eb5f2d" d="M1372.453 328.903c-2.025-9.233-5.608-17.396-12.172-24.16-2.762-2.846-5.498-5.764-7.884-8.923-10.584-14.01-25.356-23.16-39.595-32.464-10.256-6.701-22.546-10.289-34.284-15.312.325-5.246 1.005-10.444 2.027-15.863l47.529 22.394c.89.428 1.83.901 2.516 1.584l45.564 45.193c7.69 7.233 9.352 16.472 11.849 26.084-5.032.773-10.066 1.154-15.55 1.466z"></path><path fill="#e95a0f" d="M801.776 434.171c8.108-7.882 16.584-15.257 24.573-23.126 6.558-6.459 12.881-13.226 18.666-20.376 4.817-5.953 8.7-12.661 13.011-19.409 5.739 1.338 11.463 3.051 17.581 4.838-.845 4.183-2.53 8.219-3.229 12.418-1.522 9.144-8.588 14.477-14.201 20.475-8.512 9.094-17.745 17.635-27.443 25.455-6.613 5.333-14.54 9.036-22.223 13.51-2.422-4.469-4.499-8.98-6.735-13.786z"></path><path fill="#eb5e5b" d="M1248.533 316.002c2.155.688 4.101 1.159 5.71 2.168 16.24 10.174 30.255 22.752 41.532 38.727-7.166 5.736-14.641 11.319-22.562 16.731-1.16-1.277-1.684-2.585-2.615-3.46l-38.694-36.2 14.203-15.029c.803-.86 1.38-1.93 2.427-2.936z"></path><path fill="#eb5a57" d="M1216.359 827.958c-4.331-3.733-8.603-7.379-12.326-11.518l-26.664-30.44c-.866-.989-1.89-1.839-3.152-2.902 6.483-6.054 13.276-11.959 20.371-18.005l39.315 44.704c-5.648 6.216-11.441 12.12-17.544 18.161z"></path><path fill="#ec6168" d="M1231.598 334.101l38.999 36.066c.931.876 1.456 2.183 2.303 3.608-4.283 4.279-8.7 8.24-13.769 12.091-4.2-3.051-7.512-6.349-11.338-8.867-12.36-8.136-22.893-18.27-32.841-29.093l16.646-13.805z"></path><path fill="#ed656e" d="M1214.597 347.955c10.303 10.775 20.836 20.908 33.196 29.044 3.825 2.518 7.137 5.816 10.992 8.903-3.171 4.397-6.65 8.648-10.432 13.046-6.785-5.184-13.998-9.858-19.529-16.038-4.946-5.527-9.687-8.644-17.309-8.215-2.616.147-5.734-2.788-8.067-4.923-3.026-2.769-5.497-6.144-8.35-9.568 6.286-4.273 12.715-8.237 19.499-12.25z"></path></svg> </p> <p align="center"> <b>The crispy rerank family from <a href="https://mixedbread.ai"><b>Mixedbread</b></a>.</b> </p> # mxbai-rerank-xsmall-v1 This is the smallest model in our family of powerful reranker models. You can learn more about the models in our [blog post](https://www.mixedbread.ai/blog/mxbai-rerank-v1). We have three models: - [mxbai-rerank-xsmall-v1](https://huggingface.co/mixedbread-ai/mxbai-rerank-xsmall-v1) (🍞) - [mxbai-rerank-base-v1](https://huggingface.co/mixedbread-ai/mxbai-rerank-base-v1) - [mxbai-rerank-large-v1](https://huggingface.co/mixedbread-ai/mxbai-rerank-large-v1) ## Quickstart Currently, the best way to use our models is with the most recent version of sentence-transformers. `pip install -U sentence-transformers` Let's say you have a query, and you want to rerank a set of documents. You can do that with only one line of code: ```python from sentence_transformers import CrossEncoder # Load the model, here we use our base sized model model = CrossEncoder("mixedbread-ai/mxbai-rerank-xsmall-v1") # Example query and documents query = "Who wrote 'To Kill a Mockingbird'?" documents = [ "'To Kill a Mockingbird' is a novel by Harper Lee published in 1960. It was immediately successful, winning the Pulitzer Prize, and has become a classic of modern American literature.", "The novel 'Moby-Dick' was written by Herman Melville and first published in 1851. It is considered a masterpiece of American literature and deals with complex themes of obsession, revenge, and the conflict between good and evil.", "Harper Lee, an American novelist widely known for her novel 'To Kill a Mockingbird', was born in 1926 in Monroeville, Alabama. She received the Pulitzer Prize for Fiction in 1961.", "Jane Austen was an English novelist known primarily for her six major novels, which interpret, critique and comment upon the British landed gentry at the end of the 18th century.", "The 'Harry Potter' series, which consists of seven fantasy novels written by British author J.K. Rowling, is among the most popular and critically acclaimed books of the modern era.", "'The Great Gatsby', a novel written by American author F. Scott Fitzgerald, was published in 1925. The story is set in the Jazz Age and follows the life of millionaire Jay Gatsby and his pursuit of Daisy Buchanan." ] # Lets get the scores results = model.rank(query, documents, return_documents=True, top_k=3) ``` <details> <summary>JavaScript Example</summary> Install [transformers.js](https://github.com/xenova/transformers.js) `npm i @xenova/transformers` Let's say you have a query, and you want to rerank a set of documents. In JavaScript, you need to add a function: ```javascript import { AutoTokenizer, AutoModelForSequenceClassification } from '@xenova/transformers'; const model_id = 'mixedbread-ai/mxbai-rerank-xsmall-v1'; const model = await AutoModelForSequenceClassification.from_pretrained(model_id); const tokenizer = await AutoTokenizer.from_pretrained(model_id); /** * Performs ranking with the CrossEncoder on the given query and documents. Returns a sorted list with the document indices and scores. * @param {string} query A single query * @param {string[]} documents A list of documents * @param {Object} options Options for ranking * @param {number} [options.top_k=undefined] Return the top-k documents. If undefined, all documents are returned. * @param {number} [options.return_documents=false] If true, also returns the documents. If false, only returns the indices and scores. */ async function rank(query, documents, { top_k = undefined, return_documents = false, } = {}) { const inputs = tokenizer( new Array(documents.length).fill(query), { text_pair: documents, padding: true, truncation: true, } ) const { logits } = await model(inputs); return logits .sigmoid() .tolist() .map(([score], i) => ({ corpus_id: i, score, ...(return_documents ? { text: documents[i] } : {}) })) .sort((a, b) => b.score - a.score) .slice(0, top_k); } // Example usage: const query = "Who wrote 'To Kill a Mockingbird'?" const documents = [ "'To Kill a Mockingbird' is a novel by Harper Lee published in 1960. It was immediately successful, winning the Pulitzer Prize, and has become a classic of modern American literature.", "The novel 'Moby-Dick' was written by Herman Melville and first published in 1851. It is considered a masterpiece of American literature and deals with complex themes of obsession, revenge, and the conflict between good and evil.", "Harper Lee, an American novelist widely known for her novel 'To Kill a Mockingbird', was born in 1926 in Monroeville, Alabama. She received the Pulitzer Prize for Fiction in 1961.", "Jane Austen was an English novelist known primarily for her six major novels, which interpret, critique and comment upon the British landed gentry at the end of the 18th century.", "The 'Harry Potter' series, which consists of seven fantasy novels written by British author J.K. Rowling, is among the most popular and critically acclaimed books of the modern era.", "'The Great Gatsby', a novel written by American author F. Scott Fitzgerald, was published in 1925. The story is set in the Jazz Age and follows the life of millionaire Jay Gatsby and his pursuit of Daisy Buchanan." ] const results = await rank(query, documents, { return_documents: true, top_k: 3 }); console.log(results); ``` </details> ## Using API You can use the large model via our API as follows: ```python from mixedbread_ai.client import MixedbreadAI mxbai = MixedbreadAI(api_key="{MIXEDBREAD_API_KEY}") res = mxbai.reranking( model="mixedbread-ai/mxbai-rerank-large-v1", query="Who is the author of To Kill a Mockingbird?", input=[ "To Kill a Mockingbird is a novel by Harper Lee published in 1960. It was immediately successful, winning the Pulitzer Prize, and has become a classic of modern American literature.", "The novel Moby-Dick was written by Herman Melville and first published in 1851. It is considered a masterpiece of American literature and deals with complex themes of obsession, revenge, and the conflict between good and evil.", "Harper Lee, an American novelist widely known for her novel To Kill a Mockingbird, was born in 1926 in Monroeville, Alabama. She received the Pulitzer Prize for Fiction in 1961.", "Jane Austen was an English novelist known primarily for her six major novels, which interpret, critique and comment upon the British landed gentry at the end of the 18th century.", "The Harry Potter series, which consists of seven fantasy novels written by British author J.K. Rowling, is among the most popular and critically acclaimed books of the modern era.", "The Great Gatsby, a novel written by American author F. Scott Fitzgerald, was published in 1925. The story is set in the Jazz Age and follows the life of millionaire Jay Gatsby and his pursuit of Daisy Buchanan." ], top_k=3, return_input=false ) print(res.data) ``` The API comes with additional features, such as a continous trained reranker! Check out the [docs](https://www.mixedbread.ai/docs) for more information. ## Evaluation Our reranker models are designed to elevate your search. They work extremely well in combination with keyword search and can even outperform semantic search systems in many cases. | Model | NDCG@10 | Accuracy@3 | | ------------------------------------------------------------------------------------- | -------- | ---------- | | Lexical Search (Lucene) | 38.0 | 66.4 | | [BAAI/bge-reranker-base](https://huggingface.co/BAAI/bge-reranker-base) | 41.6 | 66.9 | | [BAAI/bge-reranker-large](https://huggingface.co/BAAI/bge-reranker-large) | 45.2 | 70.6 | | cohere-embed-v3 (semantic search) | 47.5 | 70.9 | | [mxbai-rerank-xsmall-v1](https://huggingface.co/mixedbread-ai/mxbai-rerank-xsmall-v1) | **43.9** | **70.0** | | [mxbai-rerank-base-v1](https://huggingface.co/mixedbread-ai/mxbai-rerank-base-v1) | **46.9** | **72.3** | | [mxbai-rerank-large-v1](https://huggingface.co/mixedbread-ai/mxbai-rerank-large-v1) | **48.8** | **74.9** | The reported results are aggregated from 11 datasets of BEIR. We used [Pyserini](https://github.com/castorini/pyserini/) to evaluate the models. Find more in our [blog-post](https://www.mixedbread.ai/blog/mxbai-rerank-v1) and on this [spreadsheet](https://docs.google.com/spreadsheets/d/15ELkSMFv-oHa5TRiIjDvhIstH9dlc3pnZeO-iGz4Ld4/edit?usp=sharing). ## Community Please join our [Discord Community](https://discord.gg/jDfMHzAVfU) and share your feedback and thoughts! We are here to help and also always happy to chat. ## License Apache 2.0

nferruz/ProtGPT2

nferruz

transformers

text-generation

--- license: apache-2.0 pipeline_tag: text-generation widget: - text: "<|endoftext|>" inference: parameters: top_k: 950 repetition_penalty: 1.2 --- # **ProtGPT2** ProtGPT2 ([peer-reviewed paper](https://www.nature.com/articles/s41467-022-32007-7)) is a language model that speaks the protein language and can be used for de novo protein design and engineering. ProtGPT2 generated sequences conserve natural proteins' critical features (amino acid propensities, secondary structural content, and globularity) while exploring unseen regions of the protein space. ## **Model description** ProtGPT2 is based on the GPT2 Transformer architecture and contains 36 layers with a model dimensionality of 1280, totalling 738 million parameters. ProtGPT2 is a decoder-only transformer model pre-trained on the protein space, database UniRef50 (version 2021_04). The pre-training was done on the raw sequences without FASTA headers. Details of training and datasets can be found here: https://huggingface.co/datasets/nferruz/UR50_2021_04 ProtGPT2 was trained in a self-supervised fashion, i.e., the raw sequence data was used during training without including the annotation of sequences. In particular, ProtGPT2 was trained using a causal modelling objective, in which the model is trained to predict the next token (or, in this case, oligomer) in the sequence. By doing so, the model learns an internal representation of proteins and is able to <em>speak</em> the protein language. ### **How to use ProtGPT2** ProtGPT2 can be used with the HuggingFace transformer python package. Detailed installation instructions can be found here: https://huggingface.co/docs/transformers/installation Since ProtGPT2 has been trained on the classical language model objective, it excels at generating protein sequences. It can be used to generate sequences in a zero-shot fashion or to generate sequences of a particular type after finetuning on a user-defined dataset. **Example 1: Generating _de novo_ proteins in a zero-shot fashion** In the example below, ProtGPT2 generates sequences that follow the amino acid 'M'. Any other amino acid, oligomer, fragment, or protein of choice can be selected instead. The model will generate the most probable sequences that follow the input. Alternatively, the input field can also be left empty and it will choose the starting tokens. ``` >>> from transformers import pipeline >>> protgpt2 = pipeline('text-generation', model="nferruz/ProtGPT2") # length is expressed in tokens, where each token has an average length of 4 amino acids. >>> sequences = protgpt2("<|endoftext|>", max_length=100, do_sample=True, top_k=950, repetition_penalty=1.2, num_return_sequences=10, eos_token_id=0) >>> for seq in sequences: print(seq): {'generated_text': 'MINDLLDISRIISGKMTLDRAEVNLTAIARQVVEEQRQAAEAKSIQLLCSTPDTNHYVFG\nDFDRLKQTLWNLLSNAVKFTPSGGTVELELGYNAEGMEVYVKDSGIGIDPAFLPYVFDRF\nRQSDAADSRNYGGLGLGLAIVKHLLDLHEGNVSAQSEGFGKGATFTVLLPLKPLKRELAA\nVNRHTAVQQSAPLNDNLAGMKILIVEDRPDTNEMVSYILEEAGAIVETAESGAAALTSLK\nSYSPDLVLSDIGMPMMDGYEMIEYIREWKTTKGG'} {'generated_text': 'MQGDSSISSSNRMFT\nLCKPLTVANETSTLSTTRNSKSNKRVSKQRVNLAESPERNAPSPASIKTNETEEFSTIKT\nTNNEVLGYEPNYVSYDFVPMEKCNLCNENCSIELASLNEETFVKKTICCHECRKKAIENA\nENNNTKGSAVSNNSVTSSSGRKKIIVSGSQILRNLDSLTSSKSNISTLLNPNHLAKLAKN\nGNLSSLSSLQSSASSISKSSSTSSTPTTSPKVSSPTNSPSSSPINSPTP'} {'generated_text': 'M\nSTHVSLENTLASLQATFFSLEARHTALETQLLSTRTELAATKQELVRVQAEISRADAQAQ\nDLKAQILTLKEKADQAEVEAAAATQRAEESQAALEAQTAELAQLRLEKQAPQHVAEEGDP\nQPAAPTTQAQSPVTSAAAAASSAASAEPSKPELTFPAYTKRKPPTITHAPKAPTKVALNP\nSTLSTSGSGGGAKADPTPTTPVPSSSAGLIPKALRLPPPVTPAASGAKPAPSARSKLRGP\nDAPLSPSTQS'} {'generated_text': 'MVLLSTGPLPILFLGPSLAELNQKYQVVSDTLLRFTNTV\nTFNTLKFLGSDS\n'} {'generated_text': 'M\nNNDEQPFIMSTSGYAGNTTSSMNSTSDFNTNNKSNTWSNRFSNFIAYFSGVGWFIGAISV\nIFFIIYVIVFLSRKTKPSGQKQYSRTERNNRDVDSIKRANYYG\n'} {'generated_text': 'M\nEAVYSFTITETGTGTVEVTPLDRTISGADIVYPPDTACVPLTVQPVINANGTWTLGSGCT\nGHFSVDTTGHVNCLTGGFGAAGVHTVIYTVETPYSGNSFAVIDVNVTEPSGPGDGGNGNG\nDRGDGPDNGGGNNPGPDPDPSTPPPPGDCSSPLPVVCSDRDCADFDTQAQVQIYLDRYGG\nTCDLDGNHDGTPCENLPNNSGGQSSDSGNGGGNPGTGSTHQVVTGDCLWNIASRNNGQGG\nQAWPALLAANNESITNP'} {'generated_text': 'M\nGLTTSGGARGFCSLAVLQELVPRPELLFVIDRAFHSGKHAVDMQVVDQEGLGDGVATLLY\nAHQGLYTCLLQAEARLLGREWAAVPALEPNFMESPLIALPRQLLEGLEQNILSAYGSEWS\nQDVAEPQGDTPAALLATALGLHEPQQVAQRRRQLFEAAEAALQAIRASA\n'} {'generated_text': 'M\nGAAGYTGSLILAALKQNPDIAVYALNRNDEKLKDVCGQYSNLKGQVCDLSNESQVEALLS\nGPRKTVVNLVGPYSFYGSRVLNACIEANCHYIDLTGEVYWIPQMIKQYHHKAVQSGARIV\nPAVGFDSTPAELGSFFAYQQCREKLKKAHLKIKAYTGQSGGASGGTILTMIQHGIENGKI\nLREIRSMANPREPQSDFKHYKEKTFQDGSASFWGVPFVMKGINTPVVQRSASLLKKLYQP\nFDYKQCFSFSTLLNSLFSYIFNAI'} {'generated_text': 'M\nKFPSLLLDSYLLVFFIFCSLGLYFSPKEFLSKSYTLLTFFGSLLFIVLVAFPYQSAISAS\nKYYYFPFPIQFFDIGLAENKSNFVTSTTILIFCFILFKRQKYISLLLLTVVLIPIISKGN\nYLFIILILNLAVYFFLFKKLYKKGFCISLFLVFSCIFIFIVSKIMYSSGIEGIYKELIFT\nGDNDGRFLIIKSFLEYWKDNLFFGLGPSSVNLFSGAVSGSFHNTYFFIFFQSGILGAFIF\nLLPFVYFFISFFKDNSSFMKLF'} {'generated_text': 'M\nRRAVGNADLGMEAARYEPSGAYQASEGDGAHGKPHSLPFVALERWQQLGPEERTLAEAVR\nAVLASGQYLLGEAVRRFETAVAAWLGVPFALGVASGTAALTLALRAYGVGPGDEVIVPAI\nTFIATSNAITAAGARPVLVDIDPSTWNMSVASLAARLTPKTKAILAVHLWGQPVDMHPLL\nDIAAQANLAVIEDCAQALGASIAGTKVGTFGDAAAFSFYPTKNMTTGEGGMLVTNARDLA\nQAARMLRSHGQDPPTAYMHSQVGFN'} ``` **Example 2: Finetuning on a set of user-defined sequences** This alternative option to the zero-shot generation permits introducing direction in the generation process. User-defined training and validation files containing the sequences of interest are provided to the model. After a short update of the model's weights, ProtGPT2 will generate sequences that follow the input properties. To create the validation and training file, it is necessary to (1) substitute the FASTA headers for each sequence with the expression "<|endoftext|>" and (2) split the originating dataset into training and validation files (this is often done with the ratio 90/10, 80/20 or 95/5). Then, to finetune the model to the input sequences, we can use the example below. Here we show a learning rate of 1e-06, but ideally, the learning rate should be optimised in separate runs. After training, the finetuned model will be stored in the ./output folder. Lastly, ProtGPT2 can generate the tailored sequences as shown in Example 1: ``` python run_clm.py --model_name_or_path nferruz/ProtGPT2 --train_file training.txt --validation_file validation.txt --tokenizer_name nferruz/ProtGPT2 --do_train --do_eval --output_dir output --learning_rate 1e-06 ``` The HuggingFace script run_clm.py can be found here: https://github.com/huggingface/transformers/blob/master/examples/pytorch/language-modeling/run_clm.py ### **How to select the best sequences** We've observed that perplexity values correlate with AlphaFold2's plddt. We recommend computing perplexity for each sequence as follows: ``` sequence='MGEAMGLTQPAVSRAVARLEERVGIRIFNRTARAITLTDEGRRFYEAVAPLLAGIEMHGYR\nVNVEGVAQLLELYARDILAEGRLVQLLPEWAD' #Convert the sequence to a string like this #(note we have to introduce new line characters every 60 amino acids, #following the FASTA file format). sequence = "<|endoftext|>\nMGEAMGLTQPAVSRAVARLEERVGIRIFNRTARAITLTDEGRRFYEAVAPLLAGIEMHGY\nRVNVEGVAQLLELYARDILAEGRLVQLLPEWAD\n<|endoftext|>" # ppl function def calculatePerplexity(sequence, model, tokenizer): input_ids = torch.tensor(tokenizer.encode(sequence)).unsqueeze(0) input_ids = input_ids.to(device) with torch.no_grad(): outputs = model(input_ids, labels=input_ids) loss, logits = outputs[:2] return math.exp(loss) #And hence: ppl = calculatePerplexity(sequence, model, tokenizer) ``` Where `ppl` is a value with the perplexity for that sequence. We do not yet have a threshold as to what perplexity value gives a 'good' or 'bad' sequence, but given the fast inference times, the best is to sample many sequences, order them by perplexity, and select those with the lower values (the lower the better). ### **Training specs** The model was trained on 128 NVIDIA A100 GPUs for 50 epochs, using a block size of 512 and a total batch size of 1024 (65,536 tokens per batch). The optimizer used was Adam (beta1 = 0.9, beta2 = 0.999) with a learning rate of 1e-3.

bond005/whisper-large-v3-ru-podlodka

bond005

transformers

automatic-speech-recognition

--- license: apache-2.0 widget: - example_title: Нейронные сети - это хорошо! src: >- https://huggingface.co/bond005/whisper-large-v3-ru-podlodka/resolve/main/test_sound_ru.flac - example_title: >- К сожалению, система распознавания речи не всегда стабильна, особенно в шумных условиях. src: >- https://huggingface.co/bond005/whisper-large-v3-ru-podlodka/resolve/main/test_sound_with_noise.wav - example_title: >- Мимо театра мальчик ходил довольно часто — белое, со взбитыми сливками, здание-торт. src: >- https://huggingface.co/bond005/whisper-large-v3-ru-podlodka/resolve/main/anna_matveeva_test.wav datasets: - bond005/taiga_speech_v2 - bond005/podlodka_speech - bond005/rulibrispeech language: - ru pipeline_tag: automatic-speech-recognition metrics: - wer model-index: - name: Whisper Large V3 Russian Podlodka by Ivan Bondarenko results: - task: name: Speech Recognition type: automatic-speech-recognition dataset: name: Podlodka.io type: bond005/podlodka_speech args: ru metrics: - name: WER (with punctuation and capital letters) type: wer value: 20.910 - task: name: Speech Recognition type: automatic-speech-recognition dataset: name: Podlodka.io type: bond005/podlodka_speech args: ru metrics: - name: WER (without punctuation) type: wer value: 10.987 - task: name: Speech Recognition type: automatic-speech-recognition dataset: name: Russian Librispeech type: bond005/rulibrispeech args: ru metrics: - name: WER (without punctuation) type: wer value: 9.795 ---

