---
# For reference on model card metadata, see the spec: https://github.com/huggingface/hub-docs/blob/main/modelcard.md?plain=1
# Doc / guide: https://huggingface.co/docs/hub/model-cards
{}
---

# Model Card for viral-sequence-prediction
This model was a part of the University of Virginia's NLP course final project: NLP for social good. Using publically available data from the [NCBI virus data portal](https://www.ncbi.nlm.nih.gov/labs/virus/vssi/#/), we designed an LSTM-based classifier that can predict the virus of origin for any arbitrary protein sequence.

Specifically, we were interested in classifying COVID v Flu.

### Using the model
Code for the model can be found at: https://github.com/nleroy917/CS6501-final

You can use the `train.ipynb` notebook, or use the code directly:
```python
from dna_classification.models import DNASequenceClassifier

model = DNASequenceClassifier("nleroy917/viral-sequence-prediction")

virus = model.predict("MGYINVFAFPFTIYSLLLCRMNFRNYIAQVDVVNFNLT")
>>> COVID
```