--- license: mit language: - en library_name: transformers tags: - esm - esm2 - protein language model - biology --- To use try running: ```python from transformers import AutoTokenizer, AutoModelForSequenceClassification import torch # Initialize the tokenizer and model model_path_directory = "AmelieSchreiber/esm2_t6_8M_UR50D-finetuned-localization" tokenizer = AutoTokenizer.from_pretrained(model_path_directory) model = AutoModelForSequenceClassification.from_pretrained(model_path_directory) # Define a function to predict the category of a protein sequence def predict_category(sequence): # Tokenize the sequence and convert it to tensor format inputs = tokenizer(sequence, return_tensors="pt", truncation=True, max_length=512, padding="max_length") # Make prediction with torch.no_grad(): logits = model(**inputs).logits # Determine the category with the highest score predicted_class = torch.argmax(logits, dim=1).item() # Return the category: 0 for cytosolic, 1 for membrane return "cytosolic" if predicted_class == 0 else "membrane" # Example sequence new_protein_sequence = "MTQRAGAAMLPSALLLLCVPGCLTVSGPSTVMGAVGESLSVQCRYEEKYKTFNKYWCRQPCLPIWHEMVETGGSEGVVRSDQVIITDHPGDLTFTVTLENLTADDAGKYRCGIATILQEDGLSGFLPDPFFQVQVLVSSASSTENSVKTPASPTRPSQCQGSLPSSTCFLLLPLLKVPLLLSILGAILWVNRPWRTPWTES" # Predict the category category = predict_category(new_protein_sequence) print(f"The predicted category for the sequence is: {category}") ```