Intel/dpt-beit-base-384

Intel

transformers

depth-estimation

--- license: mit --- # DPT 3.1 (BEiT backbone) DPT (Dense Prediction Transformer) model trained on 1.4 million images for monocular depth estimation. It was introduced in the paper [Vision Transformers for Dense Prediction](https://arxiv.org/abs/2103.13413) by Ranftl et al. (2021) and first released in [this repository](https://github.com/isl-org/MiDaS/tree/master). Disclaimer: The team releasing DPT did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description This DPT model uses the [BEiT](https://huggingface.co/docs/transformers/model_doc/beit) model as backbone and adds a neck + head on top for monocular depth estimation.  ## How to use Here is how to use this model for zero-shot depth estimation on an image: ```python from transformers import DPTImageProcessor, DPTForDepthEstimation import torch import numpy as np from PIL import Image import requests url = "http://images.cocodataset.org/val2017/000000039769.jpg" image = Image.open(requests.get(url, stream=True).raw) processor = DPTImageProcessor.from_pretrained("Intel/dpt-beit-base-384") model = DPTForDepthEstimation.from_pretrained("Intel/dpt-beit-base-384") # prepare image for the model inputs = processor(images=image, return_tensors="pt") with torch.no_grad(): outputs = model(**inputs) predicted_depth = outputs.predicted_depth # interpolate to original size prediction = torch.nn.functional.interpolate( predicted_depth.unsqueeze(1), size=image.size[::-1], mode="bicubic", align_corners=False, ) # visualize the prediction output = prediction.squeeze().cpu().numpy() formatted = (output * 255 / np.max(output)).astype("uint8") depth = Image.fromarray(formatted) ``` or one can use the pipeline API: ```python from transformers import pipeline pipe = pipeline(task="depth-estimation", model="Intel/dpt-beit-base-384") result = pipe("http://images.cocodataset.org/val2017/000000039769.jpg") result["depth"] ```

nielsr/lilt-xlm-roberta-base

nielsr

transformers

feature-extraction

--- language: - multilingual - af - am - ar - as - az - be - bg - bn - br - bs - ca - cs - cy - da - de - el - en - eo - es - et - eu - fa - fi - fr - fy - ga - gd - gl - gu - ha - he - hi - hr - hu - hy - id - is - it - ja - jv - ka - kk - km - kn - ko - ku - ky - la - lo - lt - lv - mg - mk - ml - mn - mr - ms - my - ne - nl - no - om - or - pa - pl - ps - pt - ro - ru - sa - sd - si - sk - sl - so - sq - sr - su - sv - sw - ta - te - th - tl - tr - ug - uk - ur - uz - vi - xh - yi - zh license: mit --- # LiLT + XLM-RoBERTa-base This model is created by combining the Language-Independent Layout Transformer (LiLT) with [XLM-RoBERTa](https://huggingface.co/xlm-roberta-base), a multilingual RoBERTa model (trained on 100 languages). This way, we have a LayoutLM-like model for 100 languages :)

sentence-transformers/sentence-t5-xl

sentence-transformers

sentence-transformers

sentence-similarity

--- language: en license: apache-2.0 library_name: sentence-transformers tags: - sentence-transformers - feature-extraction - sentence-similarity pipeline_tag: sentence-similarity --- # sentence-transformers/sentence-t5-xl This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 768 dimensional dense vector space. The model works well for sentence similarity tasks, but doesn't perform that well for semantic search tasks. This model was converted from the Tensorflow model [st5-3b-1](https://tfhub.dev/google/sentence-t5/st5-3b/1) to PyTorch. When using this model, have a look at the publication: [Sentence-T5: Scalable sentence encoders from pre-trained text-to-text models](https://arxiv.org/abs/2108.08877). The tfhub model and this PyTorch model can produce slightly different embeddings, however, when run on the same benchmarks, they produce identical results. The model uses only the encoder from a T5-3B model. The weights are stored in FP16. ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer sentences = ["This is an example sentence", "Each sentence is converted"] model = SentenceTransformer('sentence-transformers/sentence-t5-xl') embeddings = model.encode(sentences) print(embeddings) ``` The model requires sentence-transformers version 2.2.0 or newer. ## Evaluation Results For an automated evaluation of this model, see the *Sentence Embeddings Benchmark*: [https://seb.sbert.net](https://seb.sbert.net?model_name=sentence-transformers/sentence-t5-xl) ## Citing & Authors If you find this model helpful, please cite the respective publication: [Sentence-T5: Scalable sentence encoders from pre-trained text-to-text models](https://arxiv.org/abs/2108.08877)

defog/sqlcoder-7b-2

defog

transformers

text-generation

--- license: cc-by-sa-4.0 library_name: transformers pipeline_tag: text-generation --- # Update notice The model weights were updated at 7 AM UTC on Feb 7, 2024. The new model weights lead to a much more performant model – particularly for joins. If you downloaded the model before that, please redownload the weights for best performance. # Model Card for SQLCoder-7B-2 A capable large language model for natural language to SQL generation.  ## Model Details ### Model Description <!-- Provide a longer summary of what this model is. --> This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated. - **Developed by:** [Defog, Inc](https://defog.ai) - **Model type:** [Text to SQL] - **License:** [CC-by-SA-4.0] - **Finetuned from model:** [CodeLlama-7B] ### Model Sources [optional] - [**HuggingFace:**](https://huggingface.co/defog/sqlcoder-70b-alpha) - [**GitHub:**](https://github.com/defog-ai/sqlcoder) - [**Demo:**](https://defog.ai/sqlcoder-demo/) ## Uses This model is intended to be used by non-technical users to understand data inside their SQL databases. It is meant as an analytics tool, and not as a database admin tool. This model has not been trained to reject malicious requests from users with write access to databases, and should only be used by users with read-only access. ## How to Get Started with the Model Use the code [here](https://github.com/defog-ai/sqlcoder/blob/main/inference.py) to get started with the model. ## Prompt Please use the following prompt for optimal results. Please remember to use `do_sample=False` and `num_beams=4` for optimal results. ``` ### Task Generate a SQL query to answer [QUESTION]{user_question}[/QUESTION] ### Database Schema The query will run on a database with the following schema: {table_metadata_string_DDL_statements} ### Answer Given the database schema, here is the SQL query that [QUESTION]{user_question}[/QUESTION] [SQL] ``` ## Evaluation This model was evaluated on [SQL-Eval](https://github.com/defog-ai/sql-eval), a PostgreSQL based evaluation framework developed by Defog for testing and alignment of model capabilities. You can read more about the methodology behind SQLEval [here](https://defog.ai/blog/open-sourcing-sqleval/). ### Results We classified each generated question into one of 6 categories. The table displays the percentage of questions answered correctly by each model, broken down by category. | | date | group_by | order_by | ratio | join | where | | -------------- | ---- | -------- | -------- | ----- | ---- | ----- | | sqlcoder-70b | 96 | 91.4 | 97.1 | 85.7 | 97.1 | 91.4 | | sqlcoder-7b-2 | 96 | 91.4 | 94.3 | 91.4 | 94.3 | 77.1 | | sqlcoder-34b | 80 | 94.3 | 85.7 | 77.1 | 85.7 | 80 | | gpt-4 | 72 | 94.3 | 97.1 | 80 | 91.4 | 80 | | gpt-4-turbo | 76 | 91.4 | 91.4 | 62.8 | 88.6 | 77.1 | | natural-sql-7b | 56 | 88.6 | 85.7 | 60 | 88.6 | 80 | | sqlcoder-7b | 64 | 82.9 | 74.3 | 54.3 | 74.3 | 74.3 | | gpt-3.5 | 72 | 77.1 | 82.8 | 34.3 | 65.7 | 71.4 | | claude-2 | 52 | 71.4 | 74.3 | 57.1 | 65.7 | 62.9 | ## Model Card Contact Contact us on X at [@defogdata](https://twitter.com/defogdata), or on email at [founders@defog.ai](mailto:founders@defog.ai)

mesolitica/sentiment-analysis-nanot5-small-malaysian-cased

mesolitica

transformers

text-classification

Entry not found

mesolitica/emotion-analysis-nanot5-small-malaysian-cased

mesolitica

transformers

text-classification

Entry not found

pkshatech/GLuCoSE-base-ja

pkshatech

sentence-transformers

sentence-similarity

--- pipeline_tag: sentence-similarity language: ja license: apache-2.0 tags: - transformers - sentence-similarity - feature-extraction - sentence-transformers inference: false datasets: - mc4 - clips/mqa - shunk031/JGLUE - paws-x - MoritzLaurer/multilingual-NLI-26lang-2mil7 - castorini/mr-tydi - hpprc/jsick base_model: studio-ousia/luke-base --- # GLuCoSE (General Luke-based Contrastive Sentence Embedding)-base-Japanese [日本語のREADME/Japanese README](https://huggingface.co/pkshatech/GLuCoSE-base-ja/blob/main/README_JA.md) GLuCoSE (General LUke-based COntrastive Sentence Embedding, "glucose") is a Japanese text embedding model based on [LUKE](https://github.com/studio-ousia/luke). In order to create a general-purpose, user-friendly Japanese text embedding model, GLuCoSE has been trained on a mix of web data and various datasets associated with natural language inference and search. This model is not only suitable for sentence vector similarity tasks but also for semantic search tasks. - Maximum token count: 512 - Output dimension: 768 - Pooling: mean pooling - Supported language: Japanese ## Usage You can use this model easily with [sentence-transformers](https://www.SBERT.net). First, install sentence-transformers with pip as follows: ``` pip install -U sentence-transformers ``` You can load the model and convert sentences into dense vectors as shown below: ```python from sentence_transformers import SentenceTransformer sentences = [ "PKSHA Technologyは機械学習/深層学習技術に関わるアルゴリズムソリューションを展開している。", "この深層学習モデルはPKSHA Technologyによって学習され、公開された。", "広目天は、仏教における四天王の一尊であり、サンスクリット語の「種々の眼をした者」を名前の由来とする。", ] model = SentenceTransformer('pkshatech/GLuCoSE-base-ja') embeddings = model.encode(sentences) print(embeddings) ``` Since the loss function used during training is cosine similarity, we recommend using cosine similarity for downstream tasks. This text embedding model can also be used in LangChain. Please refer to [this page](https://python.langchain.com/docs/modules/data_connection/text_embedding/integrations/sentence_transformers) for more information. ## Resources Used The following resources were used to train this model. ### Pre-trained model - [studio-ousia/luke-japanese-base-lite](https://huggingface.co/studio-ousia/luke-japanese-base-lite) ### Datasets - [mC4](https://huggingface.co/datasets/mc4) - [MQA](https://huggingface.co/datasets/clips/mqa) - [JNLI](https://github.com/yahoojapan/JGLUE) - [JSNLI](https://nlp.ist.i.kyoto-u.ac.jp/?%E6%97%A5%E6%9C%AC%E8%AA%9ESNLI%28JSNLI%29%E3%83%87%E3%83%BC%E3%82%BF%E3%82%BB%E3%83%83%E3%83%88) - [PAWS-X](https://huggingface.co/datasets/paws-x) - [JSeM](https://github.com/DaisukeBekki/JSeM) - [MoritzLaurer/multilingual-NLI-26lang-2mil7](https://huggingface.co/datasets/MoritzLaurer/multilingual-NLI-26lang-2mil7) - [MultiNLI](https://huggingface.co/datasets/multi_nli) - [WANLI](https://huggingface.co/datasets/alisawuffles/WANLI) - [FeverNLI](https://github.com/easonnie/combine-FEVER-NSMN/blob/master/other_resources/nli_fever.md) - [LingNLI](https://arxiv.org/pdf/2104.07179.pdf) - [JSICK](https://github.com/verypluming/JSICK) - [Mr.Tidy](https://huggingface.co/datasets/castorini/mr-tydi) - [JSTS](https://github.com/yahoojapan/JGLUE) (used for validation) [^1] ## Benchmarks ### Semantic Similarity Calculation ([JSTS](https://github.com/yahoojapan/JGLUE) dev set) Evaluation by Spearman's correlation coefficient and Pearson's correlation coefficient. | Model | Spearman | Pearson | | --- | --- | --- | | [text-embedding-ada-002](https://platform.openai.com/docs/guides/embeddings) |0.837[^2] | 0.790[^2] | | [pkshatech/simcse-ja-bert-base-clcmlp](https://huggingface.co/pkshatech/simcse-ja-bert-base-clcmlp)[^3] | 0.850 | 0.801 | | pkshatech/GLuCoSE-base-ja | **0.864** | **0.818** | ### Zero-shot Search ([AIO3](https://sites.google.com/view/project-aio/competition3?authuser=0) dev set) Evaluation by top-k retrieval accuracy[^4] (the fraction of questions that have a correct answer in the top-k retrieved documents at least once.) | Model | Top-1 | Top-5 | Top-10 | Top-50 | | --- | --- | --- | --- | --- | | [text-embedding-ada-002](https://platform.openai.com/docs/guides/embeddings) | 33.50 | 57.80 | 65.10 | 76.60 | | [pkshatech/simcse-ja-bert-base-clcmlp](https://huggingface.co/pkshatech/simcse-ja-bert-base-clcmlp)[^3] | 30.60 | 54.50 | 62.50 | 76.70 | | pkshatech/GLuCoSE-base-ja | **36.10** | **59.40** | **66.40** | **78.30** | # Authors [Akihiko Fukuchi](https://huggingface.co/akiFQC), [Yuichiro Hoshino](https://huggingface.co/Yuichiroh), [Yotarow Watanabe](https://huggingface.co/yotarow) ## License This model is published under the [Apache License, Version 2.0](https://www.apache.org/licenses/LICENSE-2.0). [^1]: When we trained this model, the test data of JGLUE was not released, so we used the dev set of JGLUE as a private evaluation data. Therefore, we selected the checkpoint on the train set of JGLUE insted of its dev set. [^2]: https://qiita.com/akeyhero/items/ce371bfed64399027c23 [^3]: This is the model we have released before. [^4]: For more details, please refer to https://arxiv.org/pdf/2004.04906.pdf.

Copycats/koelectra-base-v3-generalized-sentiment-analysis

Copycats

transformers

text-classification

--- license: apache-2.0 language: - ko library_name: transformers pipeline_tag: text-classification --- # Usage ```python # import library import torch from transformers import AutoTokenizer, AutoModelForSequenceClassification, TextClassificationPipeline # load model tokenizer = AutoTokenizer.from_pretrained("jaehyeong/koelectra-base-v3-generalized-sentiment-analysis") model = AutoModelForSequenceClassification.from_pretrained("jaehyeong/koelectra-base-v3-generalized-sentiment-analysis") sentiment_classifier = TextClassificationPipeline(tokenizer=tokenizer, model=model) # target reviews review_list = [ '이쁘고 좋아요~~~씻기도 편하고 아이고 이쁘다고 자기방에 갖다놓고 잘써요~^^', '아직 입어보진 않았지만 굉장히 가벼워요~~ 다른 리뷰처럼 어깡이 좀 되네요ㅋ 만족합니다. 엄청 빠른발송 감사드려요 :)', '재구매 한건데 너무너무 가성비인거 같아요!! 다음에 또 생각나면 3개째 또 살듯..ㅎㅎ', '가습량이 너무 적어요. 방이 작지 않다면 무조건 큰걸로구매하세요. 물량도 조금밖에 안들어가서 쓰기도 불편함', '한번입었는데 옆에 봉제선 다 풀리고 실밥도 계속 나옵니다. 마감 처리 너무 엉망 아닌가요?', '따뜻하고 좋긴한데 배송이 느려요', '맛은 있는데 가격이 있는 편이에요' ] # predict for idx, review in enumerate(review_list): pred = sentiment_classifier(review) print(f'{review}\n>> {pred[0]}') ``` ``` 이쁘고 좋아요~~~씻기도 편하고 아이고 이쁘다고 자기방에 갖다놓고 잘써요~^^ >> {'label': '1', 'score': 0.9945501685142517} 아직 입어보진 않았지만 굉장히 가벼워요~~ 다른 리뷰처럼 어깡이 좀 되네요ㅋ 만족합니다. 엄청 빠른발송 감사드려요 :) >> {'label': '1', 'score': 0.995430588722229} 재구매 한건데 너무너무 가성비인거 같아요!! 다음에 또 생각나면 3개째 또 살듯..ㅎㅎ >> {'label': '1', 'score': 0.9959582686424255} 가습량이 너무 적어요. 방이 작지 않다면 무조건 큰걸로구매하세요. 물량도 조금밖에 안들어가서 쓰기도 불편함 >> {'label': '0', 'score': 0.9984619617462158} 한번입었는데 옆에 봉제선 다 풀리고 실밥도 계속 나옵니다. 마감 처리 너무 엉망 아닌가요? >> {'label': '0', 'score': 0.9991756677627563} 따뜻하고 좋긴한데 배송이 느려요 >> {'label': '1', 'score': 0.6473883390426636} 맛은 있는데 가격이 있는 편이에요 >> {'label': '1', 'score': 0.5128092169761658} ``` - label 0 : negative review - label 1 : positive review

timm/resnet101.a1h_in1k

timm

timm

image-classification

--- license: apache-2.0 library_name: timm tags: - image-classification - timm --- # Model card for resnet101.a1h_in1k A ResNet-B image classification model. This model features: * ReLU activations * single layer 7x7 convolution with pooling * 1x1 convolution shortcut downsample Trained on ImageNet-1k in `timm` using recipe template described below. Recipe details: * Based on [ResNet Strikes Back](https://arxiv.org/abs/2110.00476) `A1` recipe * LAMB optimizer * Stronger dropout, stochastic depth, and RandAugment than paper `A1` recipe * Cosine LR schedule with warmup ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 44.5 - GMACs: 7.8 - Activations (M): 16.2 - Image size: train = 224 x 224, test = 288 x 288 - **Papers:** - ResNet strikes back: An improved training procedure in timm: https://arxiv.org/abs/2110.00476 - Deep Residual Learning for Image Recognition: https://arxiv.org/abs/1512.03385 - **Original:** https://github.com/huggingface/pytorch-image-models ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('resnet101.a1h_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Feature Map Extraction ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'resnet101.a1h_in1k', pretrained=True, features_only=True, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 for o in output: # print shape of each feature map in output # e.g.: # torch.Size([1, 64, 112, 112]) # torch.Size([1, 256, 56, 56]) # torch.Size([1, 512, 28, 28]) # torch.Size([1, 1024, 14, 14]) # torch.Size([1, 2048, 7, 7]) print(o.shape) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'resnet101.a1h_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled, a (1, 2048, 7, 7) shaped tensor output = model.forward_head(output, pre_logits=True) # output is a (1, num_features) shaped tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). |model |img_size|top1 |top5 |param_count|gmacs|macts|img/sec| |------------------------------------------|--------|-----|-----|-----------|-----|-----|-------| |[seresnextaa101d_32x8d.sw_in12k_ft_in1k_288](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k_288)|320 |86.72|98.17|93.6 |35.2 |69.7 |451 | |[seresnextaa101d_32x8d.sw_in12k_ft_in1k_288](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k_288)|288 |86.51|98.08|93.6 |28.5 |56.4 |560 | |[seresnextaa101d_32x8d.sw_in12k_ft_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k)|288 |86.49|98.03|93.6 |28.5 |56.4 |557 | |[seresnextaa101d_32x8d.sw_in12k_ft_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.sw_in12k_ft_in1k)|224 |85.96|97.82|93.6 |17.2 |34.2 |923 | |[resnext101_32x32d.fb_wsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x32d.fb_wsl_ig1b_ft_in1k)|224 |85.11|97.44|468.5 |87.3 |91.1 |254 | |[resnetrs420.tf_in1k](https://huggingface.co/timm/resnetrs420.tf_in1k)|416 |85.0 |97.12|191.9 |108.4|213.8|134 | |[ecaresnet269d.ra2_in1k](https://huggingface.co/timm/ecaresnet269d.ra2_in1k)|352 |84.96|97.22|102.1 |50.2 |101.2|291 | |[ecaresnet269d.ra2_in1k](https://huggingface.co/timm/ecaresnet269d.ra2_in1k)|320 |84.73|97.18|102.1 |41.5 |83.7 |353 | |[resnetrs350.tf_in1k](https://huggingface.co/timm/resnetrs350.tf_in1k)|384 |84.71|96.99|164.0 |77.6 |154.7|183 | |[seresnextaa101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.ah_in1k)|288 |84.57|97.08|93.6 |28.5 |56.4 |557 | |[resnetrs200.tf_in1k](https://huggingface.co/timm/resnetrs200.tf_in1k)|320 |84.45|97.08|93.2 |31.5 |67.8 |446 | |[resnetrs270.tf_in1k](https://huggingface.co/timm/resnetrs270.tf_in1k)|352 |84.43|96.97|129.9 |51.1 |105.5|280 | |[seresnext101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101d_32x8d.ah_in1k)|288 |84.36|96.92|93.6 |27.6 |53.0 |595 | |[seresnet152d.ra2_in1k](https://huggingface.co/timm/seresnet152d.ra2_in1k)|320 |84.35|97.04|66.8 |24.1 |47.7 |610 | |[resnetrs350.tf_in1k](https://huggingface.co/timm/resnetrs350.tf_in1k)|288 |84.3 |96.94|164.0 |43.7 |87.1 |333 | |[resnext101_32x8d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x8d.fb_swsl_ig1b_ft_in1k)|224 |84.28|97.17|88.8 |16.5 |31.2 |1100 | |[resnetrs420.tf_in1k](https://huggingface.co/timm/resnetrs420.tf_in1k)|320 |84.24|96.86|191.9 |64.2 |126.6|228 | |[seresnext101_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101_32x8d.ah_in1k)|288 |84.19|96.87|93.6 |27.2 |51.6 |613 | |[resnext101_32x16d.fb_wsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x16d.fb_wsl_ig1b_ft_in1k)|224 |84.18|97.19|194.0 |36.3 |51.2 |581 | |[resnetaa101d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa101d.sw_in12k_ft_in1k)|288 |84.11|97.11|44.6 |15.1 |29.0 |1144 | |[resnet200d.ra2_in1k](https://huggingface.co/timm/resnet200d.ra2_in1k)|320 |83.97|96.82|64.7 |31.2 |67.3 |518 | |[resnetrs200.tf_in1k](https://huggingface.co/timm/resnetrs200.tf_in1k)|256 |83.87|96.75|93.2 |20.2 |43.4 |692 | |[seresnextaa101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnextaa101d_32x8d.ah_in1k)|224 |83.86|96.65|93.6 |17.2 |34.2 |923 | |[resnetrs152.tf_in1k](https://huggingface.co/timm/resnetrs152.tf_in1k)|320 |83.72|96.61|86.6 |24.3 |48.1 |617 | |[seresnet152d.ra2_in1k](https://huggingface.co/timm/seresnet152d.ra2_in1k)|256 |83.69|96.78|66.8 |15.4 |30.6 |943 | |[seresnext101d_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101d_32x8d.ah_in1k)|224 |83.68|96.61|93.6 |16.7 |32.0 |986 | |[resnet152d.ra2_in1k](https://huggingface.co/timm/resnet152d.ra2_in1k)|320 |83.67|96.74|60.2 |24.1 |47.7 |706 | |[resnetrs270.tf_in1k](https://huggingface.co/timm/resnetrs270.tf_in1k)|256 |83.59|96.61|129.9 |27.1 |55.8 |526 | |[seresnext101_32x8d.ah_in1k](https://huggingface.co/timm/seresnext101_32x8d.ah_in1k)|224 |83.58|96.4 |93.6 |16.5 |31.2 |1013 | |[resnetaa101d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa101d.sw_in12k_ft_in1k)|224 |83.54|96.83|44.6 |9.1 |17.6 |1864 | |[resnet152.a1h_in1k](https://huggingface.co/timm/resnet152.a1h_in1k)|288 |83.46|96.54|60.2 |19.1 |37.3 |904 | |[resnext101_32x16d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x16d.fb_swsl_ig1b_ft_in1k)|224 |83.35|96.85|194.0 |36.3 |51.2 |582 | |[resnet200d.ra2_in1k](https://huggingface.co/timm/resnet200d.ra2_in1k)|256 |83.23|96.53|64.7 |20.0 |43.1 |809 | |[resnext101_32x4d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x4d.fb_swsl_ig1b_ft_in1k)|224 |83.22|96.75|44.2 |8.0 |21.2 |1814 | |[resnext101_64x4d.c1_in1k](https://huggingface.co/timm/resnext101_64x4d.c1_in1k)|288 |83.16|96.38|83.5 |25.7 |51.6 |590 | |[resnet152d.ra2_in1k](https://huggingface.co/timm/resnet152d.ra2_in1k)|256 |83.14|96.38|60.2 |15.4 |30.5 |1096 | |[resnet101d.ra2_in1k](https://huggingface.co/timm/resnet101d.ra2_in1k)|320 |83.02|96.45|44.6 |16.5 |34.8 |992 | |[ecaresnet101d.miil_in1k](https://huggingface.co/timm/ecaresnet101d.miil_in1k)|288 |82.98|96.54|44.6 |13.4 |28.2 |1077 | |[resnext101_64x4d.tv_in1k](https://huggingface.co/timm/resnext101_64x4d.tv_in1k)|224 |82.98|96.25|83.5 |15.5 |31.2 |989 | |[resnetrs152.tf_in1k](https://huggingface.co/timm/resnetrs152.tf_in1k)|256 |82.86|96.28|86.6 |15.6 |30.8 |951 | |[resnext101_32x8d.tv2_in1k](https://huggingface.co/timm/resnext101_32x8d.tv2_in1k)|224 |82.83|96.22|88.8 |16.5 |31.2 |1099 | |[resnet152.a1h_in1k](https://huggingface.co/timm/resnet152.a1h_in1k)|224 |82.8 |96.13|60.2 |11.6 |22.6 |1486 | |[resnet101.a1h_in1k](https://huggingface.co/timm/resnet101.a1h_in1k)|288 |82.8 |96.32|44.6 |13.0 |26.8 |1291 | |[resnet152.a1_in1k](https://huggingface.co/timm/resnet152.a1_in1k)|288 |82.74|95.71|60.2 |19.1 |37.3 |905 | |[resnext101_32x8d.fb_wsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext101_32x8d.fb_wsl_ig1b_ft_in1k)|224 |82.69|96.63|88.8 |16.5 |31.2 |1100 | |[resnet152.a2_in1k](https://huggingface.co/timm/resnet152.a2_in1k)|288 |82.62|95.75|60.2 |19.1 |37.3 |904 | |[resnetaa50d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa50d.sw_in12k_ft_in1k)|288 |82.61|96.49|25.6 |8.9 |20.6 |1729 | |[resnet61q.ra2_in1k](https://huggingface.co/timm/resnet61q.ra2_in1k)|288 |82.53|96.13|36.8 |9.9 |21.5 |1773 | |[wide_resnet101_2.tv2_in1k](https://huggingface.co/timm/wide_resnet101_2.tv2_in1k)|224 |82.5 |96.02|126.9 |22.8 |21.2 |1078 | |[resnext101_64x4d.c1_in1k](https://huggingface.co/timm/resnext101_64x4d.c1_in1k)|224 |82.46|95.92|83.5 |15.5 |31.2 |987 | |[resnet51q.ra2_in1k](https://huggingface.co/timm/resnet51q.ra2_in1k)|288 |82.36|96.18|35.7 |8.1 |20.9 |1964 | |[ecaresnet50t.ra2_in1k](https://huggingface.co/timm/ecaresnet50t.ra2_in1k)|320 |82.35|96.14|25.6 |8.8 |24.1 |1386 | |[resnet101.a1_in1k](https://huggingface.co/timm/resnet101.a1_in1k)|288 |82.31|95.63|44.6 |13.0 |26.8 |1291 | |[resnetrs101.tf_in1k](https://huggingface.co/timm/resnetrs101.tf_in1k)|288 |82.29|96.01|63.6 |13.6 |28.5 |1078 | |[resnet152.tv2_in1k](https://huggingface.co/timm/resnet152.tv2_in1k)|224 |82.29|96.0 |60.2 |11.6 |22.6 |1484 | |[wide_resnet50_2.racm_in1k](https://huggingface.co/timm/wide_resnet50_2.racm_in1k)|288 |82.27|96.06|68.9 |18.9 |23.8 |1176 | |[resnet101d.ra2_in1k](https://huggingface.co/timm/resnet101d.ra2_in1k)|256 |82.26|96.07|44.6 |10.6 |22.2 |1542 | |[resnet101.a2_in1k](https://huggingface.co/timm/resnet101.a2_in1k)|288 |82.24|95.73|44.6 |13.0 |26.8 |1290 | |[seresnext50_32x4d.racm_in1k](https://huggingface.co/timm/seresnext50_32x4d.racm_in1k)|288 |82.2 |96.14|27.6 |7.0 |23.8 |1547 | |[ecaresnet101d.miil_in1k](https://huggingface.co/timm/ecaresnet101d.miil_in1k)|224 |82.18|96.05|44.6 |8.1 |17.1 |1771 | |[resnext50_32x4d.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnext50_32x4d.fb_swsl_ig1b_ft_in1k)|224 |82.17|96.22|25.0 |4.3 |14.4 |2943 | |[ecaresnet50t.a1_in1k](https://huggingface.co/timm/ecaresnet50t.a1_in1k)|288 |82.12|95.65|25.6 |7.1 |19.6 |1704 | |[resnext50_32x4d.a1h_in1k](https://huggingface.co/timm/resnext50_32x4d.a1h_in1k)|288 |82.03|95.94|25.0 |7.0 |23.8 |1745 | |[ecaresnet101d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet101d_pruned.miil_in1k)|288 |82.0 |96.15|24.9 |5.8 |12.7 |1787 | |[resnet61q.ra2_in1k](https://huggingface.co/timm/resnet61q.ra2_in1k)|256 |81.99|95.85|36.8 |7.8 |17.0 |2230 | |[resnext101_32x8d.tv2_in1k](https://huggingface.co/timm/resnext101_32x8d.tv2_in1k)|176 |81.98|95.72|88.8 |10.3 |19.4 |1768 | |[resnet152.a1_in1k](https://huggingface.co/timm/resnet152.a1_in1k)|224 |81.97|95.24|60.2 |11.6 |22.6 |1486 | |[resnet101.a1h_in1k](https://huggingface.co/timm/resnet101.a1h_in1k)|224 |81.93|95.75|44.6 |7.8 |16.2 |2122 | |[resnet101.tv2_in1k](https://huggingface.co/timm/resnet101.tv2_in1k)|224 |81.9 |95.77|44.6 |7.8 |16.2 |2118 | |[resnext101_32x16d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext101_32x16d.fb_ssl_yfcc100m_ft_in1k)|224 |81.84|96.1 |194.0 |36.3 |51.2 |583 | |[resnet51q.ra2_in1k](https://huggingface.co/timm/resnet51q.ra2_in1k)|256 |81.78|95.94|35.7 |6.4 |16.6 |2471 | |[resnet152.a2_in1k](https://huggingface.co/timm/resnet152.a2_in1k)|224 |81.77|95.22|60.2 |11.6 |22.6 |1485 | |[resnetaa50d.sw_in12k_ft_in1k](https://huggingface.co/timm/resnetaa50d.sw_in12k_ft_in1k)|224 |81.74|96.06|25.6 |5.4 |12.4 |2813 | |[ecaresnet50t.a2_in1k](https://huggingface.co/timm/ecaresnet50t.a2_in1k)|288 |81.65|95.54|25.6 |7.1 |19.6 |1703 | |[ecaresnet50d.miil_in1k](https://huggingface.co/timm/ecaresnet50d.miil_in1k)|288 |81.64|95.88|25.6 |7.2 |19.7 |1694 | |[resnext101_32x8d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext101_32x8d.fb_ssl_yfcc100m_ft_in1k)|224 |81.62|96.04|88.8 |16.5 |31.2 |1101 | |[wide_resnet50_2.tv2_in1k](https://huggingface.co/timm/wide_resnet50_2.tv2_in1k)|224 |81.61|95.76|68.9 |11.4 |14.4 |1930 | |[resnetaa50.a1h_in1k](https://huggingface.co/timm/resnetaa50.a1h_in1k)|288 |81.61|95.83|25.6 |8.5 |19.2 |1868 | |[resnet101.a1_in1k](https://huggingface.co/timm/resnet101.a1_in1k)|224 |81.5 |95.16|44.6 |7.8 |16.2 |2125 | |[resnext50_32x4d.a1_in1k](https://huggingface.co/timm/resnext50_32x4d.a1_in1k)|288 |81.48|95.16|25.0 |7.0 |23.8 |1745 | |[gcresnet50t.ra2_in1k](https://huggingface.co/timm/gcresnet50t.ra2_in1k)|288 |81.47|95.71|25.9 |6.9 |18.6 |2071 | |[wide_resnet50_2.racm_in1k](https://huggingface.co/timm/wide_resnet50_2.racm_in1k)|224 |81.45|95.53|68.9 |11.4 |14.4 |1929 | |[resnet50d.a1_in1k](https://huggingface.co/timm/resnet50d.a1_in1k)|288 |81.44|95.22|25.6 |7.2 |19.7 |1908 | |[ecaresnet50t.ra2_in1k](https://huggingface.co/timm/ecaresnet50t.ra2_in1k)|256 |81.44|95.67|25.6 |5.6 |15.4 |2168 | |[ecaresnetlight.miil_in1k](https://huggingface.co/timm/ecaresnetlight.miil_in1k)|288 |81.4 |95.82|30.2 |6.8 |13.9 |2132 | |[resnet50d.ra2_in1k](https://huggingface.co/timm/resnet50d.ra2_in1k)|288 |81.37|95.74|25.6 |7.2 |19.7 |1910 | |[resnet101.a2_in1k](https://huggingface.co/timm/resnet101.a2_in1k)|224 |81.32|95.19|44.6 |7.8 |16.2 |2125 | |[seresnet50.ra2_in1k](https://huggingface.co/timm/seresnet50.ra2_in1k)|288 |81.3 |95.65|28.1 |6.8 |18.4 |1803 | |[resnext50_32x4d.a2_in1k](https://huggingface.co/timm/resnext50_32x4d.a2_in1k)|288 |81.3 |95.11|25.0 |7.0 |23.8 |1746 | |[seresnext50_32x4d.racm_in1k](https://huggingface.co/timm/seresnext50_32x4d.racm_in1k)|224 |81.27|95.62|27.6 |4.3 |14.4 |2591 | |[ecaresnet50t.a1_in1k](https://huggingface.co/timm/ecaresnet50t.a1_in1k)|224 |81.26|95.16|25.6 |4.3 |11.8 |2823 | |[gcresnext50ts.ch_in1k](https://huggingface.co/timm/gcresnext50ts.ch_in1k)|288 |81.23|95.54|15.7 |4.8 |19.6 |2117 | |[senet154.gluon_in1k](https://huggingface.co/timm/senet154.gluon_in1k)|224 |81.23|95.35|115.1 |20.8 |38.7 |545 | |[resnet50.a1_in1k](https://huggingface.co/timm/resnet50.a1_in1k)|288 |81.22|95.11|25.6 |6.8 |18.4 |2089 | |[resnet50_gn.a1h_in1k](https://huggingface.co/timm/resnet50_gn.a1h_in1k)|288 |81.22|95.63|25.6 |6.8 |18.4 |676 | |[resnet50d.a2_in1k](https://huggingface.co/timm/resnet50d.a2_in1k)|288 |81.18|95.09|25.6 |7.2 |19.7 |1908 | |[resnet50.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnet50.fb_swsl_ig1b_ft_in1k)|224 |81.18|95.98|25.6 |4.1 |11.1 |3455 | |[resnext50_32x4d.tv2_in1k](https://huggingface.co/timm/resnext50_32x4d.tv2_in1k)|224 |81.17|95.34|25.0 |4.3 |14.4 |2933 | |[resnext50_32x4d.a1h_in1k](https://huggingface.co/timm/resnext50_32x4d.a1h_in1k)|224 |81.1 |95.33|25.0 |4.3 |14.4 |2934 | |[seresnet50.a2_in1k](https://huggingface.co/timm/seresnet50.a2_in1k)|288 |81.1 |95.23|28.1 |6.8 |18.4 |1801 | |[seresnet50.a1_in1k](https://huggingface.co/timm/seresnet50.a1_in1k)|288 |81.1 |95.12|28.1 |6.8 |18.4 |1799 | |[resnet152s.gluon_in1k](https://huggingface.co/timm/resnet152s.gluon_in1k)|224 |81.02|95.41|60.3 |12.9 |25.0 |1347 | |[resnet50.d_in1k](https://huggingface.co/timm/resnet50.d_in1k)|288 |80.97|95.44|25.6 |6.8 |18.4 |2085 | |[gcresnet50t.ra2_in1k](https://huggingface.co/timm/gcresnet50t.ra2_in1k)|256 |80.94|95.45|25.9 |5.4 |14.7 |2571 | |[resnext101_32x4d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext101_32x4d.fb_ssl_yfcc100m_ft_in1k)|224 |80.93|95.73|44.2 |8.0 |21.2 |1814 | |[resnet50.c1_in1k](https://huggingface.co/timm/resnet50.c1_in1k)|288 |80.91|95.55|25.6 |6.8 |18.4 |2084 | |[seresnext101_32x4d.gluon_in1k](https://huggingface.co/timm/seresnext101_32x4d.gluon_in1k)|224 |80.9 |95.31|49.0 |8.0 |21.3 |1585 | |[seresnext101_64x4d.gluon_in1k](https://huggingface.co/timm/seresnext101_64x4d.gluon_in1k)|224 |80.9 |95.3 |88.2 |15.5 |31.2 |918 | |[resnet50.c2_in1k](https://huggingface.co/timm/resnet50.c2_in1k)|288 |80.86|95.52|25.6 |6.8 |18.4 |2085 | |[resnet50.tv2_in1k](https://huggingface.co/timm/resnet50.tv2_in1k)|224 |80.85|95.43|25.6 |4.1 |11.1 |3450 | |[ecaresnet50t.a2_in1k](https://huggingface.co/timm/ecaresnet50t.a2_in1k)|224 |80.84|95.02|25.6 |4.3 |11.8 |2821 | |[ecaresnet101d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet101d_pruned.miil_in1k)|224 |80.79|95.62|24.9 |3.5 |7.7 |2961 | |[seresnet33ts.ra2_in1k](https://huggingface.co/timm/seresnet33ts.ra2_in1k)|288 |80.79|95.36|19.8 |6.0 |14.8 |2506 | |[ecaresnet50d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet50d_pruned.miil_in1k)|288 |80.79|95.58|19.9 |4.2 |10.6 |2349 | |[resnet50.a2_in1k](https://huggingface.co/timm/resnet50.a2_in1k)|288 |80.78|94.99|25.6 |6.8 |18.4 |2088 | |[resnet50.b1k_in1k](https://huggingface.co/timm/resnet50.b1k_in1k)|288 |80.71|95.43|25.6 |6.8 |18.4 |2087 | |[resnext50_32x4d.ra_in1k](https://huggingface.co/timm/resnext50_32x4d.ra_in1k)|288 |80.7 |95.39|25.0 |7.0 |23.8 |1749 | |[resnetrs101.tf_in1k](https://huggingface.co/timm/resnetrs101.tf_in1k)|192 |80.69|95.24|63.6 |6.0 |12.7 |2270 | |[resnet50d.a1_in1k](https://huggingface.co/timm/resnet50d.a1_in1k)|224 |80.68|94.71|25.6 |4.4 |11.9 |3162 | |[eca_resnet33ts.ra2_in1k](https://huggingface.co/timm/eca_resnet33ts.ra2_in1k)|288 |80.68|95.36|19.7 |6.0 |14.8 |2637 | |[resnet50.a1h_in1k](https://huggingface.co/timm/resnet50.a1h_in1k)|224 |80.67|95.3 |25.6 |4.1 |11.1 |3452 | |[resnext50d_32x4d.bt_in1k](https://huggingface.co/timm/resnext50d_32x4d.bt_in1k)|288 |80.67|95.42|25.0 |7.4 |25.1 |1626 | |[resnetaa50.a1h_in1k](https://huggingface.co/timm/resnetaa50.a1h_in1k)|224 |80.63|95.21|25.6 |5.2 |11.6 |3034 | |[ecaresnet50d.miil_in1k](https://huggingface.co/timm/ecaresnet50d.miil_in1k)|224 |80.61|95.32|25.6 |4.4 |11.9 |2813 | |[resnext101_64x4d.gluon_in1k](https://huggingface.co/timm/resnext101_64x4d.gluon_in1k)|224 |80.61|94.99|83.5 |15.5 |31.2 |989 | |[gcresnet33ts.ra2_in1k](https://huggingface.co/timm/gcresnet33ts.ra2_in1k)|288 |80.6 |95.31|19.9 |6.0 |14.8 |2578 | |[gcresnext50ts.ch_in1k](https://huggingface.co/timm/gcresnext50ts.ch_in1k)|256 |80.57|95.17|15.7 |3.8 |15.5 |2710 | |[resnet152.a3_in1k](https://huggingface.co/timm/resnet152.a3_in1k)|224 |80.56|95.0 |60.2 |11.6 |22.6 |1483 | |[resnet50d.ra2_in1k](https://huggingface.co/timm/resnet50d.ra2_in1k)|224 |80.53|95.16|25.6 |4.4 |11.9 |3164 | |[resnext50_32x4d.a1_in1k](https://huggingface.co/timm/resnext50_32x4d.a1_in1k)|224 |80.53|94.46|25.0 |4.3 |14.4 |2930 | |[wide_resnet101_2.tv2_in1k](https://huggingface.co/timm/wide_resnet101_2.tv2_in1k)|176 |80.48|94.98|126.9 |14.3 |13.2 |1719 | |[resnet152d.gluon_in1k](https://huggingface.co/timm/resnet152d.gluon_in1k)|224 |80.47|95.2 |60.2 |11.8 |23.4 |1428 | |[resnet50.b2k_in1k](https://huggingface.co/timm/resnet50.b2k_in1k)|288 |80.45|95.32|25.6 |6.8 |18.4 |2086 | |[ecaresnetlight.miil_in1k](https://huggingface.co/timm/ecaresnetlight.miil_in1k)|224 |80.45|95.24|30.2 |4.1 |8.4 |3530 | |[resnext50_32x4d.a2_in1k](https://huggingface.co/timm/resnext50_32x4d.a2_in1k)|224 |80.45|94.63|25.0 |4.3 |14.4 |2936 | |[wide_resnet50_2.tv2_in1k](https://huggingface.co/timm/wide_resnet50_2.tv2_in1k)|176 |80.43|95.09|68.9 |7.3 |9.0 |3015 | |[resnet101d.gluon_in1k](https://huggingface.co/timm/resnet101d.gluon_in1k)|224 |80.42|95.01|44.6 |8.1 |17.0 |2007 | |[resnet50.a1_in1k](https://huggingface.co/timm/resnet50.a1_in1k)|224 |80.38|94.6 |25.6 |4.1 |11.1 |3461 | |[seresnet33ts.ra2_in1k](https://huggingface.co/timm/seresnet33ts.ra2_in1k)|256 |80.36|95.1 |19.8 |4.8 |11.7 |3267 | |[resnext101_32x4d.gluon_in1k](https://huggingface.co/timm/resnext101_32x4d.gluon_in1k)|224 |80.34|94.93|44.2 |8.0 |21.2 |1814 | |[resnext50_32x4d.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnext50_32x4d.fb_ssl_yfcc100m_ft_in1k)|224 |80.32|95.4 |25.0 |4.3 |14.4 |2941 | |[resnet101s.gluon_in1k](https://huggingface.co/timm/resnet101s.gluon_in1k)|224 |80.28|95.16|44.7 |9.2 |18.6 |1851 | |[seresnet50.ra2_in1k](https://huggingface.co/timm/seresnet50.ra2_in1k)|224 |80.26|95.08|28.1 |4.1 |11.1 |2972 | |[resnetblur50.bt_in1k](https://huggingface.co/timm/resnetblur50.bt_in1k)|288 |80.24|95.24|25.6 |8.5 |19.9 |1523 | |[resnet50d.a2_in1k](https://huggingface.co/timm/resnet50d.a2_in1k)|224 |80.22|94.63|25.6 |4.4 |11.9 |3162 | |[resnet152.tv2_in1k](https://huggingface.co/timm/resnet152.tv2_in1k)|176 |80.2 |94.64|60.2 |7.2 |14.0 |2346 | |[seresnet50.a2_in1k](https://huggingface.co/timm/seresnet50.a2_in1k)|224 |80.08|94.74|28.1 |4.1 |11.1 |2969 | |[eca_resnet33ts.ra2_in1k](https://huggingface.co/timm/eca_resnet33ts.ra2_in1k)|256 |80.08|94.97|19.7 |4.8 |11.7 |3284 | |[gcresnet33ts.ra2_in1k](https://huggingface.co/timm/gcresnet33ts.ra2_in1k)|256 |80.06|94.99|19.9 |4.8 |11.7 |3216 | |[resnet50_gn.a1h_in1k](https://huggingface.co/timm/resnet50_gn.a1h_in1k)|224 |80.06|94.95|25.6 |4.1 |11.1 |1109 | |[seresnet50.a1_in1k](https://huggingface.co/timm/seresnet50.a1_in1k)|224 |80.02|94.71|28.1 |4.1 |11.1 |2962 | |[resnet50.ram_in1k](https://huggingface.co/timm/resnet50.ram_in1k)|288 |79.97|95.05|25.6 |6.8 |18.4 |2086 | |[resnet152c.gluon_in1k](https://huggingface.co/timm/resnet152c.gluon_in1k)|224 |79.92|94.84|60.2 |11.8 |23.4 |1455 | |[seresnext50_32x4d.gluon_in1k](https://huggingface.co/timm/seresnext50_32x4d.gluon_in1k)|224 |79.91|94.82|27.6 |4.3 |14.4 |2591 | |[resnet50.d_in1k](https://huggingface.co/timm/resnet50.d_in1k)|224 |79.91|94.67|25.6 |4.1 |11.1 |3456 | |[resnet101.tv2_in1k](https://huggingface.co/timm/resnet101.tv2_in1k)|176 |79.9 |94.6 |44.6 |4.9 |10.1 |3341 | |[resnetrs50.tf_in1k](https://huggingface.co/timm/resnetrs50.tf_in1k)|224 |79.89|94.97|35.7 |4.5 |12.1 |2774 | |[resnet50.c2_in1k](https://huggingface.co/timm/resnet50.c2_in1k)|224 |79.88|94.87|25.6 |4.1 |11.1 |3455 | |[ecaresnet26t.ra2_in1k](https://huggingface.co/timm/ecaresnet26t.ra2_in1k)|320 |79.86|95.07|16.0 |5.2 |16.4 |2168 | |[resnet50.a2_in1k](https://huggingface.co/timm/resnet50.a2_in1k)|224 |79.85|94.56|25.6 |4.1 |11.1 |3460 | |[resnet50.ra_in1k](https://huggingface.co/timm/resnet50.ra_in1k)|288 |79.83|94.97|25.6 |6.8 |18.4 |2087 | |[resnet101.a3_in1k](https://huggingface.co/timm/resnet101.a3_in1k)|224 |79.82|94.62|44.6 |7.8 |16.2 |2114 | |[resnext50_32x4d.ra_in1k](https://huggingface.co/timm/resnext50_32x4d.ra_in1k)|224 |79.76|94.6 |25.0 |4.3 |14.4 |2943 | |[resnet50.c1_in1k](https://huggingface.co/timm/resnet50.c1_in1k)|224 |79.74|94.95|25.6 |4.1 |11.1 |3455 | |[ecaresnet50d_pruned.miil_in1k](https://huggingface.co/timm/ecaresnet50d_pruned.miil_in1k)|224 |79.74|94.87|19.9 |2.5 |6.4 |3929 | |[resnet33ts.ra2_in1k](https://huggingface.co/timm/resnet33ts.ra2_in1k)|288 |79.71|94.83|19.7 |6.0 |14.8 |2710 | |[resnet152.gluon_in1k](https://huggingface.co/timm/resnet152.gluon_in1k)|224 |79.68|94.74|60.2 |11.6 |22.6 |1486 | |[resnext50d_32x4d.bt_in1k](https://huggingface.co/timm/resnext50d_32x4d.bt_in1k)|224 |79.67|94.87|25.0 |4.5 |15.2 |2729 | |[resnet50.bt_in1k](https://huggingface.co/timm/resnet50.bt_in1k)|288 |79.63|94.91|25.6 |6.8 |18.4 |2086 | |[ecaresnet50t.a3_in1k](https://huggingface.co/timm/ecaresnet50t.a3_in1k)|224 |79.56|94.72|25.6 |4.3 |11.8 |2805 | |[resnet101c.gluon_in1k](https://huggingface.co/timm/resnet101c.gluon_in1k)|224 |79.53|94.58|44.6 |8.1 |17.0 |2062 | |[resnet50.b1k_in1k](https://huggingface.co/timm/resnet50.b1k_in1k)|224 |79.52|94.61|25.6 |4.1 |11.1 |3459 | |[resnet50.tv2_in1k](https://huggingface.co/timm/resnet50.tv2_in1k)|176 |79.42|94.64|25.6 |2.6 |6.9 |5397 | |[resnet32ts.ra2_in1k](https://huggingface.co/timm/resnet32ts.ra2_in1k)|288 |79.4 |94.66|18.0 |5.9 |14.6 |2752 | |[resnet50.b2k_in1k](https://huggingface.co/timm/resnet50.b2k_in1k)|224 |79.38|94.57|25.6 |4.1 |11.1 |3459 | |[resnext50_32x4d.tv2_in1k](https://huggingface.co/timm/resnext50_32x4d.tv2_in1k)|176 |79.37|94.3 |25.0 |2.7 |9.0 |4577 | |[resnext50_32x4d.gluon_in1k](https://huggingface.co/timm/resnext50_32x4d.gluon_in1k)|224 |79.36|94.43|25.0 |4.3 |14.4 |2942 | |[resnext101_32x8d.tv_in1k](https://huggingface.co/timm/resnext101_32x8d.tv_in1k)|224 |79.31|94.52|88.8 |16.5 |31.2 |1100 | |[resnet101.gluon_in1k](https://huggingface.co/timm/resnet101.gluon_in1k)|224 |79.31|94.53|44.6 |7.8 |16.2 |2125 | |[resnetblur50.bt_in1k](https://huggingface.co/timm/resnetblur50.bt_in1k)|224 |79.31|94.63|25.6 |5.2 |12.0 |2524 | |[resnet50.a1h_in1k](https://huggingface.co/timm/resnet50.a1h_in1k)|176 |79.27|94.49|25.6 |2.6 |6.9 |5404 | |[resnext50_32x4d.a3_in1k](https://huggingface.co/timm/resnext50_32x4d.a3_in1k)|224 |79.25|94.31|25.0 |4.3 |14.4 |2931 | |[resnet50.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnet50.fb_ssl_yfcc100m_ft_in1k)|224 |79.22|94.84|25.6 |4.1 |11.1 |3451 | |[resnet33ts.ra2_in1k](https://huggingface.co/timm/resnet33ts.ra2_in1k)|256 |79.21|94.56|19.7 |4.8 |11.7 |3392 | |[resnet50d.gluon_in1k](https://huggingface.co/timm/resnet50d.gluon_in1k)|224 |79.07|94.48|25.6 |4.4 |11.9 |3162 | |[resnet50.ram_in1k](https://huggingface.co/timm/resnet50.ram_in1k)|224 |79.03|94.38|25.6 |4.1 |11.1 |3453 | |[resnet50.am_in1k](https://huggingface.co/timm/resnet50.am_in1k)|224 |79.01|94.39|25.6 |4.1 |11.1 |3461 | |[resnet32ts.ra2_in1k](https://huggingface.co/timm/resnet32ts.ra2_in1k)|256 |79.01|94.37|18.0 |4.6 |11.6 |3440 | |[ecaresnet26t.ra2_in1k](https://huggingface.co/timm/ecaresnet26t.ra2_in1k)|256 |78.9 |94.54|16.0 |3.4 |10.5 |3421 | |[resnet152.a3_in1k](https://huggingface.co/timm/resnet152.a3_in1k)|160 |78.89|94.11|60.2 |5.9 |11.5 |2745 | |[wide_resnet101_2.tv_in1k](https://huggingface.co/timm/wide_resnet101_2.tv_in1k)|224 |78.84|94.28|126.9 |22.8 |21.2 |1079 | |[seresnext26d_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26d_32x4d.bt_in1k)|288 |78.83|94.24|16.8 |4.5 |16.8 |2251 | |[resnet50.ra_in1k](https://huggingface.co/timm/resnet50.ra_in1k)|224 |78.81|94.32|25.6 |4.1 |11.1 |3454 | |[seresnext26t_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26t_32x4d.bt_in1k)|288 |78.74|94.33|16.8 |4.5 |16.7 |2264 | |[resnet50s.gluon_in1k](https://huggingface.co/timm/resnet50s.gluon_in1k)|224 |78.72|94.23|25.7 |5.5 |13.5 |2796 | |[resnet50d.a3_in1k](https://huggingface.co/timm/resnet50d.a3_in1k)|224 |78.71|94.24|25.6 |4.4 |11.9 |3154 | |[wide_resnet50_2.tv_in1k](https://huggingface.co/timm/wide_resnet50_2.tv_in1k)|224 |78.47|94.09|68.9 |11.4 |14.4 |1934 | |[resnet50.bt_in1k](https://huggingface.co/timm/resnet50.bt_in1k)|224 |78.46|94.27|25.6 |4.1 |11.1 |3454 | |[resnet34d.ra2_in1k](https://huggingface.co/timm/resnet34d.ra2_in1k)|288 |78.43|94.35|21.8 |6.5 |7.5 |3291 | |[gcresnext26ts.ch_in1k](https://huggingface.co/timm/gcresnext26ts.ch_in1k)|288 |78.42|94.04|10.5 |3.1 |13.3 |3226 | |[resnet26t.ra2_in1k](https://huggingface.co/timm/resnet26t.ra2_in1k)|320 |78.33|94.13|16.0 |5.2 |16.4 |2391 | |[resnet152.tv_in1k](https://huggingface.co/timm/resnet152.tv_in1k)|224 |78.32|94.04|60.2 |11.6 |22.6 |1487 | |[seresnext26ts.ch_in1k](https://huggingface.co/timm/seresnext26ts.ch_in1k)|288 |78.28|94.1 |10.4 |3.1 |13.3 |3062 | |[bat_resnext26ts.ch_in1k](https://huggingface.co/timm/bat_resnext26ts.ch_in1k)|256 |78.25|94.1 |10.7 |2.5 |12.5 |3393 | |[resnet50.a3_in1k](https://huggingface.co/timm/resnet50.a3_in1k)|224 |78.06|93.78|25.6 |4.1 |11.1 |3450 | |[resnet50c.gluon_in1k](https://huggingface.co/timm/resnet50c.gluon_in1k)|224 |78.0 |93.99|25.6 |4.4 |11.9 |3286 | |[eca_resnext26ts.ch_in1k](https://huggingface.co/timm/eca_resnext26ts.ch_in1k)|288 |78.0 |93.91|10.3 |3.1 |13.3 |3297 | |[seresnext26t_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26t_32x4d.bt_in1k)|224 |77.98|93.75|16.8 |2.7 |10.1 |3841 | |[resnet34.a1_in1k](https://huggingface.co/timm/resnet34.a1_in1k)|288 |77.92|93.77|21.8 |6.1 |6.2 |3609 | |[resnet101.a3_in1k](https://huggingface.co/timm/resnet101.a3_in1k)|160 |77.88|93.71|44.6 |4.0 |8.3 |3926 | |[resnet26t.ra2_in1k](https://huggingface.co/timm/resnet26t.ra2_in1k)|256 |77.87|93.84|16.0 |3.4 |10.5 |3772 | |[seresnext26ts.ch_in1k](https://huggingface.co/timm/seresnext26ts.ch_in1k)|256 |77.86|93.79|10.4 |2.4 |10.5 |4263 | |[resnetrs50.tf_in1k](https://huggingface.co/timm/resnetrs50.tf_in1k)|160 |77.82|93.81|35.7 |2.3 |6.2 |5238 | |[gcresnext26ts.ch_in1k](https://huggingface.co/timm/gcresnext26ts.ch_in1k)|256 |77.81|93.82|10.5 |2.4 |10.5 |4183 | |[ecaresnet50t.a3_in1k](https://huggingface.co/timm/ecaresnet50t.a3_in1k)|160 |77.79|93.6 |25.6 |2.2 |6.0 |5329 | |[resnext50_32x4d.a3_in1k](https://huggingface.co/timm/resnext50_32x4d.a3_in1k)|160 |77.73|93.32|25.0 |2.2 |7.4 |5576 | |[resnext50_32x4d.tv_in1k](https://huggingface.co/timm/resnext50_32x4d.tv_in1k)|224 |77.61|93.7 |25.0 |4.3 |14.4 |2944 | |[seresnext26d_32x4d.bt_in1k](https://huggingface.co/timm/seresnext26d_32x4d.bt_in1k)|224 |77.59|93.61|16.8 |2.7 |10.2 |3807 | |[resnet50.gluon_in1k](https://huggingface.co/timm/resnet50.gluon_in1k)|224 |77.58|93.72|25.6 |4.1 |11.1 |3455 | |[eca_resnext26ts.ch_in1k](https://huggingface.co/timm/eca_resnext26ts.ch_in1k)|256 |77.44|93.56|10.3 |2.4 |10.5 |4284 | |[resnet26d.bt_in1k](https://huggingface.co/timm/resnet26d.bt_in1k)|288 |77.41|93.63|16.0 |4.3 |13.5 |2907 | |[resnet101.tv_in1k](https://huggingface.co/timm/resnet101.tv_in1k)|224 |77.38|93.54|44.6 |7.8 |16.2 |2125 | |[resnet50d.a3_in1k](https://huggingface.co/timm/resnet50d.a3_in1k)|160 |77.22|93.27|25.6 |2.2 |6.1 |5982 | |[resnext26ts.ra2_in1k](https://huggingface.co/timm/resnext26ts.ra2_in1k)|288 |77.17|93.47|10.3 |3.1 |13.3 |3392 | |[resnet34.a2_in1k](https://huggingface.co/timm/resnet34.a2_in1k)|288 |77.15|93.27|21.8 |6.1 |6.2 |3615 | |[resnet34d.ra2_in1k](https://huggingface.co/timm/resnet34d.ra2_in1k)|224 |77.1 |93.37|21.8 |3.9 |4.5 |5436 | |[seresnet50.a3_in1k](https://huggingface.co/timm/seresnet50.a3_in1k)|224 |77.02|93.07|28.1 |4.1 |11.1 |2952 | |[resnext26ts.ra2_in1k](https://huggingface.co/timm/resnext26ts.ra2_in1k)|256 |76.78|93.13|10.3 |2.4 |10.5 |4410 | |[resnet26d.bt_in1k](https://huggingface.co/timm/resnet26d.bt_in1k)|224 |76.7 |93.17|16.0 |2.6 |8.2 |4859 | |[resnet34.bt_in1k](https://huggingface.co/timm/resnet34.bt_in1k)|288 |76.5 |93.35|21.8 |6.1 |6.2 |3617 | |[resnet34.a1_in1k](https://huggingface.co/timm/resnet34.a1_in1k)|224 |76.42|92.87|21.8 |3.7 |3.7 |5984 | |[resnet26.bt_in1k](https://huggingface.co/timm/resnet26.bt_in1k)|288 |76.35|93.18|16.0 |3.9 |12.2 |3331 | |[resnet50.tv_in1k](https://huggingface.co/timm/resnet50.tv_in1k)|224 |76.13|92.86|25.6 |4.1 |11.1 |3457 | |[resnet50.a3_in1k](https://huggingface.co/timm/resnet50.a3_in1k)|160 |75.96|92.5 |25.6 |2.1 |5.7 |6490 | |[resnet34.a2_in1k](https://huggingface.co/timm/resnet34.a2_in1k)|224 |75.52|92.44|21.8 |3.7 |3.7 |5991 | |[resnet26.bt_in1k](https://huggingface.co/timm/resnet26.bt_in1k)|224 |75.3 |92.58|16.0 |2.4 |7.4 |5583 | |[resnet34.bt_in1k](https://huggingface.co/timm/resnet34.bt_in1k)|224 |75.16|92.18|21.8 |3.7 |3.7 |5994 | |[seresnet50.a3_in1k](https://huggingface.co/timm/seresnet50.a3_in1k)|160 |75.1 |92.08|28.1 |2.1 |5.7 |5513 | |[resnet34.gluon_in1k](https://huggingface.co/timm/resnet34.gluon_in1k)|224 |74.57|91.98|21.8 |3.7 |3.7 |5984 | |[resnet18d.ra2_in1k](https://huggingface.co/timm/resnet18d.ra2_in1k)|288 |73.81|91.83|11.7 |3.4 |5.4 |5196 | |[resnet34.tv_in1k](https://huggingface.co/timm/resnet34.tv_in1k)|224 |73.32|91.42|21.8 |3.7 |3.7 |5979 | |[resnet18.fb_swsl_ig1b_ft_in1k](https://huggingface.co/timm/resnet18.fb_swsl_ig1b_ft_in1k)|224 |73.28|91.73|11.7 |1.8 |2.5 |10213 | |[resnet18.a1_in1k](https://huggingface.co/timm/resnet18.a1_in1k)|288 |73.16|91.03|11.7 |3.0 |4.1 |6050 | |[resnet34.a3_in1k](https://huggingface.co/timm/resnet34.a3_in1k)|224 |72.98|91.11|21.8 |3.7 |3.7 |5967 | |[resnet18.fb_ssl_yfcc100m_ft_in1k](https://huggingface.co/timm/resnet18.fb_ssl_yfcc100m_ft_in1k)|224 |72.6 |91.42|11.7 |1.8 |2.5 |10213 | |[resnet18.a2_in1k](https://huggingface.co/timm/resnet18.a2_in1k)|288 |72.37|90.59|11.7 |3.0 |4.1 |6051 | |[resnet14t.c3_in1k](https://huggingface.co/timm/resnet14t.c3_in1k)|224 |72.26|90.31|10.1 |1.7 |5.8 |7026 | |[resnet18d.ra2_in1k](https://huggingface.co/timm/resnet18d.ra2_in1k)|224 |72.26|90.68|11.7 |2.1 |3.3 |8707 | |[resnet18.a1_in1k](https://huggingface.co/timm/resnet18.a1_in1k)|224 |71.49|90.07|11.7 |1.8 |2.5 |10187 | |[resnet14t.c3_in1k](https://huggingface.co/timm/resnet14t.c3_in1k)|176 |71.31|89.69|10.1 |1.1 |3.6 |10970 | |[resnet18.gluon_in1k](https://huggingface.co/timm/resnet18.gluon_in1k)|224 |70.84|89.76|11.7 |1.8 |2.5 |10210 | |[resnet18.a2_in1k](https://huggingface.co/timm/resnet18.a2_in1k)|224 |70.64|89.47|11.7 |1.8 |2.5 |10194 | |[resnet34.a3_in1k](https://huggingface.co/timm/resnet34.a3_in1k)|160 |70.56|89.52|21.8 |1.9 |1.9 |10737 | |[resnet18.tv_in1k](https://huggingface.co/timm/resnet18.tv_in1k)|224 |69.76|89.07|11.7 |1.8 |2.5 |10205 | |[resnet10t.c3_in1k](https://huggingface.co/timm/resnet10t.c3_in1k)|224 |68.34|88.03|5.4 |1.1 |2.4 |13079 | |[resnet18.a3_in1k](https://huggingface.co/timm/resnet18.a3_in1k)|224 |68.25|88.17|11.7 |1.8 |2.5 |10167 | |[resnet10t.c3_in1k](https://huggingface.co/timm/resnet10t.c3_in1k)|176 |66.71|86.96|5.4 |0.7 |1.5 |20327 | |[resnet18.a3_in1k](https://huggingface.co/timm/resnet18.a3_in1k)|160 |65.66|86.26|11.7 |0.9 |1.3 |18229 | ## Citation ```bibtex @inproceedings{wightman2021resnet, title={ResNet strikes back: An improved training procedure in timm}, author={Wightman, Ross and Touvron, Hugo and Jegou, Herve}, booktitle={NeurIPS 2021 Workshop on ImageNet: Past, Present, and Future} } ``` ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ``` ```bibtex @article{He2015, author = {Kaiming He and Xiangyu Zhang and Shaoqing Ren and Jian Sun}, title = {Deep Residual Learning for Image Recognition}, journal = {arXiv preprint arXiv:1512.03385}, year = {2015} } ```

Qwen/Qwen-Audio-Chat

Qwen

transformers

text-generation

--- language: - zh - en tags: - qwen pipeline_tag: text-generation inference: false --- # Qwen-Audio-Chat <br> <p align="center"> <img src="https://qianwen-res.oss-cn-beijing.aliyuncs.com/Qwen-Audio/audio_logo.jpg" width="400"/> <p> <br> <p align="center"> Qwen-Audio <a href="https://www.modelscope.cn/models/qwen/QWen-Audio/summary">🤖 <a> | <a href="https://huggingface.co/Qwen/Qwen-Audio">🤗</a>&nbsp ｜ Qwen-Audio-Chat <a href="https://www.modelscope.cn/models/qwen/QWen-Audio-Chat/summary">🤖 <a>| <a href="https://huggingface.co/Qwen/Qwen-Audio-Chat">🤗</a>&nbsp | &nbsp&nbsp Demo<a href="https://modelscope.cn/studios/qwen/Qwen-Audio-Chat-Demo/summary"> 🤖</a> | <a href="https://huggingface.co/spaces/Qwen/Qwen-Audio">🤗</a>&nbsp <br> &nbsp&nbsp<a href="https://qwen-audio.github.io/Qwen-Audio/">Homepage</a>&nbsp ｜ &nbsp<a href="http://arxiv.org/abs/2311.07919">Paper</a> </p> <br><br> **Qwen-Audio** (Qwen Large Audio Language Model) is the multimodal version of the large model series, Qwen (abbr. Tongyi Qianwen), proposed by Alibaba Cloud. Qwen-Audio accepts diverse audio (human speech, natural sound, music and song) and text as inputs, outputs text. The contribution of Qwen-Audio include: - **Fundamental audio models**: Qwen-Audio is a fundamental multi-task audio-language model that supports various tasks, languages, and audio types, serving as a universal audio understanding model. Building upon Qwen-Audio, we develop Qwen-Audio-Chat through instruction fine-tuning, enabling multi-turn dialogues and supporting diverse audio-oriented scenarios. - **Multi-task learning framework for all types of audios**: To scale up audio-language pre-training, we address the challenge of variation in textual labels associated with different datasets by proposing a multi-task training framework, enabling knowledge sharing and avoiding one-to-many interference. Our model incorporates more than 30 tasks and extensive experiments show the model achieves strong performance. - **Strong Performance**: Experimental results show that Qwen-Audio achieves impressive performance across diverse benchmark tasks without requiring any task-specific fine-tuning, surpassing its counterparts. Specifically, Qwen-Audio achieves state-of-the-art results on the test set of Aishell1, cochlscene, ClothoAQA, and VocalSound. - **Flexible multi-run chat from audio and text input**: Qwen-Audio supports multiple-audio analysis, sound understading and reasoning, music appreciation, and tool usage for speech editing. **Qwen-Audio** 是阿里云研发的大规模音频语言模型（Large Audio Language Model）。Qwen-Audio 可以以多种音频 (包括说话人语音、自然音、音乐、歌声）和文本作为输入，并以文本作为输出。Qwen-Audio 系列模型的特点包括： - **音频基石模型**：Qwen-Audio是一个性能卓越的通用的音频理解模型，支持各种任务、语言和音频类型。在Qwen-Audio的基础上，我们通过指令微调开发了Qwen-Audio-Chat，支持多轮、多语言、多语言对话。Qwen-Audio和Qwen-Audio-Chat模型均已开源。 - **兼容多种复杂音频的多任务学习框架**：为了避免由于数据收集来源不同以及任务类型不同，带来的音频到文本的一对多的干扰问题，我们提出了一种多任务训练框架，实现相似任务的知识共享，并尽可能减少不同任务之间的干扰。通过提出的框架，Qwen-Audio可以容纳训练超过30多种不同的音频任务； - **出色的性能**：Qwen-Audio在不需要任何任务特定的微调的情况下，在各种基准任务上取得了领先的结果。具体得，Qwen-Audio在Aishell1、cochlscene、ClothoAQA和VocalSound的测试集上都达到了SOTA； - **支持多轮音频和文本对话，支持各种语音场景**：Qwen-Audio-Chat支持声音理解和推理、音乐欣赏、多音频分析、多轮音频-文本交错对话以及外部语音工具的使用(如语音编辑)。 We release Qwen-Audio and Qwen-Audio-Chat, which are pretrained model and Chat model respectively. For more details about Qwen-Audio, please refer to our [Github Repo](https://github.com/QwenLM/Qwen-Audio/tree/main). This repo is the one for Qwen-Audio-Chat. <br> 目前，我们提供了Qwen-Audio和Qwen-Audio-Chat两个模型，分别为预训练模型和Chat模型。如果想了解更多关于信息，请点击[链接](https://github.com/QwenLM/Qwen-Audio/tree/main)查看Github仓库。本仓库为Qwen-Audio-Chat仓库。 ## Requirements * python 3.8 and above * pytorch 1.12 and above, 2.0 and above are recommended * CUDA 11.4 and above are recommended (this is for GPU users) * FFmpeg <br> ## Quickstart Below, we provide simple examples to show how to use Qwen-Audio with 🤗 Transformers. Before running the code, make sure you have setup the environment and installed the required packages. Make sure you meet the above requirements, and then install the dependent libraries. ```bash pip install -r requirements.txt ``` Now you can start with Transformers. For more usage, please refer to [tutorial](https://github.com/QwenLM/Qwen-Audio/blob/main/TUTORIAL.md). #### 🤗 Transformers To use Qwen-Audio for the inference, all you need to do is to input a few lines of codes as demonstrated below. However, **please make sure that you are using the latest code.** ```python from transformers import AutoModelForCausalLM, AutoTokenizer from transformers.generation import GenerationConfig import torch torch.manual_seed(1234) # Note: The default behavior now has injection attack prevention off. tokenizer = AutoTokenizer.from_pretrained("Qwen/Qwen-Audio-Chat", trust_remote_code=True) # use bf16 # model = AutoModelForCausalLM.from_pretrained("Qwen/Qwen-Audio-Chat", device_map="auto", trust_remote_code=True, bf16=True).eval() # use fp16 # model = AutoModelForCausalLM.from_pretrained("Qwen/Qwen-Audio-Chat", device_map="auto", trust_remote_code=True, fp16=True).eval() # use cpu only # model = AutoModelForCausalLM.from_pretrained("Qwen/Qwen-Audio-Chat", device_map="cpu", trust_remote_code=True).eval() # use cuda device model = AutoModelForCausalLM.from_pretrained("Qwen/Qwen-Audio-Chat", device_map="cuda", trust_remote_code=True).eval() # Specify hyperparameters for generation (No need to do this if you are using transformers>4.32.0) # model.generation_config = GenerationConfig.from_pretrained("Qwen/Qwen-Audio-Chat", trust_remote_code=True) # 1st dialogue turn query = tokenizer.from_list_format([ {'audio': 'https://qianwen-res.oss-cn-beijing.aliyuncs.com/Qwen-Audio/1272-128104-0000.flac'}, # Either a local path or an url {'text': 'what does the person say?'}, ]) response, history = model.chat(tokenizer, query=query, history=None) print(response) # The person says: "mister quilter is the apostle of the middle classes and we are glad to welcome his gospel". # 2nd dialogue turn response, history = model.chat(tokenizer, 'Find the start time and end time of the word "middle classes"', history=history) print(response) # The word "middle classes" starts at <|2.33|> seconds and ends at <|3.26|> seconds. ``` ## License Agreement Researchers and developers are free to use the codes and model weights of Qwen-Audio-Chat. We also allow its commercial use. Check our license at [LICENSE](https://github.com/QwenLM/Qwen-Audio/blob/main/LICENSE.txt) for more details. <br> ## Citation If you find our paper and code useful in your research, please consider giving a star and citation ```BibTeX @article{Qwen-Audio, title={Qwen-Audio: Advancing Universal Audio Understanding via Unified Large-Scale Audio-Language Models}, author={Chu, Yunfei and Xu, Jin and Zhou, Xiaohuan and Yang, Qian and Zhang, Shiliang and Yan, Zhijie and Zhou, Chang and Zhou, Jingren}, journal={arXiv preprint arXiv:2311.07919}, year={2023} } ``` <br> ## Contact Us If you are interested to leave a message to either our research team or product team, feel free to send an email to qianwen_opensource@alibabacloud.com.

Ericwang/tiny-random-ast

Ericwang

transformers

feature-extraction

One custom ast model for testing of HF repos

Qwen/Qwen2-1.5B-Instruct

Qwen

transformers

text-generation

--- license: apache-2.0 language: - en pipeline_tag: text-generation tags: - chat --- # Qwen2-1.5B-Instruct ## Introduction Qwen2 is the new series of Qwen large language models. For Qwen2, we release a number of base language models and instruction-tuned language models ranging from 0.5 to 72 billion parameters, including a Mixture-of-Experts model. This repo contains the instruction-tuned 1.5B Qwen2 model. Compared with the state-of-the-art opensource language models, including the previous released Qwen1.5, Qwen2 has generally surpassed most opensource models and demonstrated competitiveness against proprietary models across a series of benchmarks targeting for language understanding, language generation, multilingual capability, coding, mathematics, reasoning, etc. For more details, please refer to our [blog](https://qwenlm.github.io/blog/qwen2/), [GitHub](https://github.com/QwenLM/Qwen2), and [Documentation](https://qwen.readthedocs.io/en/latest/). <br> ## Model Details Qwen2 is a language model series including decoder language models of different model sizes. For each size, we release the base language model and the aligned chat model. It is based on the Transformer architecture with SwiGLU activation, attention QKV bias, group query attention, etc. Additionally, we have an improved tokenizer adaptive to multiple natural languages and codes. ## Training details We pretrained the models with a large amount of data, and we post-trained the models with both supervised finetuning and direct preference optimization. ## Requirements The code of Qwen2 has been in the latest Hugging face transformers and we advise you to install `transformers>=4.37.0`, or you might encounter the following error: ``` KeyError: 'qwen2' ``` ## Quickstart Here provides a code snippet with `apply_chat_template` to show you how to load the tokenizer and model and how to generate contents. ```python from transformers import AutoModelForCausalLM, AutoTokenizer device = "cuda" # the device to load the model onto model = AutoModelForCausalLM.from_pretrained( "Qwen/Qwen2-1.5B-Instruct", torch_dtype="auto", device_map="auto" ) tokenizer = AutoTokenizer.from_pretrained("Qwen/Qwen2-1.5B-Instruct") prompt = "Give me a short introduction to large language model." messages = [ {"role": "system", "content": "You are a helpful assistant."}, {"role": "user", "content": prompt} ] text = tokenizer.apply_chat_template( messages, tokenize=False, add_generation_prompt=True ) model_inputs = tokenizer([text], return_tensors="pt").to(device) generated_ids = model.generate( model_inputs.input_ids, max_new_tokens=512 ) generated_ids = [ output_ids[len(input_ids):] for input_ids, output_ids in zip(model_inputs.input_ids, generated_ids) ] response = tokenizer.batch_decode(generated_ids, skip_special_tokens=True)[0] ``` ## Evaluation We briefly compare Qwen2-1.5B-Instruct with Qwen1.5-1.8B-Chat. The results are as follows: | Datasets | Qwen1.5-0.5B-Chat | **Qwen2-0.5B-Instruct** | Qwen1.5-1.8B-Chat | **Qwen2-1.5B-Instruct** | | :--- | :---: | :---: | :---: | :---: | | MMLU | 35.0 | **37.9** | 43.7 | **52.4** | | HumanEval | 9.1 | **17.1** | 25.0 | **37.8** | | GSM8K | 11.3 | **40.1** | 35.3 | **61.6** | | C-Eval | 37.2 | **45.2** | 55.3 | **63.8** | | IFEval (Prompt Strict-Acc.) | 14.6 | **20.0** | 16.8 | **29.0** | ## Citation If you find our work helpful, feel free to give us a cite. ``` @article{qwen2, title={Qwen2 Technical Report}, year={2024} } ```

timm/vit_tiny_patch16_384.augreg_in21k_ft_in1k

timm

timm

image-classification

--- tags: - image-classification - timm library_name: timm license: apache-2.0 datasets: - imagenet-1k - imagenet-21k --- # Model card for vit_tiny_patch16_384.augreg_in21k_ft_in1k A Vision Transformer (ViT) image classification model. Trained on ImageNet-21k and fine-tuned on ImageNet-1k (with additional augmentation and regularization) in JAX by paper authors, ported to PyTorch by Ross Wightman. ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 5.8 - GMACs: 3.2 - Activations (M): 12.1 - Image size: 384 x 384 - **Papers:** - How to train your ViT? Data, Augmentation, and Regularization in Vision Transformers: https://arxiv.org/abs/2106.10270 - An Image is Worth 16x16 Words: Transformers for Image Recognition at Scale: https://arxiv.org/abs/2010.11929v2 - **Dataset:** ImageNet-1k - **Pretrain Dataset:** ImageNet-21k - **Original:** https://github.com/google-research/vision_transformer ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('vit_tiny_patch16_384.augreg_in21k_ft_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'vit_tiny_patch16_384.augreg_in21k_ft_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled, a (1, 577, 192) shaped tensor output = model.forward_head(output, pre_logits=True) # output is a (1, num_features) shaped tensor ``` ## Model Comparison Explore the dataset and runtime metrics of this model in timm [model results](https://github.com/huggingface/pytorch-image-models/tree/main/results). ## Citation ```bibtex @article{steiner2021augreg, title={How to train your ViT? Data, Augmentation, and Regularization in Vision Transformers}, author={Steiner, Andreas and Kolesnikov, Alexander and and Zhai, Xiaohua and Wightman, Ross and Uszkoreit, Jakob and Beyer, Lucas}, journal={arXiv preprint arXiv:2106.10270}, year={2021} } ``` ```bibtex @article{dosovitskiy2020vit, title={An Image is Worth 16x16 Words: Transformers for Image Recognition at Scale}, author={Dosovitskiy, Alexey and Beyer, Lucas and Kolesnikov, Alexander and Weissenborn, Dirk and Zhai, Xiaohua and Unterthiner, Thomas and Dehghani, Mostafa and Minderer, Matthias and Heigold, Georg and Gelly, Sylvain and Uszkoreit, Jakob and Houlsby, Neil}, journal={ICLR}, year={2021} } ``` ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ```

SWivid/E2-TTS

SWivid

f5-tts

text-to-speech

--- license: cc-by-nc-4.0 pipeline_tag: text-to-speech library_name: f5-tts datasets: - amphion/Emilia-Dataset --- ### 2024/10/14. We change the License of this ckpt repo to CC-BY-NC-4.0 following the used training set Emilia, which is an in-the-wild dataset. Sorry for any inconvenience this may cause. Our codebase remains under the MIT license. Download [F5-TTS](https://huggingface.co/SWivid/F5-TTS/tree/main/F5TTS_Base) or [E2 TTS](https://huggingface.co/SWivid/E2-TTS/tree/main/E2TTS_Base) and place under ckpts/ ``` ckpts/ E2TTS_Base/ model_1200000.pt F5TTS_Base/ model_1200000.pt ``` Inference with .safetensors option ``` ckpts/ E2TTS_Base/ model_1200000.safetensors F5TTS_Base/ model_1200000.safetensors ``` Github: https://github.com/SWivid/F5-TTS Paper: [E2 TTS: Embarrassingly Easy Fully Non-Autoregressive Zero-Shot TTS](https://huggingface.co/papers/2406.18009)

ggrazzioli/cls_sentimento_sebrae

ggrazzioli

transformers

text-classification

--- tags: - text-classification language: - pt widget: - text: "Gostei muito do serviço prestado" datasets: - ggrazzioli/cls_sentimento_sebrae co2_eq_emissions: emissions: 0.6308403394105772 --- # Model Trained - Problem type: Classificação de sentimentos em dataset interno do Sebrae RS - Model ID: 96390146647 - CO2 Emissions (in grams): 0.6308 - "id2label": {"0": "Negativo", "1": "Neutro", "2": "Positivo"} ## Validation Metrics - Loss: 0.143 - Accuracy: 0.965 - Macro F1: 0.935 - Micro F1: 0.965 - Weighted F1: 0.964 - Macro Precision: 0.938 - Micro Precision: 0.965 - Weighted Precision: 0.964 - Macro Recall: 0.933 - Micro Recall: 0.965 - Weighted Recall: 0.965 ## Usage Python API: ``` from transformers import AutoModelForSequenceClassification, AutoTokenizer model = AutoModelForSequenceClassification.from_pretrained("ggrazzioli/cls_sentimento_sebrae") tokenizer = AutoTokenizer.from_pretrained("ggrazzioli/cls_sentimento_sebrae") inputs = tokenizer("Gostei muito dos serviços gerados, recomendo a todos!", return_tensors="pt") outputs = model(**inputs) ```

bofenghuang/whisper-large-v3-french

bofenghuang

transformers

automatic-speech-recognition

--- license: mit language: fr library_name: transformers pipeline_tag: automatic-speech-recognition thumbnail: null tags: - automatic-speech-recognition - hf-asr-leaderboard datasets: - mozilla-foundation/common_voice_13_0 - facebook/multilingual_librispeech - facebook/voxpopuli - google/fleurs - gigant/african_accented_french metrics: - wer model-index: - name: whisper-large-v3-french results: - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: Common Voice 13.0 type: mozilla-foundation/common_voice_13_0 config: fr split: test args: language: fr metrics: - name: WER type: wer value: 7.28 - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: Multilingual LibriSpeech (MLS) type: facebook/multilingual_librispeech config: french split: test args: language: fr metrics: - name: WER type: wer value: 3.98 - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: VoxPopuli type: facebook/voxpopuli config: fr split: test args: language: fr metrics: - name: WER type: wer value: 8.91 - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: Fleurs type: google/fleurs config: fr_fr split: test args: language: fr metrics: - name: WER type: wer value: 4.84 - task: name: Automatic Speech Recognition type: automatic-speech-recognition dataset: name: African Accented French type: gigant/african_accented_french config: fr split: test args: language: fr metrics: - name: WER type: wer value: 4.20 --- # Whisper-Large-V3-French Whisper-Large-V3-French is fine-tuned on `openai/whisper-large-v3` to further enhance its performance on the French language. This model has been trained to predict casing, punctuation, and numbers. While this might slightly sacrifice performance, we believe it allows for broader usage. This model has been converted into various formats, facilitating its usage across different libraries, including transformers, openai-whisper, fasterwhisper, whisper.cpp, candle, mlx, etc. ## Table of Contents - [Performance](#performance) - [Usage](#usage) - [Hugging Face Pipeline](#hugging-face-pipeline) - [Hugging Face Low-level APIs](#hugging-face-low-level-apis) - [Speculative Decoding](#speculative-decoding) - [OpenAI Whisper](#openai-whisper) - [Faster Whisper](#faster-whisper) - [Whisper.cpp](#whispercpp) - [Candle](#candle) - [MLX](#mlx) - [Training details](#training-details) - [Acknowledgements](#acknowledgements) ## Performance We evaluated our model on both short and long-form transcriptions, and also tested it on both in-distribution and out-of-distribution datasets to conduct a comprehensive analysis assessing its accuracy, generalizability, and robustness. Please note that the reported WER is the result after converting numbers to text, removing punctuation (except for apostrophes and hyphens), and converting all characters to lowercase. All evaluation results on the public datasets can be found [here](https://drive.google.com/drive/folders/1rFIh6yXRVa9RZ0ieZoKiThFZgQ4STPPI?usp=drive_link). ### Short-Form Transcription  Due to the lack of readily available out-of-domain (OOD) and long-form test sets in French, we evaluated using internal test sets from [Zaion Lab](https://zaion.ai/). These sets comprise human-annotated audio-transcription pairs from call center conversations, which are notable for their significant background noise and domain-specific terminology. ### Long-Form Transcription  The long-form transcription was run using the 🤗 Hugging Face pipeline for quicker evaluation. Audio files were segmented into 30-second chunks and processed in parallel. ## Usage ### Hugging Face Pipeline The model can easily used with the 🤗 Hugging Face [`pipeline`](https://huggingface.co/docs/transformers/main_classes/pipelines#transformers.AutomaticSpeechRecognitionPipeline) class for audio transcription. For long-form transcription (> 30 seconds), you can activate the process by passing the `chunk_length_s` argument. This approach segments the audio into smaller segments, processes them in parallel, and then joins them at the strides by finding the longest common sequence. While this chunked long-form approach may have a slight compromise in performance compared to OpenAI's sequential algorithm, it provides 9x faster inference speed. ```python import torch from datasets import load_dataset from transformers import AutoModelForSpeechSeq2Seq, AutoProcessor, pipeline device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 # Load model model_name_or_path = "bofenghuang/whisper-large-v3-french" processor = AutoProcessor.from_pretrained(model_name_or_path) model = AutoModelForSpeechSeq2Seq.from_pretrained( model_name_or_path, torch_dtype=torch_dtype, low_cpu_mem_usage=True, ) model.to(device) # Init pipeline pipe = pipeline( "automatic-speech-recognition", model=model, feature_extractor=processor.feature_extractor, tokenizer=processor.tokenizer, torch_dtype=torch_dtype, device=device, # chunk_length_s=30, # for long-form transcription max_new_tokens=128, ) # Example audio dataset = load_dataset("bofenghuang/asr-dummy", "fr", split="test") sample = dataset[0]["audio"] # Run pipeline result = pipe(sample) print(result["text"]) ``` ### Hugging Face Low-level APIs You can also use the 🤗 Hugging Face low-level APIs for transcription, offering greater control over the process, as demonstrated below: ```python import torch from datasets import load_dataset from transformers import AutoModelForSpeechSeq2Seq, AutoProcessor device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 # Load model model_name_or_path = "bofenghuang/whisper-large-v3-french" processor = AutoProcessor.from_pretrained(model_name_or_path) model = AutoModelForSpeechSeq2Seq.from_pretrained( model_name_or_path, torch_dtype=torch_dtype, low_cpu_mem_usage=True, ) model.to(device) # Example audio dataset = load_dataset("bofenghuang/asr-dummy", "fr", split="test") sample = dataset[0]["audio"] # Extract feautres input_features = processor( sample["array"], sampling_rate=sample["sampling_rate"], return_tensors="pt" ).input_features # Generate tokens predicted_ids = model.generate( input_features.to(dtype=torch_dtype).to(device), max_new_tokens=128 ) # Detokenize to text transcription = processor.batch_decode(predicted_ids, skip_special_tokens=True)[0] print(transcription) ``` ### Speculative Decoding [Speculative decoding](https://huggingface.co/blog/whisper-speculative-decoding) can be achieved using a draft model, essentially a distilled version of Whisper. This approach guarantees identical outputs to using the main Whisper model alone, offers a 2x faster inference speed, and incurs only a slight increase in memory overhead. Since the distilled Whisper has the same encoder as the original, only its decoder need to be loaded, and encoder outputs are shared between the main and draft models during inference. Using speculative decoding with the Hugging Face pipeline is simple - just specify the `assistant_model` within the generation configurations. ```python import torch from datasets import load_dataset from transformers import ( AutoModelForCausalLM, AutoModelForSpeechSeq2Seq, AutoProcessor, pipeline, ) device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 # Load model model_name_or_path = "bofenghuang/whisper-large-v3-french" processor = AutoProcessor.from_pretrained(model_name_or_path) model = AutoModelForSpeechSeq2Seq.from_pretrained( model_name_or_path, torch_dtype=torch_dtype, low_cpu_mem_usage=True, ) model.to(device) # Load draft model assistant_model_name_or_path = "bofenghuang/whisper-large-v3-french-distil-dec2" assistant_model = AutoModelForCausalLM.from_pretrained( assistant_model_name_or_path, torch_dtype=torch_dtype, low_cpu_mem_usage=True, ) assistant_model.to(device) # Init pipeline pipe = pipeline( "automatic-speech-recognition", model=model, feature_extractor=processor.feature_extractor, tokenizer=processor.tokenizer, torch_dtype=torch_dtype, device=device, generate_kwargs={"assistant_model": assistant_model}, max_new_tokens=128, ) # Example audio dataset = load_dataset("bofenghuang/asr-dummy", "fr", split="test") sample = dataset[0]["audio"] # Run pipeline result = pipe(sample) print(result["text"]) ``` ### OpenAI Whisper You can also employ the sequential long-form decoding algorithm with a sliding window and temperature fallback, as outlined by OpenAI in their original [paper](https://arxiv.org/abs/2212.04356). First, install the [openai-whisper](https://github.com/openai/whisper) package: ```bash pip install -U openai-whisper ``` Then, download the converted model: ```bash python -c "from huggingface_hub import hf_hub_download; hf_hub_download(repo_id='bofenghuang/whisper-large-v3-french', filename='original_model.pt', local_dir='./models/whisper-large-v3-french')" ``` Now, you can transcirbe audio files by following the usage instructions provided in the repository: ```python import whisper from datasets import load_dataset # Load model model = whisper.load_model("./models/whisper-large-v3-french/original_model.pt") # Example audio dataset = load_dataset("bofenghuang/asr-dummy", "fr", split="test") sample = dataset[0]["audio"]["array"].astype("float32") # Transcribe result = model.transcribe(sample, language="fr") print(result["text"]) ``` ### Faster Whisper Faster Whisper is a reimplementation of OpenAI's Whisper models and the sequential long-form decoding algorithm in the [CTranslate2](https://github.com/OpenNMT/CTranslate2) format. Compared to openai-whisper, it offers up to 4x faster inference speed, while consuming less memory. Additionally, the model can be quantized into int8, further enhancing its efficiency on both CPU and GPU. First, install the [faster-whisper](https://github.com/SYSTRAN/faster-whisper) package: ```bash pip install faster-whisper ``` Then, download the model converted to the CTranslate2 format: ```bash python -c "from huggingface_hub import snapshot_download; snapshot_download(repo_id='bofenghuang/whisper-large-v3-french', local_dir='./models/whisper-large-v3-french', allow_patterns='ctranslate2/*')" ``` Now, you can transcirbe audio files by following the usage instructions provided in the repository: ```python from datasets import load_dataset from faster_whisper import WhisperModel # Load model model = WhisperModel("./models/whisper-large-v3-french/ctranslate2", device="cuda", compute_type="float16") # Run on GPU with FP16 # Example audio dataset = load_dataset("bofenghuang/asr-dummy", "fr", split="test") sample = dataset[0]["audio"]["array"].astype("float32") segments, info = model.transcribe(sample, beam_size=5, language="fr") for segment in segments: print("[%.2fs -> %.2fs] %s" % (segment.start, segment.end, segment.text)) ``` ### Whisper.cpp Whisper.cpp is a reimplementation of OpenAI's Whisper models, crafted in plain C/C++ without any dependencies. It offers compatibility with various backends and platforms. Additionally, the model can be quantized to either 4-bit or 5-bit integers, further enhancing its efficiency. First, clone and build the [whisper.cpp](https://github.com/ggerganov/whisper.cpp) repository: ```bash git clone https://github.com/ggerganov/whisper.cpp.git cd whisper.cpp # build the main example make ``` Next, download the converted ggml weights from the Hugging Face Hub: ```bash # Download model quantized with Q5_0 method python -c "from huggingface_hub import hf_hub_download; hf_hub_download(repo_id='bofenghuang/whisper-large-v3-french', filename='ggml-model-q5_0.bin', local_dir='./models/whisper-large-v3-french')" ``` Now, you can transcribe an audio file using the following command: ```bash ./main -m ./models/whisper-large-v3-french/ggml-model-q5_0.bin -l fr -f /path/to/audio/file --print-colors ``` ### Candle [Candle-whisper](https://github.com/huggingface/candle/tree/main/candle-examples/examples/whisper) is a reimplementation of OpenAI's Whisper models in the candle format - a lightweight ML framework built in Rust. First, clone the [candle](https://github.com/huggingface/candle) repository: ```bash git clone https://github.com/huggingface/candle.git cd candle/candle-examples/examples/whisper ``` Transcribe an audio file using the following command: ```bash cargo run --example whisper --release -- --model large-v3 --model-id bofenghuang/whisper-large-v3-french --language fr --input /path/to/audio/file ``` In order to use CUDA add `--features cuda` to the example command line: ```bash cargo run --example whisper --release --features cuda -- --model large-v3 --model-id bofenghuang/whisper-large-v3-french --language fr --input /path/to/audio/file ``` ### MLX [MLX-Whisper](https://github.com/ml-explore/mlx-examples/tree/main/whisper) is a reimplementation of OpenAI's Whisper models in the [MLX](https://github.com/ml-explore/mlx) format - a ML framework on Apple silicon. It supports features like lazy computation, unified memory management, etc. First, clone the [MLX Examples](https://github.com/ml-explore/mlx-examples) repository: ```bash git clone https://github.com/ml-explore/mlx-examples.git cd mlx-examples/whisper ``` Next, install the dependencies: ```bash pip install -r requirements.txt ``` Download the pytorch checkpoint in the original OpenAI format and convert it into MLX format (We haven't included the converted version here since the repository is already heavy and the conversion is very fast): ```bash # Download python -c "from huggingface_hub import hf_hub_download; hf_hub_download(repo_id='bofenghuang/whisper-large-v3-french', filename='original_model.pt', local_dir='./models/whisper-large-v3-french')" # Convert into .npz python convert.py --torch-name-or-path ./models/whisper-large-v3-french/original_model.pt --mlx-path ./mlx_models/whisper-large-v3-french ``` Now, you can transcribe audio with: ```python import whisper result = whisper.transcribe("/path/to/audio/file", path_or_hf_repo="mlx_models/whisper-large-v3-french", language="fr") print(result["text"]) ``` ## Training details We've collected a composite dataset consisting of over 2,500 hours of French speech recognition data, which incldues datasets such as [Common Voice 13.0](https://huggingface.co/datasets/mozilla-foundation/common_voice_13_0), [Multilingual LibriSpeech](https://huggingface.co/datasets/facebook/multilingual_librispeech), [Voxpopuli](https://huggingface.co/datasets/facebook/voxpopuli), [Fleurs](https://huggingface.co/datasets/google/fleurs), [Multilingual TEDx](https://www.openslr.org/100/), [MediaSpeech](https://www.openslr.org/108/), [African Accented French](https://huggingface.co/datasets/gigant/african_accented_french), etc. Given that some datasets, like MLS, only offer text without case or punctuation, we employed a customized version of 🤗 [Speechbox](https://github.com/huggingface/speechbox) to restore case and punctuation from a limited set of symbols using the [bofenghuang/whisper-large-v2-cv11-french](bofenghuang/whisper-large-v2-cv11-french) model. However, even within these datasets, we observed certain quality issues. These ranged from mismatches between audio and transcription in terms of language or content, poorly segmented utterances, to missing words in scripted speech, etc. We've built a pipeline to filter out many of these problematic utterances, aiming to enhance the dataset's quality. As a result, we excluded more than 10% of the data, and when we retrained the model, we noticed a significant reduction of hallucination. For training, we employed the [script](https://github.com/huggingface/transformers/blob/main/examples/pytorch/speech-recognition/run_speech_recognition_seq2seq.py) available in the 🤗 Transformers repository. The model training took place on the [Jean-Zay supercomputer](http://www.idris.fr/eng/jean-zay/jean-zay-presentation-eng.html) at GENCI, and we extend our gratitude to the IDRIS team for their responsive support throughout the project. ## Acknowledgements - OpenAI for creating and open-sourcing the [Whisper model](https://arxiv.org/abs/2212.04356) - 🤗 Hugging Face for integrating the Whisper model and providing the training codebase within the [Transformers](https://github.com/huggingface/transformers) repository - [Genci](https://genci.fr/) for their generous contribution of GPU hours to this project

neuralmagic/Meta-Llama-3.1-8B-Instruct-FP8

neuralmagic

transformers

text-generation

--- tags: - fp8 - vllm language: - en - de - fr - it - pt - hi - es - th pipeline_tag: text-generation license: llama3.1 base_model: meta-llama/Meta-Llama-3.1-8B-Instruct --- # Meta-Llama-3.1-8B-Instruct-FP8 ## Model Overview - **Model Architecture:** Meta-Llama-3.1 - **Input:** Text - **Output:** Text - **Model Optimizations:** - **Weight quantization:** FP8 - **Activation quantization:** FP8 - **Intended Use Cases:** Intended for commercial and research use in multiple languages. Similarly to [Meta-Llama-3.1-8B-Instruct](https://huggingface.co/meta-llama/Meta-Llama-3.1-8B-Instruct), this models is intended for assistant-like chat. - **Out-of-scope:** Use in any manner that violates applicable laws or regulations (including trade compliance laws). Use in languages other than English. - **Release Date:** 7/23/2024 - **Version:** 1.0 - **License(s):** [llama3.1](https://huggingface.co/meta-llama/Meta-Llama-3.1-8B/blob/main/LICENSE) - **Model Developers:** Neural Magic Quantized version of [Meta-Llama-3.1-8B-Instruct](https://huggingface.co/meta-llama/Meta-Llama-3.1-8B-Instruct). It achieves an average score of 73.44 on the [OpenLLM](https://huggingface.co/spaces/open-llm-leaderboard/open_llm_leaderboard) benchmark (version 1), whereas the unquantized model achieves 73.79. ### Model Optimizations This model was obtained by quantizing the weights and activations of [Meta-Llama-3.1-8B-Instruct](https://huggingface.co/meta-llama/Meta-Llama-3.1-8B-Instruct) to FP8 data type, ready for inference with vLLM built from source. This optimization reduces the number of bits per parameter from 16 to 8, reducing the disk size and GPU memory requirements by approximately 50%. Only the weights and activations of the linear operators within transformers blocks are quantized. Symmetric per-tensor quantization is applied, in which a single linear scaling maps the FP8 representations of the quantized weights and activations. [LLM Compressor](https://github.com/vllm-project/llm-compressor) is used for quantization with 512 sequences of UltraChat. ## Deployment ### Use with vLLM This model can be deployed efficiently using the [vLLM](https://docs.vllm.ai/en/latest/) backend, as shown in the example below. ```python from vllm import LLM, SamplingParams from transformers import AutoTokenizer model_id = "neuralmagic/Meta-Llama-3.1-8B-Instruct-FP8" sampling_params = SamplingParams(temperature=0.6, top_p=0.9, max_tokens=256) tokenizer = AutoTokenizer.from_pretrained(model_id) messages = [ {"role": "system", "content": "You are a pirate chatbot who always responds in pirate speak!"}, {"role": "user", "content": "Who are you?"}, ] prompts = tokenizer.apply_chat_template(messages, tokenize=False) llm = LLM(model=model_id) outputs = llm.generate(prompts, sampling_params) generated_text = outputs[0].outputs[0].text print(generated_text) ``` vLLM aslo supports OpenAI-compatible serving. See the [documentation](https://docs.vllm.ai/en/latest/) for more details. ## Creation This model was created by applying [LLM Compressor with calibration samples from UltraChat](https://github.com/vllm-project/llm-compressor/blob/sa/big_model_support/examples/big_model_offloading/big_model_w8a8_calibrate.py), as presented in the code snipet below. ```python import torch from datasets import load_dataset from transformers import AutoTokenizer from llmcompressor.transformers import SparseAutoModelForCausalLM, oneshot from llmcompressor.transformers.compression.helpers import ( calculate_offload_device_map, custom_offload_device_map, ) recipe = """ quant_stage: quant_modifiers: QuantizationModifier: ignore: ["lm_head"] config_groups: group_0: weights: num_bits: 8 type: float strategy: tensor dynamic: false symmetric: true input_activations: num_bits: 8 type: float strategy: tensor dynamic: false symmetric: true targets: ["Linear"] """ model_stub = "meta-llama/Meta-Llama-3.1-8B-Instruct" model_name = model_stub.split("/")[-1] device_map = calculate_offload_device_map( model_stub, reserve_for_hessians=False, num_gpus=1, torch_dtype="auto" ) model = SparseAutoModelForCausalLM.from_pretrained( model_stub, torch_dtype="auto", device_map=device_map ) tokenizer = AutoTokenizer.from_pretrained(model_stub) output_dir = f"./{model_name}-FP8" DATASET_ID = "HuggingFaceH4/ultrachat_200k" DATASET_SPLIT = "train_sft" NUM_CALIBRATION_SAMPLES = 512 MAX_SEQUENCE_LENGTH = 4096 ds = load_dataset(DATASET_ID, split=DATASET_SPLIT) ds = ds.shuffle(seed=42).select(range(NUM_CALIBRATION_SAMPLES)) def preprocess(example): return { "text": tokenizer.apply_chat_template( example["messages"], tokenize=False, ) } ds = ds.map(preprocess) def tokenize(sample): return tokenizer( sample["text"], padding=False, max_length=MAX_SEQUENCE_LENGTH, truncation=True, add_special_tokens=False, ) ds = ds.map(tokenize, remove_columns=ds.column_names) oneshot( model=model, output_dir=output_dir, dataset=ds, recipe=recipe, max_seq_length=MAX_SEQUENCE_LENGTH, num_calibration_samples=NUM_CALIBRATION_SAMPLES, save_compressed=True, ) ``` ## Evaluation The model was evaluated on MMLU, ARC-Challenge, GSM-8K, Hellaswag, Winogrande and TruthfulQA. Evaluation was conducted using the Neural Magic fork of [lm-evaluation-harness](https://github.com/neuralmagic/lm-evaluation-harness/tree/llama_3.1_instruct) (branch llama_3.1_instruct) and the [vLLM](https://docs.vllm.ai/en/stable/) engine. This version of the lm-evaluation-harness includes versions of ARC-Challenge, GSM-8K, MMLU, and MMLU-cot that match the prompting style of [Meta-Llama-3.1-Instruct-evals](https://huggingface.co/datasets/meta-llama/Meta-Llama-3.1-8B-Instruct-evals). ### Accuracy #### Open LLM Leaderboard evaluation scores <table> <tr> <td><strong>Benchmark</strong> </td> <td><strong>Meta-Llama-3.1-8B-Instruct </strong> </td> <td><strong>Meta-Llama-3.1-8B-Instruct-FP8(this model)</strong> </td> <td><strong>Recovery</strong> </td> </tr> <tr> <td>MMLU (5-shot) </td> <td>67.95 </td> <td>67.97 </td> <td>100.0% </td> </tr> <tr> <td>MMLU-cot (0-shot) </td> <td>71.24 </td> <td>71.12 </td> <td>99.83% </td> </tr> <tr> <td>ARC Challenge (0-shot) </td> <td>82.00 </td> <td>81.66 </td> <td>99.59% </td> </tr> <tr> <td>GSM-8K-cot (8-shot, strict-match) </td> <td>81.96 </td> <td>81.12 </td> <td>98.98% </td> </tr> <tr> <td>Hellaswag (10-shot) </td> <td>80.46 </td> <td>80.4 </td> <td>99.93% </td> </tr> <tr> <td>Winogrande (5-shot) </td> <td>78.45 </td> <td>77.90 </td> <td>99.30% </td> </tr> <tr> <td>TruthfulQA (0-shot, mc2) </td> <td>54.50 </td> <td>53.92 </td> <td>98.94% </td> </tr> <tr> <td><strong>Average</strong> </td> <td><strong>73.79</strong> </td> <td><strong>73.44</strong> </td> <td><strong>99.52%</strong> </td> </tr> </table> ### Reproduction The results were obtained using the following commands: #### MMLU ``` lm_eval \ --model vllm \ --model_args pretrained="neuralmagic/Meta-Llama-3.1-8B-Instruct-FP8",dtype=auto,add_bos_token=True,max_model_len=4096,tensor_parallel_size=1 \ --tasks mmlu \ --num_fewshot 5 \ --batch_size auto ``` #### MMLU-cot ``` lm_eval \ --model vllm \ --model_args pretrained="neuralmagic/Meta-Llama-3.1-8B-Instruct-FP8",dtype=auto,add_bos_token=True,max_model_len=4096,tensor_parallel_size=1 \ --tasks mmlu_cot_0shot_llama_3.1_instruct \ --apply_chat_template \ --num_fewshot 0 \ --batch_size auto ``` #### ARC-Challenge ``` lm_eval \ --model vllm \ --model_args pretrained="neuralmagic/Meta-Llama-3.1-8B-Instruct-FP8",dtype=auto,add_bos_token=True,max_model_len=4096,tensor_parallel_size=1 \ --tasks arc_challenge_llama_3.1_instruct \ --apply_chat_template \ --num_fewshot 0 \ --batch_size auto ``` #### GSM-8K ``` lm_eval \ --model vllm \ --model_args pretrained="neuralmagic/Meta-Llama-3.1-8B-Instruct-FP8",dtype=auto,add_bos_token=True,max_model_len=4096,tensor_parallel_size=1 \ --tasks gsm8k_cot_llama_3.1_instruct \ --apply_chat_template \ --fewshot_as_multiturn \ --num_fewshot 8 \ --batch_size auto ``` #### Hellaswag ``` lm_eval \ --model vllm \ --model_args pretrained="neuralmagic/Meta-Llama-3.1-8B-Instruct-FP8",dtype=auto,add_bos_token=True,max_model_len=4096,tensor_parallel_size=1 \ --tasks hellaswag \ --num_fewshot 10 \ --batch_size auto ``` #### Winogrande ``` lm_eval \ --model vllm \ --model_args pretrained="neuralmagic/Meta-Llama-3.1-8B-Instruct-FP8",dtype=auto,add_bos_token=True,max_model_len=4096,tensor_parallel_size=1 \ --tasks winogrande \ --num_fewshot 5 \ --batch_size auto ``` #### TruthfulQA ``` lm_eval \ --model vllm \ --model_args pretrained="neuralmagic/Meta-Llama-3.1-8B-Instruct-FP8",dtype=auto,add_bos_token=True,max_model_len=4096,tensor_parallel_size=1 \ --tasks truthfulqa \ --num_fewshot 0 \ --batch_size auto ```

SpanBERT/spanbert-large-cased

SpanBERT

transformers

Entry not found

cross-encoder/nli-deberta-base

cross-encoder

transformers

zero-shot-classification

--- language: en pipeline_tag: zero-shot-classification tags: - deberta-base-base datasets: - multi_nli - snli metrics: - accuracy license: apache-2.0 --- # Cross-Encoder for Natural Language Inference This model was trained using [SentenceTransformers](https://sbert.net) [Cross-Encoder](https://www.sbert.net/examples/applications/cross-encoder/README.html) class. ## Training Data The model was trained on the [SNLI](https://nlp.stanford.edu/projects/snli/) and [MultiNLI](https://cims.nyu.edu/~sbowman/multinli/) datasets. For a given sentence pair, it will output three scores corresponding to the labels: contradiction, entailment, neutral. ## Performance For evaluation results, see [SBERT.net - Pretrained Cross-Encoder](https://www.sbert.net/docs/pretrained_cross-encoders.html#nli). ## Usage Pre-trained models can be used like this: ```python from sentence_transformers import CrossEncoder model = CrossEncoder('cross-encoder/nli-deberta-base') scores = model.predict([('A man is eating pizza', 'A man eats something'), ('A black race car starts up in front of a crowd of people.', 'A man is driving down a lonely road.')]) #Convert scores to labels label_mapping = ['contradiction', 'entailment', 'neutral'] labels = [label_mapping[score_max] for score_max in scores.argmax(axis=1)] ``` ## Usage with Transformers AutoModel You can use the model also directly with Transformers library (without SentenceTransformers library): ```python from transformers import AutoTokenizer, AutoModelForSequenceClassification import torch model = AutoModelForSequenceClassification.from_pretrained('cross-encoder/nli-deberta-base') tokenizer = AutoTokenizer.from_pretrained('cross-encoder/nli-deberta-base') features = tokenizer(['A man is eating pizza', 'A black race car starts up in front of a crowd of people.'], ['A man eats something', 'A man is driving down a lonely road.'], padding=True, truncation=True, return_tensors="pt") model.eval() with torch.no_grad(): scores = model(**features).logits label_mapping = ['contradiction', 'entailment', 'neutral'] labels = [label_mapping[score_max] for score_max in scores.argmax(dim=1)] print(labels) ``` ## Zero-Shot Classification This model can also be used for zero-shot-classification: ```python from transformers import pipeline classifier = pipeline("zero-shot-classification", model='cross-encoder/nli-deberta-base') sent = "Apple just announced the newest iPhone X" candidate_labels = ["technology", "sports", "politics"] res = classifier(sent, candidate_labels) print(res) ```

flax-sentence-embeddings/st-codesearch-distilroberta-base

flax-sentence-embeddings

sentence-transformers

sentence-similarity

--- pipeline_tag: sentence-similarity tags: - sentence-transformers - feature-extraction - sentence-similarity datasets: - code_search_net --- # flax-sentence-embeddings/st-codesearch-distilroberta-base This is a [sentence-transformers](https://www.SBERT.net) model: It maps sentences & paragraphs to a 768 dimensional dense vector space and can be used for tasks like clustering or semantic search. It was trained on the [code_search_net](https://huggingface.co/datasets/code_search_net) dataset and can be used to search program code given text. ## Usage: ```python from sentence_transformers import SentenceTransformer, util #This list the defines the different programm codes code = ["""def sort_list(x): return sorted(x)""", """def count_above_threshold(elements, threshold=0): counter = 0 for e in elements: if e > threshold: counter += 1 return counter""", """def find_min_max(elements): min_ele = 99999 max_ele = -99999 for e in elements: if e < min_ele: min_ele = e if e > max_ele: max_ele = e return min_ele, max_ele"""] model = SentenceTransformer("flax-sentence-embeddings/st-codesearch-distilroberta-base") # Encode our code into the vector space code_emb = model.encode(code, convert_to_tensor=True) # Interactive demo: Enter queries, and the method returns the best function from the # 3 functions we defined while True: query = input("Query: ") query_emb = model.encode(query, convert_to_tensor=True) hits = util.semantic_search(query_emb, code_emb)[0] top_hit = hits[0] print("Cossim: {:.2f}".format(top_hit['score'])) print(code[top_hit['corpus_id']]) print("\n\n") ``` ## Usage (Sentence-Transformers) Using this model becomes easy when you have [sentence-transformers](https://www.SBERT.net) installed: ``` pip install -U sentence-transformers ``` Then you can use the model like this: ```python from sentence_transformers import SentenceTransformer sentences = ["This is an example sentence", "Each sentence is converted"] model = SentenceTransformer('flax-sentence-embeddings/st-codesearch-distilroberta-base') embeddings = model.encode(sentences) print(embeddings) ``` ## Training The model was trained with a DistilRoBERTa-base model for 10k training steps on the codesearch dataset with batch_size 256 and MultipleNegativesRankingLoss. It is some preliminary model. It was neither tested nor was the trained quite sophisticated The model was trained with the parameters: **DataLoader**: `MultiDatasetDataLoader.MultiDatasetDataLoader` of length 5371 with parameters: ``` {'batch_size': 256} ``` **Loss**: `sentence_transformers.losses.MultipleNegativesRankingLoss.MultipleNegativesRankingLoss` with parameters: ``` {'scale': 20, 'similarity_fct': 'dot_score'} ``` Parameters of the fit()-Method: ``` { "callback": null, "epochs": 1, "evaluation_steps": 0, "evaluator": "NoneType", "max_grad_norm": 1, "optimizer_class": "<class 'transformers.optimization.AdamW'>", "optimizer_params": { "lr": 2e-05 }, "scheduler": "warmupconstant", "steps_per_epoch": 10000, "warmup_steps": 500, "weight_decay": 0.01 } ``` ## Full Model Architecture ``` SentenceTransformer( (0): Transformer({'max_seq_length': 128, 'do_lower_case': False}) with Transformer model: RobertaModel (1): Pooling({'word_embedding_dimension': 768, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False}) (2): Normalize() ) ``` ## Citing & Authors <!--- Describe where people can find more information -->

google/mt5-small

google

transformers

text2text-generation

--- language: - multilingual - af - am - ar - az - be - bg - bn - ca - ceb - co - cs - cy - da - de - el - en - eo - es - et - eu - fa - fi - fil - fr - fy - ga - gd - gl - gu - ha - haw - hi - hmn - ht - hu - hy - ig - is - it - iw - ja - jv - ka - kk - km - kn - ko - ku - ky - la - lb - lo - lt - lv - mg - mi - mk - ml - mn - mr - ms - mt - my - ne - nl - no - ny - pa - pl - ps - pt - ro - ru - sd - si - sk - sl - sm - sn - so - sq - sr - st - su - sv - sw - ta - te - tg - th - tr - uk - und - ur - uz - vi - xh - yi - yo - zh - zu datasets: - mc4 license: apache-2.0 --- [Google's mT5](https://github.com/google-research/multilingual-t5) mT5 is pretrained on the [mC4](https://www.tensorflow.org/datasets/catalog/c4#c4multilingual) corpus, covering 101 languages: Afrikaans, Albanian, Amharic, Arabic, Armenian, Azerbaijani, Basque, Belarusian, Bengali, Bulgarian, Burmese, Catalan, Cebuano, Chichewa, Chinese, Corsican, Czech, Danish, Dutch, English, Esperanto, Estonian, Filipino, Finnish, French, Galician, Georgian, German, Greek, Gujarati, Haitian Creole, Hausa, Hawaiian, Hebrew, Hindi, Hmong, Hungarian, Icelandic, Igbo, Indonesian, Irish, Italian, Japanese, Javanese, Kannada, Kazakh, Khmer, Korean, Kurdish, Kyrgyz, Lao, Latin, Latvian, Lithuanian, Luxembourgish, Macedonian, Malagasy, Malay, Malayalam, Maltese, Maori, Marathi, Mongolian, Nepali, Norwegian, Pashto, Persian, Polish, Portuguese, Punjabi, Romanian, Russian, Samoan, Scottish Gaelic, Serbian, Shona, Sindhi, Sinhala, Slovak, Slovenian, Somali, Sotho, Spanish, Sundanese, Swahili, Swedish, Tajik, Tamil, Telugu, Thai, Turkish, Ukrainian, Urdu, Uzbek, Vietnamese, Welsh, West Frisian, Xhosa, Yiddish, Yoruba, Zulu. **Note**: mT5 was only pre-trained on mC4 excluding any supervised training. Therefore, this model has to be fine-tuned before it is useable on a downstream task. Pretraining Dataset: [mC4](https://www.tensorflow.org/datasets/catalog/c4#c4multilingual) Other Community Checkpoints: [here](https://huggingface.co/models?search=mt5) Paper: [mT5: A massively multilingual pre-trained text-to-text transformer](https://arxiv.org/abs/2010.11934) Authors: *Linting Xue, Noah Constant, Adam Roberts, Mihir Kale, Rami Al-Rfou, Aditya Siddhant, Aditya Barua, Colin Raffel* ## Abstract The recent "Text-to-Text Transfer Transformer" (T5) leveraged a unified text-to-text format and scale to attain state-of-the-art results on a wide variety of English-language NLP tasks. In this paper, we introduce mT5, a multilingual variant of T5 that was pre-trained on a new Common Crawl-based dataset covering 101 languages. We describe the design and modified training of mT5 and demonstrate its state-of-the-art performance on many multilingual benchmarks. All of the code and model checkpoints used in this work are publicly available.

HuggingFaceM4/tiny-random-LlamaForCausalLM

HuggingFaceM4

transformers

text-generation

Entry not found

lmms-lab/llava-onevision-qwen2-7b-ov

lmms-lab

transformers

text-generation

--- datasets: - lmms-lab/LLaVA-OneVision-Data language: - en - zh library_name: transformers license: apache-2.0 metrics: - accuracy tags: - multimodal model-index: - name: llava-onevision-qwen-7b-ov results: - task: type: multimodal dataset: name: AI2D type: ai2d metrics: - type: accuracy value: 81.4 name: accuracy verified: true - task: type: multimodal dataset: name: ChartQA type: chartqa metrics: - type: accuracy value: 80.0 name: accuracy verified: true - task: type: multimodal dataset: name: DocVQA type: docvqa metrics: - type: accuracy value: 90.2 name: accuracy verified: true - task: type: multimodal dataset: name: InfoVQA type: infovqa metrics: - type: accuracy value: 70.7 name: accuracy verified: true - task: type: multimodal dataset: name: MathVerse type: mathverse metrics: - type: accuracy value: 26.2 name: accuracy verified: true - task: type: multimodal dataset: name: MathVista type: mathvista metrics: - type: accuracy value: 63.2 name: accuracy verified: true - task: type: multimodal dataset: name: MMBench type: mmbench metrics: - type: accuracy value: 80.8 name: accuracy verified: true - task: type: multimodal dataset: name: MME-Perception type: mme-perception metrics: - type: score value: 1580 name: score verified: true - task: type: multimodal dataset: name: MME-Cognition type: mme-cognition metrics: - type: score value: 418 name: score verified: true - task: type: multimodal dataset: name: MMMU type: mmmu metrics: - type: accuracy value: 48.8 name: accuracy verified: true - task: type: multimodal dataset: name: MMVet type: mmvet metrics: - type: accuracy value: 57.5 name: accuracy verified: true - task: type: multimodal dataset: name: MMStar type: mmstar metrics: - type: accuracy value: 61.7 name: accuracy verified: true - task: type: multimodal dataset: name: Seed-Bench type: seed-bench metrics: - type: accuracy value: 75.4 name: accuracy verified: true - task: type: multimodal dataset: name: Science-QA type: science-qa metrics: - type: accuracy value: 96.0 name: accuracy verified: true - task: type: multimodal dataset: name: ImageDC type: imagedc metrics: - type: accuracy value: 88.9 name: accuracy verified: true - task: type: multimodal dataset: name: MMLBench type: mmlbench metrics: - type: accuracy value: 77.1 name: accuracy verified: true - task: type: multimodal dataset: name: RealWorldQA type: realworldqa metrics: - type: accuracy value: 66.3 name: accuracy verified: true - task: type: multimodal dataset: name: Vibe-Eval type: vibe-eval metrics: - type: accuracy value: 51.7 name: accuracy verified: true - task: type: multimodal dataset: name: LLaVA-W type: llava-w metrics: - type: accuracy value: 90.7 name: accuracy verified: true - task: type: multimodal dataset: name: LLaVA-Wilder type: l-wilder metrics: - type: accuracy value: 67.8 name: accuracy verified: true - task: type: multimodal dataset: name: ActNet-QA type: actnet-qa metrics: - type: accuracy value: 56.6 name: accuracy verified: true - task: type: multimodal dataset: name: EgoSchema type: egoschema metrics: - type: accuracy value: 60.1 name: accuracy verified: true - task: type: multimodal dataset: name: MLVU type: mlvu metrics: - type: accuracy value: 64.7 name: accuracy verified: true - task: type: multimodal dataset: name: MVBench type: mvbench metrics: - type: accuracy value: 56.7 name: accuracy verified: true - task: type: multimodal dataset: name: NextQA type: nextqa metrics: - type: accuracy value: 79.4 name: accuracy verified: true - task: type: multimodal dataset: name: PercepTest type: percepTest metrics: - type: accuracy value: 49.7 name: accuracy verified: true - task: type: multimodal dataset: name: SeedBench type: seedbench metrics: - type: accuracy value: 56.9 name: accuracy verified: true - task: type: multimodal dataset: name: VideoChatGPT type: videochatgpt metrics: - type: score value: 3.49 name: score verified: true - task: type: multimodal dataset: name: VideoDC type: videodc metrics: - type: score value: 3.75 name: score verified: true - task: type: multimodal dataset: name: VideoMME type: videomme metrics: - type: accuracy value: 58.2 name: accuracy verified: true --- # LLaVA-OneVision  Play with the model on the [LLaVA OneVision Chat](https://llava-onevision.lmms-lab.com/). ## Table of Contents 1. [Model Summary](##model-summary) 2. [Use](##use) 3. [Limitations](##limitations) 4. [Training](##training) 5. [License](##license) 6. [Citation](##citation) ## Model Summary The LLaVA-OneVision models are 0.5/7/72B parameter models trained on [LLaVA-OneVision](https://huggingface.co/datasets/lmms-lab/LLaVA-OneVision-Data), based on Qwen2 language model with a context window of 32K tokens. - **Repository:** [LLaVA-VL/LLaVA-NeXT](https://github.com/LLaVA-VL/LLaVA-NeXT?tab=readme-ov-file) - **Project Website:** [llava-onevision.lmms-lab.com](llava-onevision.lmms-lab.com) - **Paper:** [LLaVA-OneVision](arxiv.org/abs/2408.03326) - **Point of Contact:** [Bo Li](mailto:drluodian@gmail.com) - **Languages:** English, Chinese ## Use ### Intended use The model was trained on [LLaVA-OneVision Dataset](https://huggingface.co/datasets/lmms-lab/LLaVA-OneVision-Data) and have the ability to interact with images, multi-image and videos. **Feel free to share your generations in the Community tab!** ### Generation We provide the simple generation process for using our model. For more details, you could refer to [Github](https://github.com/LLaVA-VL/LLaVA-NeXT). ```python # pip install git+https://github.com/LLaVA-VL/LLaVA-NeXT.git from llava.model.builder import load_pretrained_model from llava.mm_utils import get_model_name_from_path, process_images, tokenizer_image_token from llava.constants import IMAGE_TOKEN_INDEX, DEFAULT_IMAGE_TOKEN, DEFAULT_IM_START_TOKEN, DEFAULT_IM_END_TOKEN, IGNORE_INDEX from llava.conversation import conv_templates, SeparatorStyle from PIL import Image import requests import copy import torch import sys import warnings warnings.filterwarnings("ignore") pretrained = "lmms-lab/llava-onevision-qwen2-7b-ov" model_name = "llava_qwen" device = "cuda" device_map = "auto" tokenizer, model, image_processor, max_length = load_pretrained_model(pretrained, None, model_name, device_map=device_map) # Add any other thing you want to pass in llava_model_args model.eval() url = "https://github.com/haotian-liu/LLaVA/blob/1a91fc274d7c35a9b50b3cb29c4247ae5837ce39/images/llava_v1_5_radar.jpg?raw=true" image = Image.open(requests.get(url, stream=True).raw) image_tensor = process_images([image], image_processor, model.config) image_tensor = [_image.to(dtype=torch.float16, device=device) for _image in image_tensor] conv_template = "qwen_1_5" # Make sure you use correct chat template for different models question = DEFAULT_IMAGE_TOKEN + "\nWhat is shown in this image?" conv = copy.deepcopy(conv_templates[conv_template]) conv.append_message(conv.roles[0], question) conv.append_message(conv.roles[1], None) prompt_question = conv.get_prompt() input_ids = tokenizer_image_token(prompt_question, tokenizer, IMAGE_TOKEN_INDEX, return_tensors="pt").unsqueeze(0).to(device) image_sizes = [image.size] cont = model.generate( input_ids, images=image_tensor, image_sizes=image_sizes, do_sample=False, temperature=0, max_new_tokens=4096, ) text_outputs = tokenizer.batch_decode(cont, skip_special_tokens=True) print(text_outputs) ``` # Training ## Model - **Architecture:** SO400M + Qwen2 - **Pretraining Stage:** LCS-558K, 1 epoch, projector - **Mid Stage:** A mixture of 4.7M high-quality synthetic data, 1 epoch, full model - **Final-Image Stage:** A mixture of 3.6M single-image data, 1 epoch, full model - **OneVision Stage:** A mixture of 1.6M single-image/multi-image/video data, 1 epoch, full model - **Precision:** bfloat16 ## Hardware & Software - **GPUs:** 256 * Nvidia Tesla A100 (for whole model series training) - **Orchestration:** [Huggingface Trainer](https://huggingface.co/docs/transformers/main_classes/trainer) - **Neural networks:** [PyTorch](https://github.com/pytorch/pytorch) # Citation ``` @article{li2024llavaonevision, title={LLaVA-OneVision}, } ```

tohoku-nlp/bert-base-japanese-char-v2

tohoku-nlp

transformers

fill-mask

--- language: ja license: cc-by-sa-4.0 datasets: - wikipedia widget: - text: 東北大学で[MASK]の研究をしています。 --- # BERT base Japanese (character-level tokenization with whole word masking, jawiki-20200831) This is a [BERT](https://github.com/google-research/bert) model pretrained on texts in the Japanese language. This version of the model processes input texts with word-level tokenization based on the Unidic 2.1.2 dictionary (available in [unidic-lite](https://pypi.org/project/unidic-lite/) package), followed by character-level tokenization. Additionally, the model is trained with the whole word masking enabled for the masked language modeling (MLM) objective. The codes for the pretraining are available at [cl-tohoku/bert-japanese](https://github.com/cl-tohoku/bert-japanese/tree/v2.0). ## Model architecture The model architecture is the same as the original BERT base model; 12 layers, 768 dimensions of hidden states, and 12 attention heads. ## Training Data The models are trained on the Japanese version of Wikipedia. The training corpus is generated from the Wikipedia Cirrussearch dump file as of August 31, 2020. The generated corpus files are 4.0GB in total, containing approximately 30M sentences. We used the [MeCab](https://taku910.github.io/mecab/) morphological parser with [mecab-ipadic-NEologd](https://github.com/neologd/mecab-ipadic-neologd) dictionary to split texts into sentences. ## Tokenization The texts are first tokenized by MeCab with the Unidic 2.1.2 dictionary and then split into characters. The vocabulary size is 6144. We used [`fugashi`](https://github.com/polm/fugashi) and [`unidic-lite`](https://github.com/polm/unidic-lite) packages for the tokenization. ## Training The models are trained with the same configuration as the original BERT; 512 tokens per instance, 256 instances per batch, and 1M training steps. For training of the MLM (masked language modeling) objective, we introduced whole word masking in which all of the subword tokens corresponding to a single word (tokenized by MeCab) are masked at once. For training of each model, we used a v3-8 instance of Cloud TPUs provided by [TensorFlow Research Cloud program](https://www.tensorflow.org/tfrc/). The training took about 5 days to finish. ## Licenses The pretrained models are distributed under the terms of the [Creative Commons Attribution-ShareAlike 3.0](https://creativecommons.org/licenses/by-sa/3.0/). ## Acknowledgments This model is trained with Cloud TPUs provided by [TensorFlow Research Cloud](https://www.tensorflow.org/tfrc/) program.

timm/efficientnet_b1.ra4_e3600_r240_in1k

timm

timm

image-classification

--- tags: - image-classification - timm library_name: timm license: apache-2.0 datasets: - imagenet-1k --- # Model card for efficientnet_b1.ra4_e3600_r240_in1k A EfficientNet image classification model. Trained on ImageNet-1k by Ross Wightman. Trained with `timm` scripts using hyper-parameters inspired by the MobileNet-V4 small, mixed with go-to hparams from `timm` and "ResNet Strikes Back". A collection of hparams (timm .yaml config files) for this training series can be found here: https://gist.github.com/rwightman/f6705cb65c03daeebca8aa129b1b94ad ## Model Details - **Model Type:** Image classification / feature backbone - **Model Stats:** - Params (M): 7.8 - GMACs: 0.7 - Activations (M): 10.9 - Image size: train = 240 x 240, test = 288 x 288 - **Dataset:** ImageNet-1k - **Papers:** - PyTorch Image Models: https://github.com/huggingface/pytorch-image-models - EfficientNet: Rethinking Model Scaling for Convolutional Neural Networks: https://arxiv.org/abs/1905.11946 - MobileNetV4 -- Universal Models for the Mobile Ecosystem: https://arxiv.org/abs/2404.10518 ## Model Usage ### Image Classification ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model('efficientnet_b1.ra4_e3600_r240_in1k', pretrained=True) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 top5_probabilities, top5_class_indices = torch.topk(output.softmax(dim=1) * 100, k=5) ``` ### Feature Map Extraction ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'efficientnet_b1.ra4_e3600_r240_in1k', pretrained=True, features_only=True, ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # unsqueeze single image into batch of 1 for o in output: # print shape of each feature map in output # e.g.: # torch.Size([1, 16, 120, 120]) # torch.Size([1, 24, 60, 60]) # torch.Size([1, 40, 30, 30]) # torch.Size([1, 112, 15, 15]) # torch.Size([1, 320, 8, 8]) print(o.shape) ``` ### Image Embeddings ```python from urllib.request import urlopen from PIL import Image import timm img = Image.open(urlopen( 'https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/beignets-task-guide.png' )) model = timm.create_model( 'efficientnet_b1.ra4_e3600_r240_in1k', pretrained=True, num_classes=0, # remove classifier nn.Linear ) model = model.eval() # get model specific transforms (normalization, resize) data_config = timm.data.resolve_model_data_config(model) transforms = timm.data.create_transform(**data_config, is_training=False) output = model(transforms(img).unsqueeze(0)) # output is (batch_size, num_features) shaped tensor # or equivalently (without needing to set num_classes=0) output = model.forward_features(transforms(img).unsqueeze(0)) # output is unpooled, a (1, 1280, 8, 8) shaped tensor output = model.forward_head(output, pre_logits=True) # output is a (1, num_features) shaped tensor ``` ## Model Comparison ### By Top-1 | model | top1 | top5 | param_count | img_size | |--------------------------------------------------------------------------------------------------------------------------|--------|--------|-------------|----------| | [mobilenetv4_conv_aa_large.e230_r448_in12k_ft_in1k](http://hf.co/timm/mobilenetv4_conv_aa_large.e230_r448_in12k_ft_in1k) | 84.99 | 97.294 | 32.59 | 544 | | [mobilenetv4_conv_aa_large.e230_r384_in12k_ft_in1k](http://hf.co/timm/mobilenetv4_conv_aa_large.e230_r384_in12k_ft_in1k) | 84.772 | 97.344 | 32.59 | 480 | | [mobilenetv4_conv_aa_large.e230_r448_in12k_ft_in1k](http://hf.co/timm/mobilenetv4_conv_aa_large.e230_r448_in12k_ft_in1k) | 84.64 | 97.114 | 32.59 | 448 | | [mobilenetv4_hybrid_large.ix_e600_r384_in1k](http://hf.co/timm/mobilenetv4_hybrid_large.ix_e600_r384_in1k) | 84.356 | 96.892 | 37.76 | 448 | | [mobilenetv4_conv_aa_large.e230_r384_in12k_ft_in1k](http://hf.co/timm/mobilenetv4_conv_aa_large.e230_r384_in12k_ft_in1k) | 84.314 | 97.102 | 32.59 | 384 | | [mobilenetv4_hybrid_large.e600_r384_in1k](http://hf.co/timm/mobilenetv4_hybrid_large.e600_r384_in1k) | 84.266 | 96.936 | 37.76 | 448 | | [mobilenetv4_hybrid_large.ix_e600_r384_in1k](http://hf.co/timm/mobilenetv4_hybrid_large.ix_e600_r384_in1k) | 83.990 | 96.702 | 37.76 | 384 | | [mobilenetv4_conv_aa_large.e600_r384_in1k](http://hf.co/timm/mobilenetv4_conv_aa_large.e600_r384_in1k) | 83.824 | 96.734 | 32.59 | 480 | | [mobilenetv4_hybrid_large.e600_r384_in1k](http://hf.co/timm/mobilenetv4_hybrid_large.e600_r384_in1k) | 83.800 | 96.770 | 37.76 | 384 | | [mobilenetv4_hybrid_medium.ix_e550_r384_in1k](http://hf.co/timm/mobilenetv4_hybrid_medium.ix_e550_r384_in1k) | 83.394 | 96.760 | 11.07 | 448 | | [mobilenetv4_conv_large.e600_r384_in1k](http://hf.co/timm/mobilenetv4_conv_large.e600_r384_in1k) | 83.392 | 96.622 | 32.59 | 448 | | [mobilenetv4_conv_aa_large.e600_r384_in1k](http://hf.co/timm/mobilenetv4_conv_aa_large.e600_r384_in1k) | 83.244 | 96.392 | 32.59 | 384 | | [mobilenetv4_hybrid_medium.e200_r256_in12k_ft_in1k](http://hf.co/timm/mobilenetv4_hybrid_medium.e200_r256_in12k_ft_in1k) | 82.99 | 96.67 | 11.07 | 320 | | [mobilenetv4_hybrid_medium.ix_e550_r384_in1k](http://hf.co/timm/mobilenetv4_hybrid_medium.ix_e550_r384_in1k) | 82.968 | 96.474 | 11.07 | 384 | | [mobilenetv4_conv_large.e600_r384_in1k](http://hf.co/timm/mobilenetv4_conv_large.e600_r384_in1k) | 82.952 | 96.266 | 32.59 | 384 | | [mobilenetv4_conv_large.e500_r256_in1k](http://hf.co/timm/mobilenetv4_conv_large.e500_r256_in1k) | 82.674 | 96.31 | 32.59 | 320 | | [mobilenetv4_hybrid_medium.ix_e550_r256_in1k](http://hf.co/timm/mobilenetv4_hybrid_medium.ix_e550_r256_in1k) | 82.492 | 96.278 | 11.07 | 320 | | [mobilenetv4_hybrid_medium.e200_r256_in12k_ft_in1k](http://hf.co/timm/mobilenetv4_hybrid_medium.e200_r256_in12k_ft_in1k) | 82.364 | 96.256 | 11.07 | 256 | | [mobilenetv4_conv_large.e500_r256_in1k](http://hf.co/timm/mobilenetv4_conv_large.e500_r256_in1k) | 81.862 | 95.69 | 32.59 | 256 | | [resnet50d.ra4_e3600_r224_in1k](http://hf.co/timm/resnet50d.ra4_e3600_r224_in1k) | 81.838 | 95.922 | 25.58 | 288 | | [mobilenetv3_large_150d.ra4_e3600_r256_in1k](http://hf.co/timm/mobilenetv3_large_150d.ra4_e3600_r256_in1k) | 81.806 | 95.9 | 14.62 | 320 | | [mobilenetv4_hybrid_medium.ix_e550_r256_in1k](http://hf.co/timm/mobilenetv4_hybrid_medium.ix_e550_r256_in1k) | 81.446 | 95.704 | 11.07 | 256 | | [efficientnet_b1.ra4_e3600_r240_in1k](http://hf.co/timm/efficientnet_b1.ra4_e3600_r240_in1k) | 81.440 | 95.700 | 7.79 | 288 | | [mobilenetv4_hybrid_medium.e500_r224_in1k](http://hf.co/timm/mobilenetv4_hybrid_medium.e500_r224_in1k) | 81.276 | 95.742 | 11.07 | 256 | | [resnet50d.ra4_e3600_r224_in1k](http://hf.co/timm/resnet50d.ra4_e3600_r224_in1k) | 80.952 | 95.384 | 25.58 | 224 | | [mobilenetv3_large_150d.ra4_e3600_r256_in1k](http://hf.co/timm/mobilenetv3_large_150d.ra4_e3600_r256_in1k) | 80.944 | 95.448 | 14.62 | 256 | | [mobilenetv4_conv_medium.e500_r256_in1k](http://hf.co/timm/mobilenetv4_conv_medium.e500_r256_in1k) | 80.858 | 95.768 | 9.72 | 320 | | [mobilenet_edgetpu_v2_m.ra4_e3600_r224_in1k](http://hf.co/timm/mobilenet_edgetpu_v2_m.ra4_e3600_r224_in1k) | 80.680 | 95.442 | 8.46 | 256 | | [mobilenetv4_hybrid_medium.e500_r224_in1k](http://hf.co/timm/mobilenetv4_hybrid_medium.e500_r224_in1k) | 80.442 | 95.38 | 11.07 | 224 | | [efficientnet_b1.ra4_e3600_r240_in1k](http://hf.co/timm/efficientnet_b1.ra4_e3600_r240_in1k) | 80.406 | 95.152 | 7.79 | 240 | | [mobilenetv4_conv_blur_medium.e500_r224_in1k](http://hf.co/timm/mobilenetv4_conv_blur_medium.e500_r224_in1k) | 80.142 | 95.298 | 9.72 | 256 | | [mobilenet_edgetpu_v2_m.ra4_e3600_r224_in1k](http://hf.co/timm/mobilenet_edgetpu_v2_m.ra4_e3600_r224_in1k) | 80.130 | 95.002 | 8.46 | 224 | | [mobilenetv4_conv_medium.e500_r256_in1k](http://hf.co/timm/mobilenetv4_conv_medium.e500_r256_in1k) | 79.928 | 95.184 | 9.72 | 256 | | [mobilenetv4_conv_medium.e500_r224_in1k](http://hf.co/timm/mobilenetv4_conv_medium.e500_r224_in1k) | 79.808 | 95.186 | 9.72 | 256 | | [resnetv2_34d.ra4_e3600_r224_in1k](http://hf.co/timm/resnetv2_34d.ra4_e3600_r224_in1k) | 79.590 | 94.770 | 21.82 | 288 | | [mobilenetv4_conv_blur_medium.e500_r224_in1k](http://hf.co/timm/mobilenetv4_conv_blur_medium.e500_r224_in1k) | 79.438 | 94.932 | 9.72 | 224 | | [efficientnet_b0.ra4_e3600_r224_in1k](http://hf.co/timm/efficientnet_b0.ra4_e3600_r224_in1k) | 79.364 | 94.754 | 5.29 | 256 | | [mobilenetv4_conv_medium.e500_r224_in1k](http://hf.co/timm/mobilenetv4_conv_medium.e500_r224_in1k) | 79.094 | 94.77 | 9.72 | 224 | | [resnetv2_34.ra4_e3600_r224_in1k](http://hf.co/timm/resnetv2_34.ra4_e3600_r224_in1k) | 79.072 | 94.566 | 21.80 | 288 | | [resnet34.ra4_e3600_r224_in1k](http://hf.co/timm/resnet34.ra4_e3600_r224_in1k) | 78.952 | 94.450 | 21.80 | 288 | | [efficientnet_b0.ra4_e3600_r224_in1k](http://hf.co/timm/efficientnet_b0.ra4_e3600_r224_in1k) | 78.584 | 94.338 | 5.29 | 224 | | [resnetv2_34d.ra4_e3600_r224_in1k](http://hf.co/timm/resnetv2_34d.ra4_e3600_r224_in1k) | 78.268 | 93.952 | 21.82 | 224 | | [resnetv2_34.ra4_e3600_r224_in1k](http://hf.co/timm/resnetv2_34.ra4_e3600_r224_in1k) | 77.636 | 93.528 | 21.80 | 224 | | [mobilenetv1_125.ra4_e3600_r224_in1k](http://hf.co/timm/mobilenetv1_125.ra4_e3600_r224_in1k) | 77.600 | 93.804 | 6.27 | 256 | | [resnet34.ra4_e3600_r224_in1k](http://hf.co/timm/resnet34.ra4_e3600_r224_in1k) | 77.448 | 93.502 | 21.80 | 224 | | [mobilenetv3_large_100.ra4_e3600_r224_in1k](http://hf.co/timm/mobilenetv3_large_100.ra4_e3600_r224_in1k) | 77.164 | 93.336 | 5.48 | 256 | | [mobilenetv1_125.ra4_e3600_r224_in1k](http://hf.co/timm/mobilenetv1_125.ra4_e3600_r224_in1k) | 76.924 | 93.234 | 6.27 | 224 | | [mobilenetv1_100h.ra4_e3600_r224_in1k](http://hf.co/timm/mobilenetv1_100h.ra4_e3600_r224_in1k) | 76.596 | 93.272 | 5.28 | 256 | | [mobilenetv3_large_100.ra4_e3600_r224_in1k](http://hf.co/timm/mobilenetv3_large_100.ra4_e3600_r224_in1k) | 76.310 | 92.846 | 5.48 | 224 | | [mobilenetv1_100.ra4_e3600_r224_in1k](http://hf.co/timm/mobilenetv1_100.ra4_e3600_r224_in1k) | 76.094 | 93.004 | 4.23 | 256 | | [resnetv2_18d.ra4_e3600_r224_in1k](http://hf.co/timm/resnetv2_18d.ra4_e3600_r224_in1k) | 76.044 | 93.020 | 11.71 | 288 | | [resnet18d.ra4_e3600_r224_in1k](http://hf.co/timm/resnet18d.ra4_e3600_r224_in1k) | 76.024 | 92.780 | 11.71 | 288 | | [mobilenetv1_100h.ra4_e3600_r224_in1k](http://hf.co/timm/mobilenetv1_100h.ra4_e3600_r224_in1k) | 75.662 | 92.504 | 5.28 | 224 | | [mobilenetv1_100.ra4_e3600_r224_in1k](http://hf.co/timm/mobilenetv1_100.ra4_e3600_r224_in1k) | 75.382 | 92.312 | 4.23 | 224 | | [resnetv2_18.ra4_e3600_r224_in1k](http://hf.co/timm/resnetv2_18.ra4_e3600_r224_in1k) | 75.340 | 92.678 | 11.69 | 288 | | [mobilenetv4_conv_small.e2400_r224_in1k](http://hf.co/timm/mobilenetv4_conv_small.e2400_r224_in1k) | 74.616 | 92.072 | 3.77 | 256 | | [resnetv2_18d.ra4_e3600_r224_in1k](http://hf.co/timm/resnetv2_18d.ra4_e3600_r224_in1k) | 74.412 | 91.936 | 11.71 | 224 | | [resnet18d.ra4_e3600_r224_in1k](http://hf.co/timm/resnet18d.ra4_e3600_r224_in1k) | 74.322 | 91.832 | 11.71 | 224 | | [mobilenetv4_conv_small.e1200_r224_in1k](http://hf.co/timm/mobilenetv4_conv_small.e1200_r224_in1k) | 74.292 | 92.116 | 3.77 | 256 | | [mobilenetv4_conv_small.e2400_r224_in1k](http://hf.co/timm/mobilenetv4_conv_small.e2400_r224_in1k) | 73.756 | 91.422 | 3.77 | 224 | | [resnetv2_18.ra4_e3600_r224_in1k](http://hf.co/timm/resnetv2_18.ra4_e3600_r224_in1k) | 73.578 | 91.352 | 11.69 | 224 | | [mobilenetv4_conv_small.e1200_r224_in1k](http://hf.co/timm/mobilenetv4_conv_small.e1200_r224_in1k) | 73.454 | 91.34 | 3.77 | 224 | | [mobilenetv4_conv_small_050.e3000_r224_in1k](http://hf.co/timm/mobilenetv4_conv_small_050.e3000_r224_in1k) | 65.810 | 86.424 | 2.24 | 256 | | [mobilenetv4_conv_small_050.e3000_r224_in1k](http://hf.co/timm/mobilenetv4_conv_small_050.e3000_r224_in1k) | 64.762 | 85.514 | 2.24 | 224 | ## Citation ```bibtex @misc{rw2019timm, author = {Ross Wightman}, title = {PyTorch Image Models}, year = {2019}, publisher = {GitHub}, journal = {GitHub repository}, doi = {10.5281/zenodo.4414861}, howpublished = {\url{https://github.com/huggingface/pytorch-image-models}} } ``` ```bibtex @inproceedings{tan2019efficientnet, title={Efficientnet: Rethinking model scaling for convolutional neural networks}, author={Tan, Mingxing and Le, Quoc}, booktitle={International conference on machine learning}, pages={6105--6114}, year={2019}, organization={PMLR} } ``` ```bibtex @article{qin2024mobilenetv4, title={MobileNetV4-Universal Models for the Mobile Ecosystem}, author={Qin, Danfeng and Leichner, Chas and Delakis, Manolis and Fornoni, Marco and Luo, Shixin and Yang, Fan and Wang, Weijun and Banbury, Colby and Ye, Chengxi and Akin, Berkin and others}, journal={arXiv preprint arXiv:2404.10518}, year={2024} } ```

microsoft/Florence-2-base-ft

microsoft

transformers

image-text-to-text

--- license: mit license_link: https://huggingface.co/microsoft/Florence-2-base-ft/resolve/main/LICENSE pipeline_tag: image-text-to-text tags: - vision --- # Florence-2: Advancing a Unified Representation for a Variety of Vision Tasks ## Model Summary This Hub repository contains a HuggingFace's `transformers` implementation of Florence-2 model from Microsoft. Florence-2 is an advanced vision foundation model that uses a prompt-based approach to handle a wide range of vision and vision-language tasks. Florence-2 can interpret simple text prompts to perform tasks like captioning, object detection, and segmentation. It leverages our FLD-5B dataset, containing 5.4 billion annotations across 126 million images, to master multi-task learning. The model's sequence-to-sequence architecture enables it to excel in both zero-shot and fine-tuned settings, proving to be a competitive vision foundation model. Resources and Technical Documentation: + [Florence-2 technical report](https://arxiv.org/abs/2311.06242). + [Jupyter Notebook for inference and visualization of Florence-2-large model](https://huggingface.co/microsoft/Florence-2-large/blob/main/sample_inference.ipynb) | Model | Model size | Model Description | | ------- | ------------- | ------------- | | Florence-2-base[[HF]](https://huggingface.co/microsoft/Florence-2-base) | 0.23B | Pretrained model with FLD-5B | Florence-2-large[[HF]](https://huggingface.co/microsoft/Florence-2-large) | 0.77B | Pretrained model with FLD-5B | Florence-2-base-ft[[HF]](https://huggingface.co/microsoft/Florence-2-base-ft) | 0.23B | Finetuned model on a colletion of downstream tasks | Florence-2-large-ft[[HF]](https://huggingface.co/microsoft/Florence-2-large-ft) | 0.77B | Finetuned model on a colletion of downstream tasks ## How to Get Started with the Model Use the code below to get started with the model. All models are trained with float16. ```python import requests from PIL import Image from transformers import AutoProcessor, AutoModelForCausalLM device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 model = AutoModelForCausalLM.from_pretrained("microsoft/Florence-2-base-ft", torch_dtype=torch_dtype, trust_remote_code=True).to(device) processor = AutoProcessor.from_pretrained("microsoft/Florence-2-base-ft", trust_remote_code=True) prompt = "<OD>" url = "https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/tasks/car.jpg?download=true" image = Image.open(requests.get(url, stream=True).raw) inputs = processor(text=prompt, images=image, return_tensors="pt").to(device, torch_dtype) generated_ids = model.generate( input_ids=inputs["input_ids"], pixel_values=inputs["pixel_values"], max_new_tokens=1024, do_sample=False, num_beams=3 ) generated_text = processor.batch_decode(generated_ids, skip_special_tokens=False)[0] parsed_answer = processor.post_process_generation(generated_text, task="<OD>", image_size=(image.width, image.height)) print(parsed_answer) ``` ## Tasks This model is capable of performing different tasks through changing the prompts. First, let's define a function to run a prompt. <details> <summary> Click to expand </summary> ```python import requests from PIL import Image from transformers import AutoProcessor, AutoModelForCausalLM device = "cuda:0" if torch.cuda.is_available() else "cpu" torch_dtype = torch.float16 if torch.cuda.is_available() else torch.float32 model = AutoModelForCausalLM.from_pretrained("microsoft/Florence-2-base-ft", torch_dtype=torch_dtype, trust_remote_code=True).to(device) processor = AutoProcessor.from_pretrained("microsoft/Florence-2-base-ft", trust_remote_code=True) url = "https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/tasks/car.jpg?download=true" image = Image.open(requests.get(url, stream=True).raw) def run_example(task_prompt, text_input=None): if text_input is None: prompt = task_prompt else: prompt = task_prompt + text_input inputs = processor(text=prompt, images=image, return_tensors="pt").to(device, torch_dtype) generated_ids = model.generate( input_ids=inputs["input_ids"], pixel_values=inputs["pixel_values"], max_new_tokens=1024, num_beams=3 ) generated_text = processor.batch_decode(generated_ids, skip_special_tokens=False)[0] parsed_answer = processor.post_process_generation(generated_text, task=task_prompt, image_size=(image.width, image.height)) print(parsed_answer) ``` </details> Here are the tasks `Florence-2` could perform: <details> <summary> Click to expand </summary> ### Caption ```python prompt = "<CAPTION>" run_example(prompt) ``` ### Detailed Caption ```python prompt = "<DETAILED_CAPTION>" run_example(prompt) ``` ### More Detailed Caption ```python prompt = "<MORE_DETAILED_CAPTION>" run_example(prompt) ``` ### Caption to Phrase Grounding caption to phrase grounding task requires additional text input, i.e. caption. Caption to phrase grounding results format: {'\<CAPTION_TO_PHRASE_GROUNDING>': {'bboxes': [[x1, y1, x2, y2], ...], 'labels': ['', '', ...]}} ```python task_prompt = '<CAPTION_TO_PHRASE_GROUNDING>" results = run_example(task_prompt, text_input="A green car parked in front of a yellow building.") ``` ### Object Detection OD results format: {'\<OD>': {'bboxes': [[x1, y1, x2, y2], ...], 'labels': ['label1', 'label2', ...]} } ```python prompt = "<OD>" run_example(prompt) ``` ### Dense Region Caption Dense region caption results format: {'\<DENSE_REGION_CAPTION>' : {'bboxes': [[x1, y1, x2, y2], ...], 'labels': ['label1', 'label2', ...]} } ```python prompt = "<DENSE_REGION_CAPTION>" run_example(prompt) ``` ### Region proposal Dense region caption results format: {'\<REGION_PROPOSAL>': {'bboxes': [[x1, y1, x2, y2], ...], 'labels': ['', '', ...]}} ```python prompt = "<REGION_PROPOSAL>" run_example(prompt) ``` ### OCR ```python prompt = "<OCR>" run_example(prompt) ``` ### OCR with Region OCR with region output format: {'\<OCR_WITH_REGION>': {'quad_boxes': [[x1, y1, x2, y2, x3, y3, x4, y4], ...], 'labels': ['text1', ...]}} ```python prompt = "<OCR_WITH_REGION>" run_example(prompt) ``` for More detailed examples, please refer to [notebook](https://huggingface.co/microsoft/Florence-2-large/blob/main/sample_inference.ipynb) </details> # Benchmarks ## Florence-2 Zero-shot performance The following table presents the zero-shot performance of generalist vision foundation models on image captioning and object detection evaluation tasks. These models have not been exposed to the training data of the evaluation tasks during their training phase. | Method | #params | COCO Cap. test CIDEr | NoCaps val CIDEr | TextCaps val CIDEr | COCO Det. val2017 mAP | |--------|---------|----------------------|------------------|--------------------|-----------------------| | Flamingo | 80B | 84.3 | - | - | - | | Florence-2-base| 0.23B | 133.0 | 118.7 | 70.1 | 34.7 | | Florence-2-large| 0.77B | 135.6 | 120.8 | 72.8 | 37.5 | The following table continues the comparison with performance on other vision-language evaluation tasks. | Method | Flickr30k test R@1 | Refcoco val Accuracy | Refcoco test-A Accuracy | Refcoco test-B Accuracy | Refcoco+ val Accuracy | Refcoco+ test-A Accuracy | Refcoco+ test-B Accuracy | Refcocog val Accuracy | Refcocog test Accuracy | Refcoco RES val mIoU | |--------|----------------------|----------------------|-------------------------|-------------------------|-----------------------|--------------------------|--------------------------|-----------------------|------------------------|----------------------| | Kosmos-2 | 78.7 | 52.3 | 57.4 | 47.3 | 45.5 | 50.7 | 42.2 | 60.6 | 61.7 | - | | Florence-2-base | 83.6 | 53.9 | 58.4 | 49.7 | 51.5 | 56.4 | 47.9 | 66.3 | 65.1 | 34.6 | | Florence-2-large | 84.4 | 56.3 | 61.6 | 51.4 | 53.6 | 57.9 | 49.9 | 68.0 | 67.0 | 35.8 | ## Florence-2 finetuned performance We finetune Florence-2 models with a collection of downstream tasks, resulting two generalist models *Florence-2-base-ft* and *Florence-2-large-ft* that can conduct a wide range of downstream tasks. The table below compares the performance of specialist and generalist models on various captioning and Visual Question Answering (VQA) tasks. Specialist models are fine-tuned specifically for each task, whereas generalist models are fine-tuned in a task-agnostic manner across all tasks. The symbol "▲" indicates the usage of external OCR as input. | Method | # Params | COCO Caption Karpathy test CIDEr | NoCaps val CIDEr | TextCaps val CIDEr | VQAv2 test-dev Acc | TextVQA test-dev Acc | VizWiz VQA test-dev Acc | |----------------|----------|-----------------------------------|------------------|--------------------|--------------------|----------------------|-------------------------| | **Specialist Models** | | | | | | | | | CoCa | 2.1B | 143.6 | 122.4 | - | 82.3 | - | - | | BLIP-2 | 7.8B | 144.5 | 121.6 | - | 82.2 | - | - | | GIT2 | 5.1B | 145.0 | 126.9 | 148.6 | 81.7 | 67.3 | 71.0 | | Flamingo | 80B | 138.1 | - | - | 82.0 | 54.1 | 65.7 | | PaLI | 17B | 149.1 | 127.0 | 160.0▲ | 84.3 | 58.8 / 73.1▲ | 71.6 / 74.4▲ | | PaLI-X | 55B | 149.2 | 126.3 | 147.0 / 163.7▲ | 86.0 | 71.4 / 80.8▲ | 70.9 / 74.6▲ | | **Generalist Models** | | | | | | | | | Unified-IO | 2.9B | - | 100.0 | - | 77.9 | - | 57.4 | | Florence-2-base-ft | 0.23B | 140.0 | 116.7 | 143.9 | 79.7 | 63.6 | 63.6 | | Florence-2-large-ft | 0.77B | 143.3 | 124.9 | 151.1 | 81.7 | 73.5 | 72.6 | | Method | # Params | COCO Det. val2017 mAP | Flickr30k test R@1 | RefCOCO val Accuracy | RefCOCO test-A Accuracy | RefCOCO test-B Accuracy | RefCOCO+ val Accuracy | RefCOCO+ test-A Accuracy | RefCOCO+ test-B Accuracy | RefCOCOg val Accuracy | RefCOCOg test Accuracy | RefCOCO RES val mIoU | |----------------------|----------|-----------------------|--------------------|----------------------|-------------------------|-------------------------|------------------------|---------------------------|---------------------------|------------------------|-----------------------|------------------------| | **Specialist Models** | | | | | | | | | | | | | | SeqTR | - | - | - | 83.7 | 86.5 | 81.2 | 71.5 | 76.3 | 64.9 | 74.9 | 74.2 | - | | PolyFormer | - | - | - | 90.4 | 92.9 | 87.2 | 85.0 | 89.8 | 78.0 | 85.8 | 85.9 | 76.9 | | UNINEXT | 0.74B | 60.6 | - | 92.6 | 94.3 | 91.5 | 85.2 | 89.6 | 79.8 | 88.7 | 89.4 | - | | Ferret | 13B | - | - | 89.5 | 92.4 | 84.4 | 82.8 | 88.1 | 75.2 | 85.8 | 86.3 | - | | **Generalist Models** | | | | | | | | | | | | | | UniTAB | - | - | - | 88.6 | 91.1 | 83.8 | 81.0 | 85.4 | 71.6 | 84.6 | 84.7 | - | | Florence-2-base-ft | 0.23B | 41.4 | 84.0 | 92.6 | 94.8 | 91.5 | 86.8 | 91.7 | 82.2 | 89.8 | 82.2 | 78.0 | | Florence-2-large-ft| 0.77B | 43.4 | 85.2 | 93.4 | 95.3 | 92.0 | 88.3 | 92.9 | 83.6 | 91.2 | 91.7 | 80.5 | ## BibTex and citation info ``` @article{xiao2023florence, title={Florence-2: Advancing a unified representation for a variety of vision tasks}, author={Xiao, Bin and Wu, Haiping and Xu, Weijian and Dai, Xiyang and Hu, Houdong and Lu, Yumao and Zeng, Michael and Liu, Ce and Yuan, Lu}, journal={arXiv preprint arXiv:2311.06242}, year={2023} } ```

anton-l/wav2vec2-random-tiny-classifier

anton-l

transformers

audio-classification

Entry not found

naver/splade-v3

naver

transformers

fill-mask

--- license: cc-by-nc-sa-4.0 language: - en tags: - splade --- ## SPLADE-v3 #### SPLADE-v3 is the latest series of SPLADE models. This checkpoint corresponds to a model that starts from SPLADE++SelfDistil (`naver/splade-cocondenser-selfdistil`), and is trained with a mix of KL-Div and MarginMSE, with 8 negatives per query sampled from SPLADE++SelfDistil. We used the original MS MARCO collection **without the titles**. For more details, see our arXiv companion book: https://arxiv.org/abs/2403.06789 To use SPLADE, please visit our GitHub repository: https://github.com/naver/splade ## Performance | | MRR@10 (MS MARCO dev) | avg nDCG@10 (BEIR-13) | | --- | --- | --- | | `naver/splade-v3` | 40.2 | 51.7 | ## Citation If you use our checkpoint, please cite our work: ``` @misc{lassance2024spladev3, title={SPLADE-v3: New baselines for SPLADE}, author={Carlos Lassance and Hervé Déjean and Thibault Formal and Stéphane Clinchant}, year={2024}, eprint={2403.06789}, archivePrefix={arXiv}, primaryClass={cs.IR}, copyright = {Creative Commons Attribution Non Commercial Share Alike 4.0 International} } ```

LiheYoung/depth-anything-small-hf

LiheYoung

transformers

depth-estimation

--- license: apache-2.0 tags: - vision pipeline_tag: depth-estimation widget: - inference: false --- # Depth Anything (small-sized model, Transformers version) Depth Anything model. It was introduced in the paper [Depth Anything: Unleashing the Power of Large-Scale Unlabeled Data](https://arxiv.org/abs/2401.10891) by Lihe Yang et al. and first released in [this repository](https://github.com/LiheYoung/Depth-Anything). [Online demo](https://huggingface.co/spaces/LiheYoung/Depth-Anything) is also provided. Disclaimer: The team releasing Depth Anything did not write a model card for this model so this model card has been written by the Hugging Face team. ## Model description Depth Anything leverages the [DPT](https://huggingface.co/docs/transformers/model_doc/dpt) architecture with a [DINOv2](https://huggingface.co/docs/transformers/model_doc/dinov2) backbone. The model is trained on ~62 million images, obtaining state-of-the-art results for both relative and absolute depth estimation. <img src="https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/transformers/model_doc/depth_anything_overview.jpg" alt="drawing" width="600"/> <small> Depth Anything overview. Taken from the <a href="https://arxiv.org/abs/2401.10891">original paper</a>.</small> ## Intended uses & limitations You can use the raw model for tasks like zero-shot depth estimation. See the [model hub](https://huggingface.co/models?search=depth-anything) to look for other versions on a task that interests you. ### How to use Here is how to use this model to perform zero-shot depth estimation: ```python from transformers import pipeline from PIL import Image import requests # load pipe pipe = pipeline(task="depth-estimation", model="LiheYoung/depth-anything-small-hf") # load image url = 'http://images.cocodataset.org/val2017/000000039769.jpg' image = Image.open(requests.get(url, stream=True).raw) # inference depth = pipe(image)["depth"] ``` Alternatively, one can use the classes themselves: ```python from transformers import AutoImageProcessor, AutoModelForDepthEstimation import torch import numpy as np from PIL import Image import requests url = "http://images.cocodataset.org/val2017/000000039769.jpg" image = Image.open(requests.get(url, stream=True).raw) image_processor = AutoImageProcessor.from_pretrained("LiheYoung/depth-anything-small-hf") model = AutoModelForDepthEstimation.from_pretrained("LiheYoung/depth-anything-small-hf") # prepare image for the model inputs = image_processor(images=image, return_tensors="pt") with torch.no_grad(): outputs = model(**inputs) predicted_depth = outputs.predicted_depth # interpolate to original size prediction = torch.nn.functional.interpolate( predicted_depth.unsqueeze(1), size=image.size[::-1], mode="bicubic", align_corners=False, ) ``` For more code examples, we refer to the [documentation](https://huggingface.co/transformers/main/model_doc/depth_anything.html#). ### BibTeX entry and citation info ```bibtex @misc{yang2024depth, title={Depth Anything: Unleashing the Power of Large-Scale Unlabeled Data}, author={Lihe Yang and Bingyi Kang and Zilong Huang and Xiaogang Xu and Jiashi Feng and Hengshuang Zhao}, year={2024}, eprint={2401.10891}, archivePrefix={arXiv}, primaryClass={cs.CV} } ```

Salesforce/moirai-1.0-R-small

Salesforce

transformers

time-series-forecasting

--- license: cc-by-nc-4.0 pipeline_tag: time-series-forecasting tags: - time series - forecasting - pretrained models - foundation models - time series foundation models - time-series --- # Moirai-1.0-R-Small Moirai, the Masked Encoder-based Universal Time Series Forecasting Transformer is a Large Time Series Model pre-trained on [LOTSA data](https://huggingface.co/datasets/Salesforce/lotsa_data). For more details on the Moirai architecture, training, and results, please refer to the [paper](https://arxiv.org/abs/2402.02592). <p align="center"> <img src="figures/architecture.png" width="100%"> <br /> <span> Fig. 1: Overall architecture of Moirai. Visualized is a 3-variate time series, where variates 0 and 1 are target variables (i.e. to be forecasted, and variate 2 is a dynamic covariate (values in forecast horizon known). Based on a patch size of 64, each variate is patchified into 3 tokens. The patch embeddings along with sequence and variate id are fed into the Transformer. The shaded patches represent the forecast horizon to be forecasted, whose corresponding output representations are mapped into the mixture distribution parameters. </span> </p> ## Usage To perform inference with Moirai, install the uni2ts library from our [GitHub repo](https://github.com/SalesforceAIResearch/uni2ts). 1. Clone repository: ```shell git clone https://github.com/SalesforceAIResearch/uni2ts.git cd uni2ts ``` 2) Create virtual environment: ```shell virtualenv venv . venv/bin/activate ``` 3) Build from source: ```shell pip install -e '.[notebook]' ``` 4) Create a `.env` file: ```shell touch .env ``` A simple example to get started: ```python import torch import matplotlib.pyplot as plt import pandas as pd from gluonts.dataset.pandas import PandasDataset from gluonts.dataset.split import split from uni2ts.eval_util.plot import plot_single from uni2ts.model.moirai import MoiraiForecast, MoiraiModule SIZE = "small" # model size: choose from {'small', 'base', 'large'} PDT = 20 # prediction length: any positive integer CTX = 200 # context length: any positive integer PSZ = "auto" # patch size: choose from {"auto", 8, 16, 32, 64, 128} BSZ = 32 # batch size: any positive integer TEST = 100 # test set length: any positive integer # Read data into pandas DataFrame url = ( "https://gist.githubusercontent.com/rsnirwan/c8c8654a98350fadd229b00167174ec4" "/raw/a42101c7786d4bc7695228a0f2c8cea41340e18f/ts_wide.csv" ) df = pd.read_csv(url, index_col=0, parse_dates=True) # Convert into GluonTS dataset ds = PandasDataset(dict(df)) # Split into train/test set train, test_template = split( ds, offset=-TEST ) # assign last TEST time steps as test set # Construct rolling window evaluation test_data = test_template.generate_instances( prediction_length=PDT, # number of time steps for each prediction windows=TEST // PDT, # number of windows in rolling window evaluation distance=PDT, # number of time steps between each window - distance=PDT for non-overlapping windows ) # Prepare pre-trained model by downloading model weights from huggingface hub model = MoiraiForecast( module=MoiraiModule.from_pretrained(f"Salesforce/moirai-1.0-R-{SIZE}"), prediction_length=PDT, context_length=CTX, patch_size=PSZ, num_samples=100, target_dim=1, feat_dynamic_real_dim=ds.num_feat_dynamic_real, past_feat_dynamic_real_dim=ds.num_past_feat_dynamic_real, ) predictor = model.create_predictor(batch_size=BSZ) forecasts = predictor.predict(test_data.input) input_it = iter(test_data.input) label_it = iter(test_data.label) forecast_it = iter(forecasts) inp = next(input_it) label = next(label_it) forecast = next(forecast_it) plot_single( inp, label, forecast, context_length=200, name="pred", show_label=True, ) plt.show() ``` ## The Moirai Family | # Model | # Parameters | | :---: | :---: | | [Moirai-1.0-R-Small](https://huggingface.co/Salesforce/moirai-1.0-R-small) | 14m | | [Moirai-1.0-R-Base](https://huggingface.co/Salesforce/moirai-1.0-R-base) | 91m | | [Moirai-1.0-R-Large](https://huggingface.co/Salesforce/moirai-1.0-R-large) | 311m | ## Citation If you're using Uni2TS in your research or applications, please cite it using this BibTeX: ```markdown @article{woo2024unified, title={Unified Training of Universal Time Series Forecasting Transformers}, author={Woo, Gerald and Liu, Chenghao and Kumar, Akshat and Xiong, Caiming and Savarese, Silvio and Sahoo, Doyen}, journal={arXiv preprint arXiv:2402.02592}, year={2024} } ```